Sorangium cellulosum So ce 56

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|162448440|ref|YP_001610807.1| peroxiredoxin [Sorangium cellulosum 'So ce 56']
    MSLQLGSIAPDFEQESTHGTIRFHEWAGSSWVILFSHPKDFTPVCTTELGAVANLKAEFDKRGVKPIALSVDDVDSHKRW
    SVDIEETQRTKLNYPILADVDRKVSGLYGMIHPQASDTLTVRSVFVIDPNKKVRATFTYPASTGRNFDEILRLIDSLQLT
    DSHSVATPANWKDGDEVVIVPSLQDPAVLAQKFPKGYNAVRPYLRLTPQPNR

    >gi|162448451|ref|YP_001610818.1| organic hydroperoxide resistance protein [Sorangium cellulosum 'So ce 56']
    MPVDVKYTTQATANGGRDGHAATADGALKVKLSTPKELGGAGGEGNNPEQLFAAGYAACFLGALKFVAAQEKARIPADAT
    VTATVGIGPRSEGGFGLDIGLRIALPGLERSQAEQLVEKAHQV
    CPYSNATRNNVPVRLEVA

    >gi|162448583|ref|YP_001610950.1| hypothetical protein sce0313 [Sorangium cellulosum 'So ce 56']
    MNKLISLTFLAAALAACTQPGEASAPAAAGAAAPQPEKAGAPKAKAADAPAAQAKAAQAKIGQPAPDFTLPDLDGKPVKL
    ADHKGKTVVLEWFNPG
    CPFVQLAHRKGGLKDVPAQQTQKGVVWLAINSGAPGKQGAAKEENVKAKGEFGMSYPVLIDEKG
    DVGRAYGAQRTPHMVVIDPQGTVVYAGAIDSTKGGEPEPGEQVTNYVDVALTELAAGKAISTKETEAFGCTVKY

    >gi|162448696|ref|YP_001611063.1| rhodanese-like domain-containing protein [Sorangium cellulosum 'So ce 56']
    MADIKRVSPQQAKKLIDEEGYLYLDVRSEPEYAAGHPSGAHNVPLMHAGAGGMKQNPDFLDVVRALYPRDAKIIVGCKSG
    QRSMRAAEAMVSAGYTAVIEQRAGFEGPRDAFGAITEPGWGPAGLPVETATPGGSYAELRKSAGR

    >gi|162448705|ref|YP_001611072.1| hypothetical protein sce0435 [Sorangium cellulosum 'So ce 56']
    MQSRMNYESVAPEAYQAMLGLSSYVKRCGLEKTLISLVFLRASQINGCAYCIDLHWKEARAAGEDERRLYMLSAWREAPC
    YSERERAALEWVEAVTLVAAEHVPDRVYDAVRQHFSEREIMDLTWAVVTINAWNRVVLATRAVPGSHRSAKREQA

    >gi|162448783|ref|YP_001611150.1| disulfide bond formation protein D precursor [Sorangium cellulosum 'So ce 56']
    MPALPPFSRLFLLLFLWCFLAACASGAVTPSAVERPKTVVLPAPSPTVAVAAEPEPEPGTAVPVTRAEPWWGEPLAPVTL
    VVWGDFE
    CPFTSRHMATLEQLKQAYGPDRLRIVWRHFPLAFHKNARPAHLAAETVFRLGGAEAFWKFHRLAFANQRALTP
    ASFEAWAAEAGVDRAAFRAAFDGQRHAPKIDRDLEAGQSVGIHGTPATFVNGVFVSGAWPVDKFRTLVDEQLRAAEDLRR
    SGVPEERVYAALSEQNKAPAPAPKPPSPPAPEDTTVWKVPVDGSPIRGNPGAPVTLVMFSDFE
    CPFCRKVAPTVDGLEKK
    YGAQLRVVFKHNPLPFHRRAEPAAELALEAKAQKGDAAFWKAYELLKTGPLEDADLAAHAKSLGLDVARAQRAIAARRHA
    ARIERDQRLADDLQARGTPHFFINGRRLAGAQPAEKFEALIDEQIARAAKLVAAGTPAAKVYDALQKDARAGDPPERILA
    PAPTRDNPGKGAKPGAKVTIQMFADFE
    CPFCMRVQATIDGIIAAYPGKVRVVFRHLPLPSHSRAPLAAEASIEAFRQKGE
    AGFWAMAQRLWQDQSENGLGREALERHAAAIGLDVAKFGAALDSGAHRAAVEADRKLAERLHITGTPSFAINDYFLGGAQ
    STRHFKRLVDQGARPARSPHEGVASRREQARGPAGCSAAGAGPARGSATGAGPARGSAIGAGPARGSAIGAGPARRCAAA
    AGSAPAAGPAPAAGPAPCGGRPDGIASVRGPPARVELRAGRYAESRITDRPRAGSDVARYPACAQGGGSPGDEGRGVSPF
    TARSMARGSTAGDLLPPRGYPAAVQWTSGFVRGDSRRGRRDFRTGPILLGGPG

    >gi|162448872|ref|YP_001611239.1| hypothetical protein sce0602 [Sorangium cellulosum 'So ce 56']
    MAHAIKENRMTKLRLYSAKACPFAHRTRLVLQEKAIDFELTEVDLQNKPRAFVDASLYGKVPAIEHEGHRIWESAIINEY
    LEEVFPEPRLLPREPGRRALARIWIDYANTRLVPAFTQLLRAETRDQEAAGRKALGDVLAFIEREALARSSGQGPYWLGA
    EVSLVDVSFYPWFERLPAVGRLRDFSIPAELTRLRAWIEAVQARPAVRAIQNPVEFYVERFAKFVKPAATTAA

    >gi|162448891|ref|YP_001611258.1| hypothetical protein sce0621 [Sorangium cellulosum 'So ce 56']
    MRSANALSSALGLTAFSGWLAARGGWLVAFGSLAAACGGVQPVPEGASTTVVSLRKIDCEACGAELVADLRERPGVYSAA
    FDRRRAEISVTASRSFDVAGTVKRLAADEGFEAVLGAGHGQYLGWATFPEGADARTIEDGGADIPDLGAQIVPGKVTVID
    FVAAW
    CMPCRKLDAHMVTVLEARKDVAYRKLDIVDWDSPLARRYLKQVSKLPYVIVFDTSGARVEAIAGLALDELDAAIE
    RGARR

    >gi|162449175|ref|YP_001611542.1| putative peroxiredoxin 2 family protein/glutaredoxin [Sorangium cellulosum 'So ce 56']
    MLKNLEGQRVPDVTFRTRVDGQWKDVTTKDVFAGKKVVVFALPGAFTPTCSSSHVPRYNELAEEFKRRGVDTIACVSVND
    AFVMDEWCKAQEADKIQFLPDGNGEFSEKMGMLVDKANLGFGKRSWRYSMLVDDGVIKKMFIEPEVEGDPFDVSDADTML
    KYLDPSSESPHDVLLFTKPG
    CGSCAKAKRLLDARKIPYEEVAASPRRLRAVSGKGTTPQVFIDGKHVGGADELEAYLAKA


    >gi|162449176|ref|YP_001611543.1| methylated-DNA--protein-cysteine methyltransferase [Sorangium cellulosum 'So ce 56']
    MTATAHGFLLFDTAIGRCGIAWGERGVAALQLPEAREPETRSRLLQRLPGARAAAPPPEVQRAIDAIVALLRGEASDLSA
    VALDMDRVPPFHRRVYEVARTIPPGATLTYGEVAARLGAVGSARAVGQALGRNPFAIIVP
    CHRVLAAGGKAGGFSANGGV
    TTKLRLLAIEGGQARGAPEAAPGGDLGFDPGAAVEHLRASDAALARVIDAVGPFAMRIDRTSSLFLALAESIVYQQLTGK
    AAATIFARVRALFPRAHEGPTPAQLLRASDEKLRGAGLSQAKLLALRDLARKTEDGELPTLAEVHGMEDEAIIERLTRVR
    GIGRWTVEMLLMFRLGRPDVLPVDDYGIRKGFALAFKRPEPPARADLEKRGARWKPYRTVASWYLWRAVDLARGG

