Sodalis glossinidius morsitans uid58553

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|85058046|ref|YP_453748.1| glutathione reductase [Sodalis glossinidius str. 'morsitans']
    MTRHYDYLAIGGGSGGIASINRAAQYGRKCALIEVKYLGGTCVNVGCVPKKVMWHAAQIAEAVKLYAPDYGFSTTVEKFD
    WRTLIESRNAYINRIHQSYEQVLGNNHVDIIHGFARFVDAHTVEVNGEHITADHILIATGGRPSKVAIPGAEYGIDSDGF
    FALDAMPERVAVVGAGYIAVEIAGVLNGLGTDTHLFVRKHATLRSFDPLIVETLVEVMQAEGPALHTGSVPRSVAKNPDG
    SLTLTLQNEEQFTVDALIWAIGREPATDNLNLVAAGVKTDDTGHIQVDKYQNTNVSGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPEEHLNYDLIPTVVFSHPPIGAIGLTEPEAKEKYGETEVKVYKTSFTSMYTAVTRHRQLCRMKLVCVGLQE
    KIVGLHGIGFGMDEMLQGFAVAIKMGATKQDFDNTVAIHPTAAEELVTMR

    >gi|85058228|ref|YP_453930.1| arsenate reductase [Sodalis glossinidius str. 'morsitans']
    MKNVTIYHNPSCGTSRNTLTLIRDSGIEPTIIPYLKQPPSPEQLLELLSVMGMHARELLRSKEAQYRQLGLDAQHLSEDE
    LIQAMCHHPVLMNRPIVVTPLGTRLCRPAEIVLEILPKVQ

    >gi|85058279|ref|YP_453981.1| thiol:disulfide interchange protein precursor [Sodalis glossinidius str. 'morsitans']
    MAQRRFTLILLACLTCLPLLPAHAALFGNSHGNQFIPAEQAFRFDFRQQGSQLTLSWDIHPGYYLYRQQIRLEPVNATLG
    AFTLPAGSRHHDEFYGDDVAIYRDELNITLPLAQAQNDSQLRVTWQGCAEAGFCYPPETQVIPLSAIAAAPPSGTGIGST
    ALIPAPPPAGGQGIITPAPPPQSNNLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGNRLQLSTARVLLLAVVYVMGM
    AITYTLLGVAVAAAGLQFQAVLQQPALLIGLAALFILLALSMFGVFTLQLPSALQTHLALWSNRQRQGTLPGVFIMGALA
    GLFCSPCTTAPLSAILLYIAQSGNLWFSGFTLWLYAVGMGIPLILVALFGHRLLPKRGPWMQQVKQGFGFVILALPVFLL
    ERVLGDSWGTRLWSLLGVAFFGWGFLLCLQARWRGARWLAVLMLGLTLISARPLQDWLWGAPADMTSTTGAAPVFQPVQT
    LAQITQALNAAPGKPVMLDLYADW
    CVACKEFDKYTFRDPAVVEQMSRFTLLQADVTANAPVQRMLLGQLQVIGLPTILFF
    DSRGHEIPGSRLTGYMNAADFTRHLRKLAP

    >gi|85058447|ref|YP_454149.1| dihydrolipoamide dehydrogenase [Sodalis glossinidius str. 'morsitans']
    MSTEIKTQVVVLGAGPGGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALSKNGIVFGEPQ
    TDIDKVRTWKEKVVNQLTGGLSGMAKARKVKVVNGYGKFTGANTLQVEGENGTTTITFDNAIIAAGSRPIQLPFIPHDDP
    RVWDSTGALALTSVPERLLVMGGGIIGLEMATVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISSQFNLMLETKVTV
    VEAREDGVYVSMEGKKAPSETQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGTHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYEVATFPWAASGRAIASDCQDGMTKLI
    FDKESHRVIGGAVVGVNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLYESVGLAAEVYEGTITDLPNAKAKKKK

    >gi|85058479|ref|YP_454181.1| hypothetical protein SG0501 [Sodalis glossinidius str. 'morsitans']
    MSETATLPLRFTDSAASKVKNLIADEENPNLKLRVYITGGGCSGFQYGFTFDDKVNEDDFTIEKQGVALVVDPMSLQYLV
    GGSVDYSEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|85058620|ref|YP_454322.1| putative peroxidase [Sodalis glossinidius str. 'morsitans']
    MVLVTRQAPDFTAAAVLGNGEIVDNFNLKSHIQGKPAVIFFWPMDFTFVCPSELIAFDKRYAEFQKRGVEIIGVSFDSEF
    VHNAWRQVPTDKGGIGPVQYPMVADIKREIIKAYGIEHSDAGVALRGSFLIDKDGLVRHQVVNDLPLGRNVDEMMRMVDA
    LQFHEEHGEVCPAQWEKGQEGMGASPEGVAKYLSENLTRL