    >gi|162449368|ref|YP_001611735.1| hypothetical protein sce1098 [Sorangium cellulosum 'So ce 56']
    MTLLRRRASVSALILLALSACGGDDAVSETGLSCGPGTKAAGGVCVPSATSPGVVCGEGTEDVDGACVPSATSPGVVCGE
    GTEDVEGECVPTALQSGHFLSPLVQLQSLHEVGSHTDEVRVRDDDLLLNCSYTFNVIDAEDPADMEVLAGGLKHTIPGDT
    RTPGCKHLAWDDDLVFTTHLGNIRNPAFLSGWDISDPEAPVQLPVLQEEGISYEGVDVANHNIFVGLHGDGLGVYRYDGA
    VGFTRVGSLGGFTNAWGVAARDNHVFVADGVDGLVTVDATDPTAPVELGRVATGGQAKGVVVDGDFAYVAAGSAGVAVVD
    ISDLARPVVVGRAEMPGTPLRLAYSDRRLFVAAWNDVRVYDVSAPAAPTFIAAVRIPRAFEYDDPDRELPTMRTFGVAAR
    GQDVFIGTWENPYSYRLEPDRLAPNIRLPESAARIDFGPVAVGDTKTLPLEVTNQGTAPLTLVDNWVSGSAFSVEPRQAR
    IAPGETIELNVTYLASATDQEIGYLHIASDDPAAPVRKSYLVGNAPGVSVGAPLPATTGTMLDGTTWTSEESAGGVLLLT
    YFATF
    CPVCANHLPDTEERFWLKYKDQGLQIVALNPREPVDQIGQVQAYCDNIKVSFPVGLEETASTYAAVTSNFPGPNP
    FPVDVIVGKDGIVRYASHEYDPDAMTAVIEQALAE

    >gi|162449420|ref|YP_001611787.1| nitrite reductase (NAD(P)H) [Sorangium cellulosum 'So ce 56']
    MRRKDLVIVGNGNAACRLLDELMSRGARDRYDITVFGEERGGAYNRVLLSKVLAGEAPDSIVTKPPAWYERNGVRLVSGT
    SVARIDTASRAVVAADGARQRYDVAVLATGSQPLVPPLEGMTTSEGDLRPGVFVYRTMDD
    CVRMRGCARAGDNAIVVGGG
    LLGLEAAKVLSDMGLHVTVIHVAKSLMNAQLDQMGGDMLEQHIERCGIFVRTGRTVEAICGEEAVEGCRLDDGSVLPADM
    VVLACGVRPRVDVARASNLPINKGIVVNDTMATQVPGIYAIGECAEHRGRLYGIVTPIWEQAAVLADVLTGANPQARYRG
    TKLYTRLKVAGVDVTSMGSTEPELESDDVLQVVETRKSTYRKLILRDGRLLGAQFVGNTAAAATLVQLFDRNDPLPADPL
    EALCPGGGAGPAAQAERVVCTCHKVSEATLREAIEGGACSLEAACAATKAGTGCGSCRGEVAQLVARHAPSPEVAGGRAV
    AVG

    >gi|162449598|ref|YP_001611965.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MAIYRCGRCGSINRVADQRVKDRPVCGRCKAHLDTTGAPQPVDGAALEQAIASSPVPVLVDYWATWCGPCRVVAPALDEL
    GRRNAGKVLVLKLDTDADPAEAGRRRIQGVPTFVLFSGGRELDRRSGVTSRADLERWIEARAGQPSTRASHA

    >gi|162449647|ref|YP_001612014.1| DSBA oxidoreductase [Sorangium cellulosum 'So ce 56']
    MKKLRVDVWSDIACPWCYVGKRRLEAALARFPRRDAVEVVWRAFELDPSAKRVLDTDVSYAGRLARKYGVPVAKAEAMIR
    QMTEVGAADGLDLRFDKVRPGNTFDAHRVLHLAAERGVQDAVKERLLRGYMTEGEAIGEPEVLARLAGEAGLDPDEVRAA
    LASDAHAREVRADEDEARAIGITGVPFFAFGGRYGVSGAQPAEALLGVLQKAWDEAADAPEQALAEGAACGPDGCA

    >gi|162450276|ref|YP_001612643.1| soluble pyridine nucleotide transhydrogenase [Sorangium cellulosum 'So ce 56']
    MVTTPHFDLIILGTGPGGEGAAMTAAKHGKSVAAIERYTRVGGGCTHWGTIPSKALRRAIYHMNLINQSPIYKRMDVVPE
    YPFAELLATANRVIDEQVDLRESFYDRNRVQLVPGQARFVDPHTIEVEGDGGQRRRYTADSFVIATGSRPYRPADIDFSH
    PRVFDSDTLLRMDHTPRSITIFGAGVIGCEYASMLRNMQVAVNLVNTRSHLLEFLDDEITDALGYHFCDKGIRVLNGEEH
    EAVEATKEGVVLSLKSGKKLRSEVFLWANGRSGNTADLGLESVGITPNKRGQIEVSETFQTSQPHIYAVGDVVGFPALAS
    ASYDQGRYAASHICGHADDKLVRDIPTGIYTTPEISSLGKSERELTAEKVPYEVGKSTFKTLARAQITGQQVGMLKLIFH
    RETLALLGIHCFGENAAEIIHIGQAIMSQPAPHNTIRYFVNTTFNYPTMAEAYRVAALDGLGRVF

    >gi|162450307|ref|YP_001612674.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MNSPAMAVPEINEQEFEREVLRSELPVLIDFTATWCGPCKTVAPEVDAIARELEGKAKVVKVDIDRSKRIATTLRIQAVP
    TFMVFHRGRPVAAEQGVLNRKQLRELLDPFLPRAEGAIRAAELAQLIREGQVVPVDTRETPAYGRAHIPGAVHIPIEEIE
    GRLAELHMLAGAPVLY
    CRSGDKSKDVAAKLAEEGVPVAFLEGGFLSWEAEALPIQRPD

    >gi|162450596|ref|YP_001612963.1| dihydrolipoyl dehydrogenase [Sorangium cellulosum 'So ce 56']
    MSPEQFDILVLGSGASGKHVAWHMAPAGGRTAVVEWEHRMIGGACPNTNCLPSKNEIWSAKVADLVRHAAAYGTVTGPSS
    VDMARVRQRKRNMVEALIAVHMERFRASGADLIIGKGRFVAPKTLEVRSDGKTRVLRGDRVFLNLGTHATIPDVPGLPAA
    GPLTHVEALELDRLPGHLIVLGGGYVGLEFAQAYRRFGSRVTLITRAPQLAPREDPDVAGALLQIFKSEGIEVLPSAQPV
    WVQGRSGDHVSVRVRSPDGEQTIEGSDLLVAAGRTPNTAGIGLETAGVELDARGYIKVNDRLETTAPDVWAMGECAGSPQ
    FTHAAVDDFRVVRDNQAGGHRTTRDRLIPFCMFTDPQLARVGLNEREAKSRGVEARVATLPMSDVLRAATTGETQGFMKA
    LVDARSDRILGFTMLGAEAGEVVAVVQTAMLAGMPYTGLRDAVLTHPTMAEGLGSLFAKVPARSTR

    >gi|162450609|ref|YP_001612976.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MSTNPVREIDEASFDAEVLEAGVPVLVELTAQWCPPCRALAPILHKLAEEGAGRLKVVAVDGDRCPAIARRLGIRAFPTV
    VAFAGGKEVARHVGLTTKDKLLRLIEGGGLPGGAGRDRAPSPP

    >gi|162450631|ref|YP_001612998.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MSTIELSAENFEKTVESNGIVLVDWWAPWCGPCRVFGPVFEKASEKHADIVFGKINTDEQKDLAQAFNIRSIPTLFIFRE
    KVLLFAEAGSLPASALDQVIEKVRSLDMDEVRAKIAEEEAKEAAGGDSAGEGP

    >gi|162450797|ref|YP_001613164.1| hypothetical protein sce2525 [Sorangium cellulosum 'So ce 56']
    MAAHKNRLASESSPYLLQHAHNPVAWYPWGAEALDLARREDKPILLSIGYAACHWCHVMERESFEDEAIARHMNDLFVNI
    KVDREERPDLDHIYQLVVQLMGRSGGWPLTVFLTPDQRPFFAGTYFPPKDALGMPGFPKVLDKIADAFRNRRDDVEQQAQ
    EITEAIERAQRAPARAAGVAAPASSDLLRRASRQLLARLDPRHGGIGSRPKFPNTMALDVLLRRGVLESDRVAAEGVELT
    LDRMRDGGIWDHLRGGFHRYSTDERWLVPHFEKMLYDNALLLRLYADGFRAFKKPIYAETAREIVGYLFAEMRDPEGGFY
    ASQDADSEGREGKFFVWTLEQLRDAVGEDQLAYDMARLVFGISEEGNFEDSGATVLSQHRTLEQAAAVIDDGAGGGPSTH
    LDRCRDALARARVAMLAARDARPRPARDDKVLASWNGLLIGALADAGRALDEPAWVDAAARAFALLERKLLRGGRVGRYL
    KDGAPAGANREHGGSGAAVGDVRPGFLDDQAYLGNAALDLYEATSDPRYVDVARAIADAMIAHHWDEAAPGFFFTPDDGD
    ALIARTQDIYDQAAPSAASMAALLCLRLSEIADERYLSPAERQLDVLAPTALENAFGLGQTVCVLDRLTRGAVTVVVVGE
    AGSASAAELTREAFKVYLPNRAIVLVDPARPESAAAVEVVAEGKPARPDGAVAYACRGRTCSAPVTTAADLKALLA

    >gi|162450859|ref|YP_001613226.1| Thiol-disulfide oxidoreductase resA [Sorangium cellulosum 'So ce 56']
    MPFPGHDQILRLDKIGTFAPAWRSLTTVGGTVPANIGTLRGNVVLLDFWATWCAPCRLMAPQLSAWHAAYAAQGLRVVGV
    TTDDVSVATKTAQALSMRYAVAADASESTSAAYGVKALPTMFVIDKKGVIRDVVVGYDPTRHAEVEKLLKALLAEPAPAP


    >gi|162451010|ref|YP_001613377.1| thiol:disulfide interchange protein tlpA [Sorangium cellulosum 'So ce 56']
    MRARSRLRAIAAAAGVLILVQALAVGLYWAVERRRGAERPGRPFAVERLHDGQRVPDAAFERPDGSTLRAAALRGRPVLL
    HFWATW
    CGPCRAELPRLLELGQQLEKAGRLQVVAVSVDESWEVVRAFFGGEVPPGVVRAGSPAVQQRFGVSTLPDTFLVE
    ADGRMSLRFTGARDWRAPEATTLLLGQERPAP

    >gi|162451130|ref|YP_001613497.1| ahpC/TSA family protein [Sorangium cellulosum 'So ce 56']
    MRPSPSPSFARVLAALCASLALSLAGGCGGAAPVAPPAPETGGGLIGSAAPELAAEVVSGEGPSTLKDARGKVVIVDFWA
    TY
    CRPCRRSFPKYQELVDRFGGNLAVLAVSLDAPEDVSTEQIAGFADEAGVRFKILWDKDQRAEKAYRPRRMPTAFVVDR
    GGVVRHIHAGYEDGEEDKISREIEALLGPAAAPPPADGGRRSP

    >gi|162451230|ref|YP_001613597.1| putative secreted protein [Sorangium cellulosum 'So ce 56']
    MNKGTAIVGFLLCFIAGMGLMWSIDRSAGSRGHEISAVHEDGQPWTDEDAAVPVSSKDPMWGTRAAPVTMVVFSDFECPF
    CTKVETTINQLKDKYGPEKLRIIWKNNPLPFHKNARPAALAAETVFRLGGSKAFWKFHELAFQNQKSLTPENFEKWAGDA
    GVDRAKFKAAFDRQEYMAKIDADMAVGKSSGVTGTPASIINGVFLSGAQPIDKFTSVIDEQLKAAQAAVAAGTKPDKVYA
    KLAAENKAKAPPQKDRERPQEDDKTVWKVPVGDAPAKGPATALVTIVEWSDFQ
    CPFCSKVVPTIDEILTTYGDKVRFVWK
    NNPLPFHQRAEPAAELAMEARAQKGEKGFWDAYYLLWKNQQKLNDEDLLGYAKELGLDVEKVKAAIATKKFGASIAADQE
    LADDLQASGTPHFFINGRRLVGAQPIDKFKTIIDEEIKKSEALLAKGVAAKDLYAEIIKDGKEPPPPERKEVSAPAPNSP
    WKGGERAKVVMQVFSDFE
    CPFCKRVEDTVSQISKTYGDKLKIVWRHRPLPMHKNAPLASEAAQEAYTQKGNAGFWAYHEV
    LFKNQGQPDAFSRASLEKYAEEQGLDMTKFKKALDANTHKAFVDSENSVADKAGISGTPAFVVNGYFISGAQPFSKFKKL
    IDKAMKEAGETAPAGLPAKRPAPATQPAAAPAAPK

    >gi|162451251|ref|YP_001613618.1| hypothetical protein sce2979 [Sorangium cellulosum 'So ce 56']
    MSDIHQAIKDTVESNRVVLFMKGTKTFPQCGFSARAVDILKKCGVDFKDVNVLSDPSLRQGIKDYSQWPTIPQVYVDGKF
    IGGSDILMEMFQSGDLQKLLSKQD

    >gi|162451800|ref|YP_001614167.1| hypothetical protein sce3527 [Sorangium cellulosum 'So ce 56']
    MDAAPAPQRPLVAIRYCPKCRWLTRAAWLAQELLITFPDEIDVLLSPGESGTFDITLDGAPLFSRAVEGRFPEPKELKQA
    IRDRVAPERPLGHSDR

    >gi|162452131|ref|YP_001614498.1| molybdopterin biosynthesis protein MoeB [Sorangium cellulosum 'So ce 56']
    MPTTYSDLISDVRKSIRELSLTELKRRLDDKVPMVLLDVREKEEYRAGFIPGAISIPRGFLEIQVEQRLPDKSAHIVAYC
    AGGTRSALAAKTLQELGYTNVESANPGFSRWKDMAYPVEMPPSLTDAQRDRYSRHLLLPEVGEAGQAKLLASKVLLLGAG
    GLGSPAALYLAAAGVGTIGLVDADVVDNSNLQRQILHATSRVGKPKVDSAEIAIRDLNPDVKVVKFQERVDSGNVDRIFE
    QFDIIVDGCDNFPTRYLVNDASVFKKKPVVHGSIFRFEGQVTTFMPGVGPCYRCLYPEPPPPHLAPS
    CQEAGVLGILPGT
    VGMIQATEAVKLILGKGTPLIGRLLTYDSLRMKFGELKLRRDKNCPVCGESPTITSYIDYEGFCTLG

    >gi|162452286|ref|YP_001614653.1| cation-transporting ATPase [Sorangium cellulosum 'So ce 56']
    MATIPQPVQQTSAKAAPAAQGARTELPVQGMTCAACVRRVEKALRAAPGVQDAAVNLVTRRATITYDAQATTPAALASAI
    VEAGYEVPEVPSAASFPEAAPTAGLPAAPQADGGPATSPIAGVRATSTAPERPAATADVPPPRPQSSAADRAAAMDAAEQ
    KEQRTLRRDVAIAALLTAPLLAMAMSHGAIPAFDGALARWLSLALATIVVFGPGRRFFRLAWSALRHRAADMNTLVSLGT
    GAAWLYSTAAVAAPGLFPHAEHGHAPPVYFEAAAAIVTFVLLGKLLETRARKRLADAVRGLVALQPKTARRVRGDAEDEV
    PASSLAPGDLVRVRPGERIATDGEVVDGASAVDEAMLTGESMPVDKTAGSVVLGGTLNQSGALVFRVTKTGADTALARIV
    EAVEQAQGSRAPIARLADVVSGVFVPVVLGVASLAFAAWLAIDPTAAGLATAVERFVAVLVIACPCALGLATPAAVAVGT
    GRGAELGVLVKGGAALEAASRVDTVLLDKTGTLTSGRPELTDVVDLAGHGEAALLGLVAAAERESEHPVARAIVEGARGR
    GVGMAPASAFRAEIGHGIEARVSGRLVRIGTAAWLKRAGVDTAALETEADRLAALGRTPSFVAVDGRLAGLVAVADRPTE
    EARRAVAAMDELGVEVAMVTGDRAGAAHAVADELGIRAVFAEVRPEDKARIVRDQRAAGRRVAMVGDGINDAPALAGADV
    GIALGSGTDIAVASADVALIRGGIAGLPVALGLARATLRTIRQNLFWAFIYNVIGIPIAAGLLYPFTGWLLSPVLASAAM
    SLSSVSVLTNSLRLRAFGRP