    >gi|85058747|ref|YP_454449.1| suppressor for copper-sensitivity B [Sodalis glossinidius str. 'morsitans']
    MNVLIRSLMLLLAGCAFVAQAADSGWLRNEQNSHAEVRLRSAVQGQDQQLLLDIRLQPGWKTYWRTPGEGGVAPDIRWQT
    TGAEAQWYWPTPARFDVSGLTTQGYKGDITLPIEIRKLAGSTLAGTLTLSTCSDVCILTDFPFSLDLSKPTDDSFARDYA
    RAMGQIPPTGGLTDKLDASFINGELQIRAQRQQGWHQPELFFDYPQGSMLAAPQISVKGDTFEARVPVTDEWGETAPDLR
    GKTLSMVIADGGMAQQSSVVLSSQPLLDGKGVNTTFWSVLLLALLGGLILNLMPCVLPVLAIKLSSLVQQQGQTRHQTRQ
    QFLASSAGILFSFLLLALLMTGLRLSGQALGWGIQFQSGGFLLLMALVMFLFSASLFDLLHFRLPSGLNTRLATVGGNGL
    TGHFGQGAFATLLATPCSAPFLGTAAAYALTAPLPQLWLLFAALGIGMSLPWLLVAALPGLARCLPHPGRWMMHLRTVLA
    LLMLMATMWLVTLLIPHWGATFAGVLAALLVLVLAVWLISRRALQQAGITLITLTLAGALFLITRIEPEEETLHWQPLTE
    AAINQALQQNRRVFVDVTADW
    CITCKVNKSRVLSQPDVRKALQADDVVLLQGDWTRPDPAISEFLRRRDSVAIPFNQIYG
    PAMPQSRILSPLLSRDAVISTLSEAKK

    >gi|85058748|ref|YP_454450.1| suppressor for copper-sensitivity C [Sodalis glossinidius str. 'morsitans']
    MKKKNLLLSLIFLTLPALAAAPFNSEQEVLIKQLIRETLVQNPSILAEAVAELDKEAARQQQSVVAQVVEKNHEALFNDA
    GSPRIGAARPALTLVYFTDYN
    CVFCKKFEADIEKMLKANPQVAVVLKPLPYRAESSLTSARLALTVWEQQPGNFLKLHER
    LMSKKGNHDEASIKAAMEKNGIKLDEPSKTSLDTVNLNLTLAQQLGVQGTPATLVGNQLISGAVPYAQLEAAVKNVLEAK
    P

    >gi|85058749|ref|YP_454451.1| suppressor for copper-sensitivity D [Sodalis glossinidius str. 'morsitans']
    MSRLTRVVREVAMLALIATAIMFGMDWLRAPQLPDNLAQPPLSAMQGEVDLAQLSQQSPVLVYVWASWCGVCKLTTSTVA
    SLSRNGTQVVSVALRSGNDARVATWLEKKGVQGIAINDESGVLGQRWQINATPTFMVLYKGRVVSTTSGWTSSPGLKLRL
    WWATKYA

    >gi|85058901|ref|YP_454603.1| glutaredoxin 1 [Sodalis glossinidius str. 'morsitans']
    MFAVIFGRPGCPYCVRAKSLAEKLTAERDDFTYRYIDIHAEGISKTDLSKTVGKLVETVPQIFVDQIHIGGCTDFEAYAK
    ENLSLYSS

    >gi|85059026|ref|YP_454728.1| hypothetical protein SG1048 [Sodalis glossinidius str. 'morsitans']
    MPVLHNRVSNQELRARMLAESEPRTTVSFYRYFTLSDPQGFRDDLYRTLTALQVFGRVYIAAEGINAQISVLQSRFDAMR
    EALYAAHPQLDGLRLNVALDDDGKSFWVLRMKVRPRIVADGIDDPTFNPANVGHYLKAEEVNALADDPQALFVDMRNHYE
    YEVGHFDQAIEIPSDTFREQLPMVVEMLQHDKDKKIVMY
    CTGGIRCEKASAWMRHNGFKNVYHVEGGIIEYARRAREQGL
    PLKFTGKNFVFDERLGERITPDIIAHCHQCGAPCDSHTNCRNQGCHLLFIQCPVCAEHYVGCCSVTCQEELSLPLSEQRS
    HRAGRENGMKIFNKSRERLQLSLTGEDSAQK