    >gi|162452408|ref|YP_001614775.1| methyltransferase [Sorangium cellulosum 'So ce 56']
    MTEFLPGQGTQSHWRTQIHNQLRLLSLLVLPSKNRAHILYEIMSTGNLLNEKSLFLNYGYWRDSPETLDAACEAMAKLVA
    ETARVSRGDRVLDVGFGFGDQDMYWMKHFEPRQIVGLNVTEMQVDIARRRVAERGLSDRIDLRVGSATEIGFEPASFDKV
    LAVECAFHFQTRERFLEEAFRVLRPGGRIAMADMTVFPFEGPPTVATKLSHFMVRSLQQI
    CKENMVSRHVLRDMMTRIGF
    QDVEITVIHDDVVMPFSRYIVKRVQDDEIKRRLPAFSRALTLKGAQVTLEGKHPERGLEYVLISATKPLAAA

    >gi|162452642|ref|YP_001615009.1| putative rhodanese-related sulfurtransferase [Sorangium cellulosum 'So ce 56']
    MASTAMVQQISVKDLFLKLKAGEPVYLLDVRTPGEHEIAALPGSTLIPLNELVERADEVAPGEGALVVAYCHHGVRSLSA
    AALLEKLGHERVASLQGGIDAWSIHIDESVPRY

    >gi|162452839|ref|YP_001615206.1| hypothetical protein sce4563 [Sorangium cellulosum 'So ce 56']
    MSNRAVYRAWMLGLAIASAVSAGAGCASPPKQPATAEDARQRTLLFNVTSGQEDVHAATMALMAASNSLDAGWSTILYFN
    VHAAALASRNLSDSVALAGERPVKELLAAAIAKGAKVFV
    CPHCMQVAGVKAEELVEGAKPAALQAVLDQLHGDVISLSY

    >gi|162452894|ref|YP_001615261.1| peroxiredoxin [Sorangium cellulosum 'So ce 56']
    MLGKSTLSVGETAPDFSLQSQKRETVKLSDFRGKKTVVLFFYPKDDTPGCTAESCAFRDHYDAFAEAGAEVLGVSADSAG
    SHQQFADKYRLPMTLLSDPGGETAARYGVKSLFGLLPGRVTFVIDRDGIVRHAFSSQLRATRHVDEALAVVKQLEASRRG


    >gi|162452920|ref|YP_001615287.1| rhodanese-like domain-containing protein [Sorangium cellulosum 'So ce 56']
    MIQTISPRDADELIKSGEVDVVDVREPREWSVGHVPHARLVPLDQLRADPQRALPRDRVVFVCAKGARSLTAAKLAERLG
    LNQLYNLDGGTSGWVKAGLPLEHS

    >gi|162453241|ref|YP_001615608.1| glutathione transferase [Sorangium cellulosum 'So ce 56']
    MKLYFAPLACSLATRIAFYEAGAEVSYVEVDLKTKRTEGGADYRAIHPLGFVPALEIEGGEILAENAAILQLVADRFPQA
    ELAPRDPLGRARLQQWLGFIGSELHKAVYMPLLDKTASAEVKAHALAGAPRRLGWVADRLEGREFLLDRFSVADAYLFAV
    LNWSVVTPIDLKSWPALAAYHARLHGRPSVARAFAEEREGYFREQARHAKAAEAAFAPAPSI

    >gi|162453285|ref|YP_001615652.1| bacterioferritin comigratory protein [Sorangium cellulosum 'So ce 56']
    MKRRFPIAVVFVVLAVVFAFASLLGCGAAERPDGGQGLIPVGAAAPDVFAADQHGAIQRLSDQRGRAVVVYFYPKDGTPG
    CTEEACAFRDAWDRFKQANVQVFGVSSDTRESHEKFATENKLPFPILVDTDHAWATAFGVPMRLGATARVTFLVDPDGKI
    AKVYPDVDPGVHADEVLKDAAQLTGAALPVAPAASGSAAPAAPDTAAPAATGAPPAAAPAGAAEPATAAPVATGTMLPPA
    APAAPPAKGPPAKGSPARR

    >gi|162453658|ref|YP_001616025.1| hypothetical protein sce5382 [Sorangium cellulosum 'So ce 56']
    MSQTAASPHFPAHTLHTAPAAARPALERASRKFGILPLPLARFATSPLLVRAFDELLAVFEGATLSPVEREVVVMVVAGE
    NGCDL
    CRTMHRGLLLRAGASPEVAAALFERRPAPDARLQALAAFTEATLRERGQVPDADLDAFLRAGFTAEQALEVIVGI
    GTTTLSTFANRMTRSHALR

    >gi|162453668|ref|YP_001616035.1| peptide methionine sulfoxide reductase [Sorangium cellulosum 'So ce 56']
    MADKKISKTEPEWLLLLGPHRYRMLRYGNTERPYTGQYWNHHGTGVYRCAGCGTQLFSSQTKFDSGTGWPSFGAVLDEKR
    IERRADRKHGLDRVEVVCARCDGHLGHVFDDGPAPTGERF
    CINSACLEFESE

    >gi|162453888|ref|YP_001616255.1| hydrolase [Sorangium cellulosum 'So ce 56']
    MHLHRMKTPGLAHIAYLLGNKGEAIVVDPRRDIDEVLAAARERDLVIKFILETHRHEDFVIGSGALAKAAGAKIVSGDHP
    LFGQSDIRMRDGEELDLIGLRIRALHTPGHTPESTCYAVFLPDVPGRAFGVFTGDTLFIGETGRTDLPDREKTSDNARLL
    FASVHEKLLPLGDQALVWPAHGSGSVCGGNIAERDDSTLGLERAYNPVFVRSADDFARAKVAERIPRPPYFSLMERLNLE
    GGKPLSVKPGEVPFLPPSKFASESKQGLVLDARDPEAFASGHLPGSLNLWFAGLPVYMYVGYLDEHFEKVQPALPRHGRI
    ALV
    CSVGHRAGLATSVLRRRGFTEVANVLGGMTAWGKLGLPTKQGPERTIATMDIEGARR

    >gi|162453889|ref|YP_001616256.1| hypothetical protein sce5613 [Sorangium cellulosum 'So ce 56']
    MSSQAGARWAPEIAGLAIGALETFAMGTAKRPLGVTSAFETGASALARRLAPQASRVNEFVAKRETTPKIDWEVLLAPGI
    VLGAFLASRASGTRGSTLPDAWRARFGESRGKRYAAAFCGGALMMFGARLGKG
    CTSGHGISGTMQLAAASPLVKNDGLDR
    PRPPRRLRNDPSARSRPPRRFRNDLGSGGGFDCFLAARQVGPEGRVIGVDMPRSGAAVRVIRRRP

    >gi|162453898|ref|YP_001616265.1| putative methyltransferase [Sorangium cellulosum 'So ce 56']
    METEHQSRVREDYGKAAAEAQTLCFTNAYKNIDLRWVPAEVLDRNQGCTSPFGGMEMGLRRGDVVVDLGSGAGLDAFIAA
    KQVGRSGRVIGIDMTPEMLEVARRNIDPVTRALGYDEPNVRFEQSVIERLPLADSSVDVVLSNCVINLCEDKRDAFSEIF
    RVLKPGGRFVISDVFCPQEVPMYMKNDRALISA
    CIGGAMAIPSLLRLTRACGFRGLTLSHSGNYSRIDGVDFLSLTVSGY
    KHERPSEGTMYAALIGPCSMVTDEDGTTYERGKLVEVSAATAAMLQRPPYRDYFFVAATPRKIDASSCKGILPEPGPCVY
    VGEYATLLGPFTQVRDDDGHVFEAGLPVEICEKTSRVLHFPLYERLFTLVNRAQQRPDALSVQCGPSCC

    >gi|162454000|ref|YP_001616367.1| thiol peroxidase [Sorangium cellulosum 'So ce 56']
    MAETKFKGSPIHTAGELPSVGATAPDFTLVKTDLSERKLSSYSGKKILNIFPSVDTPVCARSVRTFHERAEKLPGVTVLN
    ISADLPFAHTRFCASEGISNAEGLSTFRGDFGQKYGVTLVDGPLAGLLARSVLVLDEQNKVLHVELVPEIAQEPDYDAAL
    AKVQ

    >gi|162454024|ref|YP_001616391.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MGSSHVIEVNDLNFAQEVLQTDTPVLVDFSASWCAPCKRLAPIVDEIAAETAGEVKVVKLDVDASPEAAQRFGIRGLPTV
    VAFQKGEPVGRHVGLTNKKTLLALLGR

    >gi|162454032|ref|YP_001616399.1| putative adenylyltransferase [Sorangium cellulosum 'So ce 56']
    MSGGGEAIRGCVLLVGAGGIAAPAGLALAAAGVRELRVADDDQVELTNLHRQILFDDDDVGRPKLDAFTEALRRRFPGLR
    VDRRYGRFTPSAAAGLMPGVSVVVDATDNFASRFLIADVCRLTRTPVVHAAAIRWRATVMAVAGEGAPCYRCLFEDLPTG
    DAPD
    CATAGVAGPVCGVAGAIAADRALAILAGDASIFGRIATYDGRTDTLRSVPVSARPACDLCGARAAIATIDASRYVV
    ACAAESGSPTHVEGDREGGSPTHVEGDREGGSPTHVEGDREGGSPTHVEKDREGGSPTHVEGDREGGSPTHVETEKDREG
    GSSTHLKTGEQDHG

    >gi|162454146|ref|YP_001616513.1| hypothetical protein sce5870 [Sorangium cellulosum 'So ce 56']
    MITITQKAAEKVMEIATAEELLGQGLRLRVVGGGCAGFSYDLYFEDKPTEFDEEFEDRGIKLYIDPLSFQYLDGTEIDYV
    EGLHGSGFKFSNPSVKSTCGCGSSFSV

    >gi|162454243|ref|YP_001616610.1| hypothetical protein sce5966 [Sorangium cellulosum 'So ce 56']
    MSVEIGKPFPRFALPNQDGKTVKLEDFAGKWLVLYVYPKDDTPGCTIQGKSFTASKADFDDANIAVVGVSEDDVTSHKSF
    CDKFSFTIDLLADTRHELLKAAGVGQSEWKGTLYWDRTTFVIDPSGVLRRTYLKVKPDGHEQALLKDIAELKAQA

    >gi|162454317|ref|YP_001616684.1| ArsC family protein [Sorangium cellulosum 'So ce 56']
    MRHFVRRRRRRRARAMNRNRRRSIGELLVSGRIPGAFRAHCTGALFFLSCYARAFHLLFHAHPGLMSRGRGGRRPGMSKV
    QILSYAG
    CSTCKRALKWLGERGVDVAVRPIVDEPPTAAELARWVPASGLSVRRWLNTSGQSYRALGKARVDAASDDDVTR
    WLTEDGKLVKRPVLVKGNRVLVGFREDDYAALFG

    >gi|162454350|ref|YP_001616717.1| putative thiol-disulfide isomerase [Sorangium cellulosum 'So ce 56']
    MARTPSTMLELGTPAPDFRLPDFTGKQVALSDFKAQRALLVMFICNHCPFVKHIRHELARLRRDYGADDVAIVAINSNDI
    VAYPADNAEAMAREAREVGYTFPYLLDEAQQVARAYRAACTPDFYLFGPDRRLVYRGQLDDSRPGNDVPVTGRDLRAAID
    AVLSSAPVPSEQRPSIGCNIKWKPGNEPGYHGRTP

    >gi|162454455|ref|YP_001616822.1| antioxidant protein [Sorangium cellulosum 'So ce 56']
    MLKVGERAPEIDTLAIDGQRFVLSAQGGLCTVVYFFPKAFTPSCTVEAQLFRDNHAEIALAGASIVGVSTDDHRTQCRFA
    EAQKVPYPMIADRDRSVCRAYGVLWPLIGLARRITYVVTPALEIAAVFHHELQARKHRDDVLSFIDKRFRAARPSAG

    >gi|162454482|ref|YP_001616849.1| putative Thiol-disulfide oxidoreductase [Sorangium cellulosum 'So ce 56']
    MYGGGHQPQRVRLVGGLSAVSPARKSGALRGAFAALAVAAGLAGGCDADKKADLPPPPTPGQGRSNAVTAPGAAAPASAR
    APASATAEAAPAAPRLLCAGQSPRPAPSSGGLTAVAASGAEKLPANIGFGVGKWVWVNFWAAW
    CKPCLEEMPRLLGWQQK
    LRAAGVLVDLAFVSIDDDERQLSRFLEAQPGTGVRASYWLPDGPQRAGWLRALGVKETTELPIHAIAAPSGQVTCVIQGA
    VEDSDYPTIAALLGSKKP

    >gi|162454484|ref|YP_001616851.1| O-6-alkylguanine-DNA/cysteine-protein methyltransferase [Sorangium cellulosum 'So ce 56']
    MDLLLDEVESPLGVMLLAAGGGAVHGLDFADCAPRLRTLLEARYGAVTLRSAADPHGLSGRLRSYWRGDLGALSGVPVEP
    GGTPFQRRVWAEVQRIPPGATRSYGEVAASLGQPSASRAVGLANGRNPVCLVIP
    CHRVVGARGDLTGYAGGIERKRWLLA
    HEGASGEAGERLVRH

    >gi|162454753|ref|YP_001617120.1| glutaredoxin-like protein [Sorangium cellulosum 'So ce 56']
    MSLSEPMRARIATIIRESDVVLFMKGTRTVPQCGFSATVVNILDEHLPEYQTVDVLSDPALRDGIKEFSSWPTIPQLYVR
    GEFIGGCDIVKELHATGELVKALGLAQGEAQAPPTLRVTAAALAAFAAAKESEADFVHIEIDPSYNYGLYFGPRQAGDVE
    AQAGGAVFLLDRASARRAEGLSIDFVEGPSGGGFKLESPNEPPKVKQISSTALKALLNSGEAIELFDVRTEQERKIATIE
    GARHLDQAGQRYLETLAKDARIVFH
    CHHGGRSQAAAEHYLTKGYRNLYNLQGGIDAWSQDVDPSVPRY

    >gi|162454811|ref|YP_001617178.1| hypothetical protein sce6529 [Sorangium cellulosum 'So ce 56']
    MKREAGGARGARIAGVLLAIAAAALGPACKEKRDDGTTPAQAVAELPPLELRDDTANLMLTWIDEKGDTHVELHPADVPA
    EGRALVRAMLSDRTEGTRDAFYVADLTQKRPDGTYAVRTMPRREWESLLEKRRAEHIAKTAPPPAATPGPGGSAGAGAPG
    APSHLAGVTVIIYGASW
    CKPCHQAADYLRSKGIAAVVKDIEEDAGAAAEMQDKLAKSHQRGGSIPIIDVRGQILVGFSPG
    AIDQALARAAGGTTL

    >gi|162454843|ref|YP_001617210.1| glutathione-disulfide reductase [Sorangium cellulosum 'So ce 56']
    MSKYDYDLFVIGAGSGGVRAARMAASYGARVAVAESRHLGGTCVNLGCIPKKLLVYASHYAEDFEDAAGYGWTVPGHGAS
    GNGHAGPSFDWPTLLRNKDKEIERLNGVYERLLKNSGADVRRGHARVVDPHAVEIDGARITAERILVATGSYPWIPDLPG
    RELAVTSDDLFHFQTMPRRAVIVGGGYIAVELAGILHGLGAKVSLIHRGLHLLRGFDDDIRAFLAAEIQKKGLDLRLGAS
    VESLARQGDALVATLADGTELAADCVLYATGRLPKTKGLGLEEVGVKLDEEGAVVVDDAFQTSVPSIYALGDVISRVQLT
    PVAIAEAMALVKTLFRGERARVDYAGIPTAVFSQPSVGTVGLSEAQARERHDVAIYLSTFRALKHTLSGREEKTMMKLVV
    DRATDRVLGVHMVGPDAGEIVQGFAVALKCGATKAQFDATIGVHPTAAEEFVTMREPLRNADRSPTPMGIAPSSA