    >gi|85059084|ref|YP_454786.1| thioredoxin reductase [Sodalis glossinidius str. 'morsitans']
    MSTVKHSKLLILGSGPAGYTAAVYAARANLNPVLITGMEQGGQLTTTTEVENWPGDTEGLTGPLLMERMYAHATKFNTEI
    IFDHITQVNLQTRPFRLVGDSGEYTCDALIIATGASARYLGLPSEEAYKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAEEVHLIHRRDTFRSEKILIDRLMDKVNNGNIVLHTNRTLEEVLGDEMGVTGVRLKEVAGSAHEDLAVAGVF
    IAIGHSPNTAIFGDQLALQNGYLRVQSGINGNATATSIPGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDGLAQAG
    SL

    >gi|85059318|ref|YP_455020.1| disulfide bond formation protein B [Sodalis glossinidius str. 'morsitans']
    MMRSLNRCSKHRAAWLLLALTTFSLELVALYFQHVMLLKPCVLCVYQRCALYGVVAAGLVGAIAPATPLRFSGLAIWLYS
    AWEGLQLAMKHTDIQLHPSPFVT
    CDFFVSFPAWLPLDKWLPSVFSASGDCAVRQWHFLSLEMPQWMIVIFGAYLAVAVLI
    LLAQFFPPRKRDLFSR

    >gi|85059326|ref|YP_455028.1| methionine sulfoxide reductase B [Sodalis glossinidius str. 'morsitans']
    MANNTPPRLPDEAMTEMQRYVTQQRGTEPPYSGNLLENKRTGQYHCLVCHAPLFYSETKYDSGCGWPSFYEPVSDESIRY
    LDDDSHGMQRVEICCGNCDAHLGHVFPDGPQPTGARF
    CVNSASLRFRDGENGEEIAG

    >gi|85059409|ref|YP_455111.1| iron-sulfur cluster assembly scaffold protein [Sodalis glossinidius str. 'morsitans']
    MQVDNKVETFSLEENIWRGLTITDSAAHQILRLVESDPTMLGLRLSVKQSGCAGFGYVVEKATQTDDSDRVYEHDGVKLY
    VPLKAMPFIDGTELDYVQEGLNHVFKFNNPKAQHACGCGESFGL

    >gi|85059418|ref|YP_455120.1| hypothetical protein SG1440 [Sodalis glossinidius str. 'morsitans']
    MTTTIEKIQQQIAENPILLYMKGSPKLPGCGFSAQAVQALSACGERFAYVDVLTNPDIRAELPKFSNWPTFPQLWVDGEL
    IGGCDIIIEMYQRGELQPLIKETAVKYNSQTDSAQ

    >gi|85059428|ref|YP_455130.1| SoxR-reducing system protein RsxE [Sodalis glossinidius str. 'morsitans']
    MNEAKRILLEGLWRNNSSLVQLLGLCPLLAVSNTATNALGLGLATTLVLVCTNTAVSALRRWITGEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYASQRPPALAALDGLSIGLGSTCTLLLLGALREVLGNGTLFDG
    ADQLLGAWARVLRIEVFHTDTPFLLAMLPPGAFIGLGFMLVGKYLIDQRMKARQPKAARPVVLQQGQPLADE

    >gi|85059433|ref|YP_455135.1| Na(+)-translocating NADH-quinone reductase subunit E [Sodalis glossinidius str. 'morsitans']
    MNGYLMLFIGTVLVNNFVLVKFLGLCPFMGVSKKVETALGMGMATTFVMTLASICAWLINDFILLPLNIPYLRTLAFIFI
    IAVVVQFTELVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNVNENHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFKGSSIALITAGLMSLAFMGFTGLVKV

    >gi|85059476|ref|YP_455178.1| thiol peroxidase [Sodalis glossinidius str. 'morsitans']
    MSQTITLKGQPVTVAGTFLTLGTKAPDFLLVGTNLSDVTLKSFSGKRKVLNIFPSVDTGTCATSVRKFNQLAGQLDNTLV
    LCISADLPFAQKRFCGAEGLEKVVALSTLRDPQFRQHYGVAIDAGPMKGLAARAVVVLDEHDTVIYSQRVSEIASEPDYD
    AALAALQA

    >gi|85059612|ref|YP_455314.1| thiol:disulfide interchange protein DsbE [Sodalis glossinidius str. 'morsitans']
    MSRKLLYIPLVLFLLLALALTVQLAHNAHGDDPTRLESALIGKPLPSLTLASLDDPGKIYSQALLRDAHPWLLNVWATWC
    PTCRAEHQFLNGLAAWGVRIAGVNYKDSRAKTMAWLNTLGNSYALSIFDGDGMLGLDLGVYGAPETFLIDG