    >gi|162455194|ref|YP_001617561.1| thiosulfate sulfurtransferase [Sorangium cellulosum 'So ce 56']
    MLDPLLVAPGPLVDVAWLAAHAGDPRVRVVDCRWYLGGRRGADEYARGHIPGAVHLDVDADLSSPAHGGPGRHPLPDAAA
    FAHVLARIGVTPGSVVVGYDDAGGAIAARLWWLLRYFGHPGGRVLDGGLQAWTSAGHPLSTGAPTIAEAPAMDLAPGGAP
    VADKAAVDRLRRDSAAVILDARARERYEGQSEPVDARPGHIPGARSAPFVENLGAPGGAFRERAELERRYRDLGALDAHT
    VVCY
    CGSGVTACHDLLALATLGREDAILYEGSWSDWARDAALPAARGPEP

    >gi|162455211|ref|YP_001617578.1| thiol:disulfide interchange protein DsbD [Sorangium cellulosum 'So ce 56']
    MTASTRFKASAGAAPAGVRRGALGRALPALAALSALASPAIALAGDERDLFTRGLEAGPLFAALAALAGGLLTCLTPCVY
    PMIAITVSIFGAREAKSRREAMLLSTSFVLGIVVLFTTMLVAAALTGSLFGGVLSNRWVIVGIAAVFIALSLSMFGAFEM
    TLPDTLMQRLSQVGGIGYGGAFLLGLVSGLVAAPCTGPVLTGIILWIGKTQNVGLGALVGATFSLGLGLPFWLVGAFAFA
    LPKGGKWMLGVKSFFGIVMMVVALYFLKTTFPALSSLAQPTPQFMAIMAGLVAVGLALGAVHLSWDDGGAGVKARKGVGI
    ALTVASSFLLVASLDLPKLASPVPSAVAGEAVSPQLTWLHEEPVAVSKAKAEGRPLLVDFTAEW
    CGACKQLAKETFSDPR
    VMAKAAHFVAVKVDATDDEDPQIDAVKGKYKVVGLPTVVLYDSTGAERKRFNDFVGPDVFLAALEGIQ

    >gi|162455241|ref|YP_001617608.1| alkyl hydroperoxide reductase, C subunit [Sorangium cellulosum 'So ce 56']
    MSLINTRIKPFKATAFHQGKFVDVSHESVLGKWSLFVFYPADFTFVCPTELEDLADLHGEFQKLGVEIYGVSTDTHFAHK
    AWHDTSAAIKKVKYPLVGDPTATLSRNFGVLIEEEGLALRGSFLVNPDGVIKVYEIHDLGIGRSAAEMLRKVKAAQYVAT
    HPGEVCPAKWDEGAKTLKPSLDLVGKI

    >gi|162455242|ref|YP_001617609.1| alkyl hydroperoxide reductase subunit F [Sorangium cellulosum 'So ce 56']
    MLEDSIKTQLRDVLGRLTRPVAVTAFVDDSQGSEEMRALLRDVASASSLVELHERREGAERTPSFGIHSPGEEPRVIFAG
    LPLGHELTSLILALLHVGGHPPRVSAEALEQIARIDGELRFETYFSQS
    CQNCPDVVQALNLMAAKNPRVRHVAVDGALFQ
    GEVEQRKIMAVPTVFLNGEPFGQGRMEIEQILAKLDDGSAVKKRAEALDQRKPFDMLIVGGGPAGASAAIYAARKGLDTG
    IVAERFGGQVMDTLAIENLISVVETDGPKLAAALEQHVRAYPVELLKHERVTSITPGSPFELRLASGATLRAKSVVLATG
    ARWRDMNVPGEAEYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVGHVTLLELAPALRADAVLVRKLKSM
    PNVEIVTRARTTEVVGDGQKVVGLRWEHTETKEQHQIEIAGVFVQIGLLPNTGFIKGTVELNGLGEVVVNDRGQTSVPGL
    FAAGDMTTTPFKQIVVALGDGAKAALGAFEYLIRATAPAE

    >gi|162455386|ref|YP_001617753.1| bacterioferritin comigratory protein [Sorangium cellulosum 'So ce 56']
    MVNAGDRAPDFSLESDSGKTVGLADFPGKTVVLYFYPKDDTPGCTREAQAFSAALRAFAEAGAVVLGVSRDSVERHRKFR
    DKYDLGVTLLSDPDLAAHNAYGVYGEKSMYGKKVMGTIRSTFIIGPDRAVKHAFSAVKVDGHADEVLALVRGGGGREAPP
    APGARAPAKSAAKAPAKSAAKAPAKSAAKAPAKTR

    >gi|162455515|ref|YP_001617882.1| thioredoxin family protein [Sorangium cellulosum 'So ce 56']
    MSLHRVIANYQFVGYANAAEHNDTMQPIQLADFYNPTGTEVFPEGSLYGAGEPKPKVLLIDVSSVWCGPCKIEAESVLPE
    LYKKYQPQGGEFLVQLADGRTPGEAAVPNDLYRWTTRYDVQYPSAIDPSYKLGALFQADAFPANMIVRTQDMTIMEIVAG
    VPEANSNFWRTFEKIMNGEL

    >gi|162455516|ref|YP_001617883.1| resA protein [Sorangium cellulosum 'So ce 56']
    MPVGRSGRPLRDGNSMNRKTRCALSLASIVLGLAAASCGAASGGSSASPAPDFSLPALDGKTVRLSDYAGKSVVLIDFWS
    TT
    CDPCLAEMPHLVELYKKHRDKGFVVLAVSLDGPESRAQVSSTVHDREMIFPVLLDEETTVAARYNPKRELPFSVLIGR
    DGSILHKRGGYQPGDEAALTEQVEKALGL

    >gi|162455613|ref|YP_001617980.1| hypothetical protein sce7331 [Sorangium cellulosum 'So ce 56']
    MQSSEQTTTKPADTGPHAAHTATADGAPARSDGASGEAEAKSKRTLSVSDAAVQAIRAQLAKRGTPEGAIRVGIRGGGCS
    GFSYVIEFEDKPPRSGDLVLEFAEPDKATVRVFCDKKSILYLGGSVLDWEKTLMYQGFKFKNPHEATRCGCGHSFTVA

    >gi|162455633|ref|YP_001618000.1| thioredoxin [Sorangium cellulosum 'So ce 56']
    MAGEHIVTFTNENFESEVINSPIPVLVDFTATWCGPCKQLAPIVETIAKESQGTLKVGKLDIDAAPKLAQKYNVRAVPTC
    ILFRGGEKAGSYTGVASKEKLLRELGV

    >gi|162455723|ref|YP_001618090.1| putative periplasmic substrate-binding protein [Sorangium cellulosum 'So ce 56']
    MRIASLLPSATEIVCALGAQSELVGVSHECDFPEGLTGLPVLTRPRLRPARSSREIDAAVRDVLRDALAVYDIDLDALRE
    ARPDVIVTQDLCDV
    CAVSFDDVRAAVARLARRDVRIINLRPTRLDDIWADIRRVAEGIGRAAGGEALVERLRARVAAVAA
    RAAAAPGRPRVLAVEWIEPVMIGGTWMPELITLAGGEPLVTRPGEHAPTLSPAALAALDPDVVMIKPCGFTLERTLDELD
    LLPRVLPWATYRAVAQGRVYIADGNAFFNRPGPRIVESLEILAACAHPALFADARRAHARSVARIDAELRRHAFDDG

    >gi|162455855|ref|YP_001618222.1| hypothetical protein sce7573 [Sorangium cellulosum 'So ce 56']
    MSFLRWMPPLLALPLLAIGATGCPGNPSSNEPKPAANPEVSVSLPGVDTSSLTPRERREWGAQVSELLSPCPDTPVSIAQ
    CVKEQRPCKACLPAALLLLDLVKDGRSKKERDDAFHMRFDANKVKTLATDGSPEMGPPDAPITIVEWADFE
    CPFCRLMAP
    LLEGLVKRFDGQVRLVFKFYPLSAHVHGEPAARAATAALNQGKFWEMHHLLFENQDKLEQADLERYAQRLKLDMVKFRAD
    LVSTDTKARIDKDKLQADGVGLEGTPLVFINGREVNLQLLSNPGQDLEAWVKLELELLGKTPRPAPPKPGDASPSGSAIP
    AASATPAASATPAAGTSAPAGGAARPAISAAPVQPVQPAKPRTP