    >gi|85059695|ref|YP_455397.1| hypothetical protein SG1717 [Sodalis glossinidius str. 'morsitans']
    MSNDLQHPGVTLYGIKNCDTVKKARRWLDDRQMPYRFHDYRSDDLDADLLQRFIDQLGWQPLLNTRGTTWRKLSESQRAA
    ADSAAGTAALMLSQPAIIKRPLLEAADGRLLLGFSPQAYHSFTASEV

    >gi|85059706|ref|YP_455408.1| thioredoxin-dependent thiol peroxidase [Sodalis glossinidius str. 'morsitans']
    MTPLKAGDIAPQFSLLDQDGELISLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDEDHQVAGQFGVWGEKSFMGKTYDGIHRISFLVGVDGAIEKVFDDFKTSNHHDIVLAYLKSV

    >gi|85059721|ref|YP_455423.1| putative transport system permease protein [Sodalis glossinidius str. 'morsitans']
    MLQKLFTGLLCGVLLGFVMQRGRFCLTGGFRDMYLAKNNRLFYALLIAIAIQSLGVYILIAAGQFSYDAGAFPWSGTIVG
    GYVFGIGIVMAGG
    CATGTWYRAGEGLIGSWIALAAYMVTSAVMRSPHLAAFNQQMMSYSTAHNAIAETFGLSSWPFIALL
    VLVALWLARRELKKPKLAGSPLYRPKKPAWPICCLKNAGIRLPPPF

    >gi|85059831|ref|YP_455533.1| putative cation transport ATPase [Sodalis glossinidius str. 'morsitans']
    MNGNEKLPRRAAKITTARPLAAGATIADGVQTRGNTCCGARPQGAGATRSEPRQEPLAAAREVDGDVRTPIRIMQMDCPT
    EEGMIRKKLASLPAVTAMEFNLMQRVLMVVHRPDSLDSILAAIRSLGFTPQIAAADAPLADDDLPRQRRWPLVLAAIAAF
    ASEISHWLSWPDGISAVLALLAVVACGLTTYKKGWLALRQGTMNINALMSITVTGALLIGQWPEAAMVMVLFTLAELIEA
    RSLDRARNAISGLLQSVPATASQQQADGSWQEVEVDTVPVGSLLRVKPGERVALDGTVEQGNSTVDQASITGESLPVEKR
    PGDTVFAGTLNQAGSFSYRVTATIGDTTLARIIHAVSEAQGNRAPTQRFVDRFARIYTPLILVLEVLVALLPPLLLGGGW
    YEWIYKALVMLVIACPCALVISTPVTIVSGLAAAARQGILIKGGVYLEKGRSLRWLALDKTGTLTHGKPILTDRHTFGVR
    DAEALYQLAAGLASRSDHPVSQAIIQAAEREGNAPVRVTDFTALPGRGITGVTADSQWYLGNRRLADELGLSTDVLDPRA
    AALEQQGKTLVMLMGEGKVQALFAVADTLKSHSRAAIAQLHQAGVKILMLSGDNTHTARAIAAQAGIDEAYGDQLPEDKL
    QKINQLADRGTVGMVGDGINDAPALARADIGFAMGALGSDTAIETADVALMDDDLRKAAQFIRLSRATHRILIQNIALAL
    GIKAVFLLLTLAGAGTMWMAVFADVGTSLLVVANGLRLLRQAPRSRPTPAHGNAAEQPLL

    >gi|85059882|ref|YP_455584.1| hypothetical protein SG1904 [Sodalis glossinidius str. 'morsitans']
    MAITIYTKPDCVHCHATCRALDHKGIDYRLVNLLDDEQALHHVRALGYQQVPVVQTPQEYWSGFRPDKISLLSASAIPA

    >gi|85059887|ref|YP_455589.1| thioredoxin 2 [Sodalis glossinidius str. 'morsitans']
    MNTVCASCLATNRLPDHRINDAANCGRCGEPVLDGTVVHSTAATLDKLLQDDLPVVIDFWAPWCGPCVGFAPVFDAVAGE
    HRDKVRFIKINTEAEPSRRSVTVSAFAVFLQLCCSSRDKKWTH