    >gi|162455918|ref|YP_001618285.1| thioredoxin-disulfide reductase [Sorangium cellulosum 'So ce 56']
    MSESNVRNLVIIGSGPAGLTAAIYAARANLKPLLIEGFSAGGLIPGGQLMFTTDVENYPGFPEKITGQELMQRFRDQAAH
    QGTEIVTADVTKVELTGHPFKVWVEDTLYLAKAVVIATGARANYLGLDSEDKLKNKGVSA
    CAVCDGALFRGQDVVVVGGG
    DTAMEEATYLSGLCSSVTLVHRRDEFRASKAMIQRVVENPKIKILYSHVVEEVLDVKADMVTGVRVKSTKTGDSHLVPAA
    AMFVAIGHTPMTDLFVGQLDTHPNGYLKTVPGSTRTNIPGVFAAGDVQDWNYRQAVTAAGTGCMAALDAERWLAQQGGH

    >gi|162455927|ref|YP_001618294.1| hypothetical protein sce7645 [Sorangium cellulosum 'So ce 56']
    MKRSLLRGVRRGYALLIPFVAISAAAFASACQGCKVPATAAVSADADVDANASKPTVRLYVLSTVAGALEPCGCTKDQLG
    GIDHLAALIEAQRGEAPDRLVVGAGPMLFTDPEVKPERSSQDAWKAEAMALAAKEIGLTAWAPGENDWALGAEALGKYQE
    QSGAALLGKNLEGAKGVQGVVVRDVSGVKVGLIGVSDPKGRAGAYPEGVKAGPAIDAMKAGVEEAKKQGASVFVGLAALP
    RGEALRLADSVPELHVLVLGKPSERGDGNDGPKPPEIIGSTLVVETPNHLQSVAVVDLFVRGGGSGPLVFADAGGVAKAG
    ELISLSERIRELEIRLNGWEGDKRVSAKDVEARKADLEKLRAEKAQLEAAETKVTGSFFRYSSVEVREKLGADKDVAGQL
    LAYYKRVNDHNKQAFADRVPEKPAKGEAGYIGIDACTNCHDEERKVFDGTAHARAYATLEQDFKEFNLDCVSCHVTGYGK
    PGGSTVTHNASLQNVQCEECHGPGSLHAKDPEKKGLIVLSPPPQSCVTQCHHPPHVEGFDPVAKMQLILGPGHGRD

    >gi|162455986|ref|YP_001618353.1| hypothetical protein sce7704 [Sorangium cellulosum 'So ce 56']
    MFIPRSGARRPALAALLALAALPGCGGAERQEPQFADSPAVPLPGPPGSSSGAPLLDAPGGAPEELPGVDTAELVRRERD
    TWWQLVSQLYAPCPEQAVSLAQCVRESRACAACAPAAQLLADKIRGGASGAEAQAAYGVRFGPNVKQIDLADSPSRGPER
    ASIQIVVWSDFE
    CPSCGRAVPHLDEVVERHAPHVRLIHKVYPLRSHPHADAAARAAIAAHRQGRYWPMERLLFENQQRLE
    EKDLLGYAQKVGLDMARFRADMAGEPAARVVARDKAEADRAGLSGTPFIVINGREFDLALFSLQGELDRWIETELAILGG
    REAAPGGGTL

    >gi|162456149|ref|YP_001618516.1| hypothetical protein sce7866 [Sorangium cellulosum 'So ce 56']
    MGDQVYPLQSKETSQKRHDLAPEPDEAFREFSKRVFAEGALPAKVKQLIAVAVAHVTQCPYCIRGHTQGALRHGASEQEI
    MEAIWVAAEMRAGGAFAHSAIAIAAMGEPPTR

    >gi|162456207|ref|YP_001618574.1| glutaredoxin [Sorangium cellulosum 'So ce 56']
    MPMQAAEVTIYVTDYCPYCAMAKRLLTQKQARFTEINVENRDDLRAWLVKASGQRTVPQIFINGASIGGFSDLSALDKEG
    GLDPRLGEAPSADAPPMPR

    >gi|162456282|ref|YP_001618649.1| bifunctional methionine sulfoxide reductase B/A protein [Sorangium cellulosum 'So ce 56']
    MKRLRAAGLLFALVLIACAAVFACFRAGDAGRASKVIPGSKEAVTMSDRSYRKPSDEELRKQLTPLAYEVTQRDATEPPF
    RNAFWDNHEAGLYVDVASGEPLFTSLDKFDSGTGWPSFTRPVEPERVVERSDRTHGMVRTEVRSKAGNSHLGHVFEDGPG
    PDGLRY
    CINSASLRFIPLARLEAEGYGAYRALFEGRGGAPRQQASANACAVPAPGEAPGCQTTLETAVLAGGCFWGMEEL
    LRQIPGVLETEVGYAGGRTKAPTYEDVKTGSTGHAESVRIVFDPAKLSYAELLEKWFFRMHDPTTRNRQGNDVGTQYRSA
    IFVTTPEQRRIAEEVKARVDKSGKWRAPLVTEIVEAGPFTRAEEYHQKYLEKYPSGYTCHFMRD

    >gi|162456283|ref|YP_001618650.1| pyruvate dehydrogenase E3 (dihydrolipoamide dehydrogenase) [Sorangium cellulosum 'So ce 56']
    MKTYDAIVIGAGPGGYPCAIRLAQLKQKVLCIEKENVGGVCLNWGCIPSKALISAAHLYEKSQAGAAMGIKVSGVELDAN
    KMQDWKEGIVKKLTGGVGSLLKGNGADVVNGTATVVGPKRVDVTRADGSVEQFEATKAIVIATGSTTIEIPTFKFDGDTI
    IGAKEAVSLRRIPKRLMVIGGGVIGLELGMVYQAFGAELIVVEALPELLTGVDPDCTKIVERKILKRGGTIHKNAKALGY
    EKQKDGSVGVKILADGKEQTIVVDTVLVAVGMRPSSKGLGLEKVGVTVDQRGFVPTDKFCRTNVPSIYAIGDVSGPPLLA
    HKATKEGEIAAEVIAGHKAEKDWVAIPGAIFTDPEIATVGLTEAEAKAKGLEVSIGKFPFSVLGKAMAMNETEGFVKIVA
    DKKTKQVLGVHIVGPEASTMISEASLSLEMAAFLEDLSLTIHPHPTLGESLMEAAAHAMGAAIHIANR

    >gi|162456356|ref|YP_001618724.1| hypothetical protein sce8074 [Sorangium cellulosum 'So ce 56']
    MNPELFERYALAHSRNSRSGSVARRGALLAALLLGISACHDAGETPVQEPTGALTGGIDLYSGIPQDGIVLGDPSAPITL
    VEFSDLR
    CSHCRDYGLEILPVILERHVRTKQVKLVFRNLAFLGPSSVQAARMAAAVGMQDRLFDFVDRFFRLQARERPAI
    TDELLLRVASEVPGVDADQAMAQRDSPEVLQQLEAARAEAAALQVRGVPALFLIREGQEPLRLRLTSMSPEPISRAIEQL
    MLEPRPPG

    >gi|162456366|ref|YP_001618733.1| putative copper chaperone [Sorangium cellulosum 'So ce 56']
    MLQVDGMSCPSCVRHIDSALRELGGVARVDVRLREGTVVVQHDPESAPVAALVEAVRGAGYGVRPRAA

    >gi|162456466|ref|YP_001618833.1| putative secreted disulfide isomerase [Sorangium cellulosum 'So ce 56']
    MTATSAASRLGAALRGGGVARGATLAACALLALGCGPGAMPASVRHPLVGSTAPEFHAESTAAVTVGVPGTRRTRVTVID
    FWASW
    CASCSRTMPALDRLWRDRKADGVAVIGVNVDDSEAAAEAAAHELGATFPIVADLDQRLSGTYGVAQVPLTFVVDG
    AGTVRWVGHDPASARRAVEVLLSERPAGARSVFE

    >gi|162456601|ref|YP_001618968.1| hypothetical protein sce8318 [Sorangium cellulosum 'So ce 56']
    MTTLTLFTRERCHLCEEAHAALERVRARLPFELAVVDLDREAGPEKRALYDWEVPVVELDGRKIMKYRVDERRLERLLSG
    PE

    >gi|162456602|ref|YP_001618969.1| hypothetical protein sce8319 [Sorangium cellulosum 'So ce 56']
    MRIPVKWTTLAQLAFILVAAVAVYGFVHAAQNDQRTTGCEAICALRPAYAGRNRLAPDFELPDMNGKPVRLSSFRGKTVF
    LNFWTKT
    CAPCLQEMPALAELGRIAQSRKDIVVLTVSTDEGPDDVRDALKVALNGDPPFPVLFDPESKVVMDQYGTQLYP
    ETWIIDPNGIIRARFDGARDWSSSLAIEVGETVSRWGSCPADIYKSKPRAGSVDVCADDS

    >gi|162456628|ref|YP_001618995.1| glutathione peroxidase [Sorangium cellulosum 'So ce 56']
    MSLYDFTMKTIDGQDRSLGDYRGKVLLVVNTASECGYTPQYAGLEQLHDRLKDRGFAVLGFPSNDFGAQEPGTDAEIAAF
    CSTKFGVSFPMFSKIPVKGGGKHPLYAFLTQAAPAGEVKWNFTKFLIGKDGSVIARFESSVAPDDPKLTQAIDRALGG

    >gi|162456813|ref|YP_001619180.1| hypothetical protein sce8530 [Sorangium cellulosum 'So ce 56']
    MTIGSLLALFGAGLLTFASPCVLPMLPVYLSALGGAGALGGPDPAAARRGVRLAGIGFAIGLAIVLVALGAGASAIAAVL
    APHRRAFTVASGVLLALFGAKLLGVLRLPWLEREARPLLSRLPAAGGFWGGMLFGIAFAAGWTPCVGPVLGAALTYAASA
    GASPLTGAIQLGAYAAGLAAPLVAAAFVGPAAVALARRLMPATPALQRVTGALLVAAGIAVADGRLDALSPAPATAVDAG
    APCEVGPAGACAAPEGAVAQGDVALPEGMPRLLEFESAH
    CPVCERMAPLVKELEGRCAKEAGTVLRIQVDDPRGRALAAR
    YGVRFVPTFLSVDAAGQEVERAVGELPAQRLASLIGDVRGEACPPAM

    >gi|162457074|ref|YP_001619442.1| pyridine nucleotide-disulphide oxidoreductase,class II [Sorangium cellulosum 'So ce 56']
    MSTREEDIPGYDAIIVGGGPAGLSAALILGRCRRRVLVCDSGQYRNHAAREMHGFLSRDGIAPSELRRIAREQLAPYGVE
    IRESAVTDVRRGARRFEVTLEGGERLRCRKLLLATGLVDRLPELPGLPAMYGKSVHH
    CPYCDGWEARDQAIGVYGQGGTG
    VSLAVNMKTWSDDVVLFTDGPASLSRSDADRLARHRIGVREERVARLEGRDGMLERVVLEDGSAVERRSLFVKAKQEQGA
    DLAERLRCTVTEERGVETVAEHEETTREGVFVAGDASKEVLLAIVAAAEGAAAAFGINCALQEEELA

    >gi|162457290|ref|YP_001619657.1| hypothetical protein sce9005 [Sorangium cellulosum 'So ce 56']
    MPSSSELQAGRARFFVTLFRLALFVAIAASAALVVEYQNAGDPAFCGVTSGCFAVRISPYSRFLGVPLPNLGLAAFTALL
    TASLLARARWHHAAIAAASAVGGLAAAVLLGLQSFVIGAFCAWCIAVDLAAFAAAITSALVARQARRMPAGAFERAAQGG
    PLGVTVWGAAAAAAIGLPFLWGSHPVIPPLPPELAALQEPGKITIVAFTDFE
    CPFCRRLHPELSKIEEPYGDRVRHVRKM
    VPLPNHPGALPAAKAYVCTPEDKREQAAALLYSASPSKLTDERVASVLSPLGLSAAELAACLAAPETQAAIDADVALYGR
    MEARGLPTTYVGRRLVVAYNPERIRDALRREAAGDDMSLPLPWLFVALFGVAAVAVLAAGRDRSRGAADEGGAAPSSSSP
    ERS

    >gi|162457325|ref|YP_001619692.1| hypothetical protein sce9040 [Sorangium cellulosum 'So ce 56']
    MSRRAIAAVAWLSLLFVLACSSALPPPPPDASQAKSSGAPARQPGPAADPGATLDDEVMVADGDPGPVPVTRADPARGSR
    LAPVTIVVFSDFE
    CPFCKHLGGTLRQLEQRYGAERLRVVWKNFPLAFHKQARPTAEAAMAVFAHAGPRAFWAFHDAIFTA
    DERLSPEVQATALRRAGVTPGQIPQLVQQSGAAQKVAADMALAGRLGVNGTPASFINGVLLVGAQPAERFAEIIDAQLAA
    AQALRAEGTPPEKIYAALAKKNFAPPAEEPDDADDEESDGGVVHLVPVGDSPVRGADTALVTMVLFSDYQ
    CPFCRRVTPT
    VEKLRAQYGDKLRVVWKDHPLPFHPRAEPAAELAREARAQKGNDAFWQANDRLLASEAALDDAALEAVAADLRLNVNAVK
    RAVASHKHAAKIEADVDLADDLGAQGTPHFFINGRSLVGAQPIEKFQAIIDEEIAKAEAMVVAGTPRAKVYEAIQKQAVP
    PAPPPKVSVPPAPKGHPSKGAAAGKVVIQAFSDFQ
    CPFCARAAATMDELIKAFPGKVRVVYRHLPLPFHPEAQLAAEAAM
    EALAQKGPAGFWKMHDLLFKVSDASNLDRAALEQHAASLGLDAARFAKALDEHTHRAAVEADAQAARSAGITGTPGFVIN
    GYLVSGAQPLAKFKKVVRRALNEAN

    >gi|162457371|ref|YP_001619738.1| thioredoxin family protein [Sorangium cellulosum 'So ce 56']
    MAEPQPNSGKILYPAVALLIALSALFGLVILPRLAPGASGMVGAEAPDVTLPVAANGEPGARMQLAELKGQPVILDFWAT
    W
    CGPCAVQAPILDRIARRYEKKGLVVLGVNVDDPPQVASQYALKKGLSYPILIDDAKEASAHYGVDKLPSLVVIDRQGKV
    AAYLTGVVDEASLSEIVEAAL

    >gi|162455115|ref|YP_001617482.1| hypothetical protein sce6833 [Sorangium cellulosum 'So ce 56']
    MLKARMKNPAMVIPDVMQPIYALIGAVKKSGVPARTLELVHLRASQINGCGFCVDIGAREMKKAGETDERVFAVAAWRET
    PYFTDAERAALALAEAATRLSDRADPVPDDVWEEAARHYDEPALAALTLQIALTNLFNRFNVTTRQIAGSARLDARAENR


    >gi|162451171|ref|YP_001613538.1| lipoprotein [Sorangium cellulosum 'So ce 56']
    MVSTEPTRHASGALPPAEPTGQSFPSDRGDAGRPRRGGLVGTPVFWAAILALVGLVALVAIGVAGRALHGRAAETPAIRI
    PLPAFELTDQRGARFGLEQLRGRVWIADFIFTT
    CPTVCPKLTQRMSEIERRGRDLGDALHLVTFTVDPENDTPAVLAAYA
    ASQRLPLERWTFLTGPLDQIESTVLDGFKIAMGKKESSPGLFSIFHGERLVLVDQQGVIRGYYEANDDGLDAILRDAGAL
    VKSR

    >gi|162448461|ref|YP_001610828.1| arsenate reductase [Sorangium cellulosum 'So ce 56']
    MIQIFGTAKCKATRAAQRFFADRGIKVQLVELREKGLSKGELASVARAVGGVRALYDAESARVKERGLQHLGPSDARIAE
    LLVDDPLLLRTPIVRDGTRACVGAAEATWKAFADAAKGG