    >gi|85059970|ref|YP_455672.1| thiol:disulfide interchange protein DsbC [Sodalis glossinidius str. 'morsitans']
    MNKSLVLLSFIALALSPLVHAEDAAIKHSLSRLGIHSADIQPSPVAGLKTVLTESGVLYVSDDGRHVIQGPLYDVGSNHP
    VNVTNQLLSKRLNALQKEMIIFKAPQEKQVVTVFTDTT
    CGYCHKLHEQIKEYNALGITIRYLAFPRQGLNSQTEKDMALV
    WCSANPKDAFNRAMNGGNVPAASCDIDISKHYTLGVQYGIQGTPALLLDNGTLIPGYQSPKELAAILDQQGSGQATGG

    >gi|85060047|ref|YP_455749.1| arsenate reductase [Sodalis glossinidius str. 'morsitans']
    MASITIYHNPACSTSRKTLALIRDSGVEPTVILYLKQPPSRAQLKEMLNAMGLSARELLRAKEELYRQERLDADNLSEDV
    LIEEMLKVPILINRPIVVSPLGTRLCRPAETVLDILPPSQ

    >gi|85060135|ref|YP_455837.1| soluble pyridine nucleotide transhydrogenase [Sodalis glossinidius str. 'morsitans']
    MQPKYDYDAIIIGSGPGGEGAAMGLTKRGARVAIIERYDNVGGGCTHWGTIPSKALRQAVSRIIEINQSPLHGNTRLPHT
    GFSDILCHADQVINQQTHMRQGFYERNHCQIFTGEASFVDEHQVQIHYGDNTTETLSAENIVIACGSRPYQPQDVDFDHP
    RIYDSDSILDLKHDPHHVIIYGAGVIGCEYASIFRGMNVKVDLINTRDRLLAFLDQEMSDALSYHFWENGVVIRHNEEYE
    EIKGLDDGVEVRFRSGKRMKADCLLYANGRTGNTDTLKLDKVELEADSRGLIKVNSMYQTAARHIYAVGDVIGYPSLASA
    AYDQGRIAAQVIIKGQANVQLIENIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKLLFH
    RETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|85060164|ref|YP_455866.1| glutaredoxin 3 [Sodalis glossinidius str. 'morsitans']
    MANIKIYTKATCPYCHRAKALITRKGVPFQEIPIDGDVDLREEMIKRSGRTTVPQIFIDGKHVGGCDDLHALDARGGLDP
    LLK

    >gi|85060165|ref|YP_455867.1| hypothetical protein SG2187 [Sodalis glossinidius str. 'morsitans']
    MQEIMQFVGNHPMLSLAWVVILGAVIFTTFQSRFSKVGDIARGEAIRLINKEDAVIVDLRNRDDYRKGHIANSLSLTAAD
    IKSGNLGELEKAKGKPVIVV
    CASGTSSRDPAQNLIKAGFERVYVLKEGISGWSGENLPLVRGK

    >gi|85060214|ref|YP_455916.1| periplasmic protein disulfide isomerase I [Sodalis glossinidius str. 'morsitans']
    MKKIWFALVVIALAFSASAAQFTEGQQYVQLDKPVTSEPQVLEFFSFYCANCYQFEQVYHISSTVKKALPAGTKMTKYHV
    DFLGPMGKQLTQAWAVAMALGVEDKVSPLLFGGLQKTQTIQTPDDIRAVFVKAGVSAEEYDSAWNSFVVKSLVVQQEKAA
    TDLQLRGVPAMFVNGKYMVKNDGLDMSSMDAYTKQFADVVKFLLSQK

    >gi|85060267|ref|YP_455969.1| hypothetical protein SG2289 [Sodalis glossinidius str. 'morsitans']
    MSLDYCLMVTGPAYGNQRASSALQFARALLECGHRLGTVFFYQDGVHNANRLSAPAGDEVDLVRAWHELAQQHQVALHVC
    AAAALRRGVTDALQASLLKRSGENLQPGFELSGLGSLVQAALGCDRFIQF

    >gi|85060306|ref|YP_456008.1| glycerol-3-phosphate regulon protein GlpE [Sodalis glossinidius str. 'morsitans']
    MDQFATISMEQARERWRQGEAVLVDIRDPQSFAAGHLRGAFHLTNDTLPAFLAQHDLARPVMVLCYHGNSSKGAAQYLLT
    QGVEVAYSVDGGFDAWLKAFPLETESL

    >gi|85060365|ref|YP_456067.1| thioredoxin 1 [Sodalis glossinidius str. 'morsitans']
    MSDKIIHLSDDSFEKDVLQAKGLFLVDFWAEWCGPCKMIAPILAEVADEFDGKLTVAKLNIDENPATAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKEFLNANL