Slackia heliotrinireducens DSM 20476 uid59051

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257062837|ref|YP_003142509.1| Peroxiredoxin [Slackia heliotrinireducens DSM 20476]
    MLEVGTKAPDFTLPDQNGQMHSLADYRGQRVILYFYPKDMTAGCTSQACSFAELYPQLREKGAVVLGVSKDSVESHKRFE
    EKHGLPFTLLSDPEMNVINAYDVLAESTTKTGKITRRLVRSTYLIDANGTIEKAFGKVKPKDNAAQMLSELA

    >gi|257062877|ref|YP_003142549.1| copper/silver-translocating P-type ATPase [Slackia heliotrinireducens DSM 20476]
    MKQTFDVTGMSCAACSSRVDKCTRGVEGVADVAVNLLKNSMEVEYDPEATPEQIARINEEISATVDKAGYGATPRAVQAA
    AGGTANGKSTAQLAHEAATKNAVANEKHMRMRLILSIVFCVPLFYLAMGHMMGWPLPSVFLGHEHMMVTALAELVLVAPI
    IFIDFKFFSNGFKSLFHGAPNMDSLIALGATASTAYSIANMFIMANAMGQGDLESAHEAFMGLYFDSAGMILTLITLGKY
    FEARAKGRTTDAISKLMDLAPKTANVLRDGVETEVPVEQVRVGDVLVVRAGEGVPLDGVVLEGSASVDESAITGESVPVD
    KHVGDPVTGATINKSGYFTMEVQRVGDDTVLAGIIALVDEATSSKAPIQNMADKIAGIFVPAVIGFAILVFVLWMLLAAP
    FETALTHAICVLVISCPCALGLATPTAIMVGTGRGASNGILIKSADSLETAGRIKTVVFDKTGTITQGKPGVVDVAPANG
    VAASDLVALASAVESKSEHPVAQAIVEYAESQGIQPVQDTVSDFTQVPGEGVRALVGGRTCLAGNARMMASNQVALDNAE
    DAAERYADEGATPLFFALDGKLQGIIAAADAIKPTSARAIRELHAMGIDTVMLTGDNERTAHAIQKQAGLGKVIAGVLPQ
    DKEREVARLSQEGGVGMVGDGINDAPALARADVGIAIGAGTDIAIESADLVLMRSDLMDVPAAIQLSRRTLRTIKQNLFW
    ALIYNVICIPIAAGLFSWAGLTLDPMIGAAAMSFSSVCVVTNALRLRTWKPKFVTPEEPSAQVTSVQAPKASPALESAAP
    APAPQPAAAPAPAAKPELPTEPEDLSAPDGTVAVKTLAVKEMMCGHCVRWVTQALQDVEGVLRADVSLSRENAVVYLNRD
    VPDDVLTAATDEQGYPAQVIETQAN

    >gi|257063173|ref|YP_003142845.1| YeeE/YedE family protein (DUF395) [Slackia heliotrinireducens DSM 20476]
    MMYLSGLIVGVLFGIFLKKSRFCLTGLIRDTYMEKKPYNAVIVFSIIAVQGLIYHSLAHAGLIRLPSYLPPFSLVSIAVG
    SLLFGIGAVVSSG
    CIASTLVKCGDGRIAGLISLATFMVTGYALSAGPLVELSKAIRSVAIVDDNLAIRTTVAPIVICGVA
    SVVLIAVMVRYRMTHKPKFRIPGRYTGVRHILFEKVWPVEVSAVLIGILAGFAFLISGHYGRHFGFALVTPLLSWAYELL
    QPPFVVGGCNPYDTVFGWGSMFVLGIVLGSLITTAASGELTPVMPDKTTALKMVIGGVLMGFGGVWGQG
    CLIANGLVGTA
    QFSLKSWYALVFLVAGIWLATRLYLMPSLQKASKN

    >gi|257063175|ref|YP_003142847.1| Rhodanese-related sulfurtransferase [Slackia heliotrinireducens DSM 20476]
    MLKDKGLKKQFMLAVTCVAMVASMGALLVSCGGGNTEAAMEEAANESAATEPAEDTTYQHLSGEEVVALMESDDNAVLVD
    VREPLAYQYEHIVGAINVPQSKMAEQAESAFPDKDQTIILY
    CDYGGVSKIAAEDLVDMGYTNVIEFDGLEDWPGETEKDE
    SIK

    >gi|257063176|ref|YP_003142848.1| cytochrome c biogenesis protein [Slackia heliotrinireducens DSM 20476]
    MDIGMIGAAFAAGLLSFFSPCVLPLLPVYIGLLTTDAGNQELGMVRRAANTVAFVLGISTTFLILGLGAGSIGKMLSNSY
    VAIVCGIIIIFFGLYLAGLLKIPFLTQEKRMDTSKLNTSTVLGAFLLGLGFSFGWTPCIGPILGTVLAMAAQQGTALAGA
    GLTLVYSLGMCIPFLVITLASNLLLAKVRKLNKYMPIIQRVGGILIAVMGLWMVVTAGQNLMASNAASSAASNATTTQSA
    TAESDASSGPDEEVDAWRHIEFETLEGEKVTIADYEGKPVYIELWGSW
    CPQCMSNMDAFIALADKHNTAGDVQILSMAFP
    SLYGEMDKAEFIEWCNQQGYEFPILMDETGALVDYFGVAGFPTSIFVDADGNVQMVRAGVVAEDELEGLLSTLAGM

    >gi|257063286|ref|YP_003142958.1| methionine-R-sulfoxide reductase/methionine-S-sulfoxide reductase [Slackia heliotrinireducens DSM 20476]
    MDKHLFSIIVLLGALVTILVGCATTASDLPPKESAGEQKSEAEAMKSQIDTNNLKDIYFAGGCFWGVEEYFSRIPGVYDV
    TSGYANGTTENPTYEEVCYGDTHFAETVHVQYDPSIISLTTLTRQFFMIINPLSVNEQGNDRGEQYRTGVYYVDEADLQT
    IQLVFAEVEQQYESSLATELGPLENFYLAEEYHQDYLQKNPDGYCHIDFSSLDQVELEEGADETQPSEIKVDPSLYSRPS
    DDEIQDNLTDMQYEVTQNNGTEPAFQNDYHDNTAPGLYVDIVTGEPLFASSAKYNSGCGWPAFTKPIDPDVLVEVPDNSW
    GLNRTEVRSRVGDSHLGHVFNDGPASQGGLRY
    CIDSAALRFIPYEEMEAEGYAEYMPLCETYSWE

    >gi|257063329|ref|YP_003143001.1| hypothetical protein Shel_05930 [Slackia heliotrinireducens DSM 20476]
    MKKIIKLDGEICANCAAKIQDRINKLDGVNDAKVNFMTLKFTLDAADDKFDDVLAESIKIFEAVEPDCEVLA

    >gi|257063416|ref|YP_003143088.1| 4Fe-4S protein [Slackia heliotrinireducens DSM 20476]
    MAIADDLALYAVGYFAHESHPFRMDSYCLNTIQRKTPCTTCSDVCPEQLNISARKPNWKGCINCNLCVTMCPTEAIHEST
    TSLTSTLSALDTDGDYIVVACDDYEGHADVRCACIGCMPWELLAAMSLSKGIVLKTKICRECPNEFLVEEVKGKVKKLRR
    FFGKEEFLRRFFTAEPEEGKASAGAAKRHAFSSAFGAVKSGAEQIVAENPPKVSHYRALLLESLESIPEENRPAVTWETL
    VQDGDCRG
    CIICGRMCPHDSIKLNIPDVTASEYSSVLRVGPGANDTEETQIEEFQYPQSYIHEASRCTQCGLCYISCPIS
    NIGGWDKITTKKVPAYNETPISVKLCEKCKRPFKPDNEEDTVCQTCNRRKFGIGGRR

    >gi|257063474|ref|YP_003143146.1| glutaredoxin-like protein [Slackia heliotrinireducens DSM 20476]
    MAELTLYKFDTCPFCRKVMAYIDEAWPKDKPIAYRDVRREADAYDELLRIGGMTQVPCLVIDGVPLYESDDIVAWLAAHK
    DE

    >gi|257063491|ref|YP_003143163.1| 4Fe-4S protein [Slackia heliotrinireducens DSM 20476]
    MAKVAAGAIVAAEVVAGLADSSDDLLRPPGAGDEKDFLSKCIKCGRCIEACPYQALYAQTGAFGAGIGAPTLNVRNQACR
    MCEDMPCIPVCPTGALEKLETRNDIRMGLAVIDREHCIAIKGMRCEVCYRACPLIDRAITLDKRVRDNDYIHTVFEPIID
    VDACTGCGLCVERCVVTDPCVPIKIVRDREDAIRQIEEEQAKEISSAYGASEGKWAPAGSY

    >gi|257063506|ref|YP_003143178.1| O-6-methylguanine DNA methyltransferase [Slackia heliotrinireducens DSM 20476]
    MGEFNDAVFEQVKRIPRGKVSTYGQIARLIGRPRSARYVGWALRTNDQPVVIPCHRVVFKDGKLAEGYIFGGDGVQRKLL
    QDEGVVFVDDDHVDMDACLWNPAEDGLPGRPADIDWTREMDEGSKGERA

    >gi|257063541|ref|YP_003143213.1| Peroxiredoxin [Slackia heliotrinireducens DSM 20476]
    MSPVKKPIVLAIVLVLVLAASGIAFAVVNVTERDAAPDVAAAGEEKEEAGAAIFPDFTVQTVDGELVSLSDMKGKPVVIG
    YWATW
    CPYCVDEAPAIQALYETYGENVNFMMIDLVDGEQETVESGSAWIEEQGYTYPVYYDLTGDAAYAGSVYYLPTTFI
    LDAEGKVVVYSESAVSFAEVSDVLASLLTK

    >gi|257063706|ref|YP_003143378.1| O-6-methylguanine DNA methyltransferase [Slackia heliotrinireducens DSM 20476]
    MNHFVYAMPQGRLTIVASETALTNIYFGVKELDMPFAPSKITNDAATQLQEYFAKKRTSFDLPIQLKGTPFQLEVWNALR
    DIPYGQTRTYAQIAETAGRPNAFRAVGSANNRNPLPIVVP
    CHRVVGSDGDLVGYAYGLKLKRFLLELEGVDVDGLKRR

    >gi|257064081|ref|YP_003143753.1| dihydrolipoamide dehydrogenase [Slackia heliotrinireducens DSM 20476]
    MIAITMPALPGNKPNIVASVLVKTGDAVAEGQELFNVETSKRAVPIKAPADGVVSRVLVCEGDEVAAGDVLAHLDEAESV
    AQTLAPSSETAPEEHRKEADDDHAELLIIGGGTGGYVAALYASKMGKHVTLVEQDKLGGT
    CLNRGCIPTKTLISSADLYS
    RVLRADEWGIEVSGHVRPNMEAIIDRKSSVVDELVGGIEYLMDENRIRVINGTARFEGNGEVSVECGCDVLKLTFDDCIV
    ATGSCIRPVSLPGTDLPKVHTTDEALDCKELPESVVIVGGGVTGMEFAFLYANLGVDVTVLARRPRILHMFDQEASAEIT
    RAAENRGIRIIPNADVKCFSMMQNGSVRTVYEVDGELHFVDNGYVLLAGGRVPNTDDMRIQNTDVELDASTGAILVDGRM
    RTNVAHVYAIGDVNGLAMLAHAASYQGRIAVDDILGNSVSFRPEIIPSVAYTDPEVAAVGLSADDARKDPSRYRVGTFSF
    AHNGKALAENSGQGYVALVSDADDVLKGATIVGGHASALIGYIGLAISAGLSGEQVREAVFAHPTTSEAIYEAACDLTFG
    ALHE

    >gi|257064082|ref|YP_003143754.1| predicted redox protein, regulator of disulfide bond formation [Slackia heliotrinireducens DSM 20476]
    MLTTMKANVQPTGKGVQMQCESRGFKFILDEPQEAGGMNEGMNPLEGALCATGACLGIVAASFAQAKGFTYESFSIDLEG
    DVDPDGFMGIADVPKGFQAIRFNVNYKTSEPQEKCDEFTKFMEETCPLCCTFAEGVKVTYSNTVA

    >gi|257064125|ref|YP_003143797.1| thioredoxin [Slackia heliotrinireducens DSM 20476]
    MADVISSAEFEEKVLKATEPVIVDLFATWCGPCKAMAPTLDKVAAEHADEVSIYKVDVDESPEIAQKFRVMSVPTLLAFK
    NGELVNRAVGAQPEDAIVALFK

    >gi|257064206|ref|YP_003143878.1| hypothetical protein Shel_15090 [Slackia heliotrinireducens DSM 20476]
    MSVLFVEYPKCSTCKKAKAWLDAKGVEYTDRHIVEENPTAAELAEWHARSGLAVRRFFNTSGMKYREQNIKAKLDAGMTP
    EECFDLLATDGMLVKRPIIVADEFVLVGFREAEWAAALL

    >gi|257064353|ref|YP_003144025.1| NAD(FAD)-dependent dehydrogenase [Slackia heliotrinireducens DSM 20476]
    MKVVIVGGVAGGASAAARIRRLDETAEIIVFERTGYVSYANCGLPYFVGGVITDPGALTLQTPESFLRRFRVDMRVHHEV
    EAINPDLKTVTVRNLETGEVFDEPYDKLLLSPGAKPTVPRLAGVDGKRVFTLRTVEDTFAMRNFVVEKAPKSAVVAGGGF
    IGLEVAENLCEMGVEVTIVQRPKQVLAPLDADMACQLHALLRSHGIGLKLGSSVAGFEERDGKVSTLLEGEEPLVSDMVV
    LAIGVTPDTAIAQAAGLEMGPKGSIVVNDRMETSVPDIYAVGDAVQVVDAVTGLDALVPLAGPANKQGRIAADNICGGYS
    YYRGSQRSSVIKLFNMTAATTGINEKLAQAAGIDYEKVVLSPANHAGYYPGGKVMTCKILYERGSLRLLGAQIVGYEGVD
    KRIDVLATAIFAGLNAVDLKDLDLAYAPPYSSAKDPVNMAGFMIENIEEGRVKQFHWHDVADLPRDGSVTLLDARTPAEY
    ARGCAEGFVNIPLDELRGRLDEIPLDKPLYVM
    CQSGLRSYLACCILAQNGYDCYNFSGGYRFYNMVTSDLLAADQAHPCG
    ADK

    >gi|257064354|ref|YP_003144026.1| Rhodanese-related sulfurtransferase [Slackia heliotrinireducens DSM 20476]
    MGLFDMFSRPNINDGAKACADMPGAVLLDVREPDEFARGRIPGAVNLSVKRISEVEAVVPDKSTPVFIYCFGGGRADKAE
    LSMRAMGYENVKSIGGISGYRGPVER

    >gi|257064473|ref|YP_003144145.1| polyferredoxin, heterodixulfide reductase subunit A [Slackia heliotrinireducens DSM 20476]
    MSRIGVFICHCGTNIAATVDVEAVAAAARKLPEVVHVETNKYTCSDPGQEGLRQAIVDHGIDRVVVAACSPRMHEATWRK
    LLADTPVNPYMLEVANIREQCSWVHKDRSVATEKAIDLVKMAVAKVARLQPLHSTEIPVHKRALVIGGGIAGMQTALDIA
    DAGFPVTIVERETSLGGKMVMLDKTFPTMDCSA
    CICTPKMSEVGNHPNITVKTLAEVENVSGYIGNFEVTIREKAKYIDY
    NLCTGCGACETKCPVRVDSDFEQGMKKRTAIYKMFPQAVPAKPVIDAAHCRKLTEGKCGVCARVCPTGAIRYDDEDKVTT
    ETYGAIIFATGYQLIDWKPLYPEYGGGKYPDVITGLQFERLVNASGPTEGHILRPSDGTEPKTVVIVKCVGSRDPTKGKA
    YCSRACCMYSAKHAHQYLEKVSDGRCYVFYMDVRTPGKGYDEFYVNTVHEGAQYLRGRVSKIFKEGDKLICKGEDTLTSR
    QVSVAADMVVLETAMVPADGIDELAAKCTVGRDADSWLVEAHAKLRPVETNTAGIYLAGTCQGPKDIPDTVCQAGAAASK
    VIGLLNKDMLQSNPQISRVNESLCQGDGACVNTCPYGAISIVQKQFRENSKKVTRPVAQVNPGLCQGCGACTVTCRAGAM
    DLLGYTNESIMREVDALCQW

    >gi|257064479|ref|YP_003144151.1| O-6-methylguanine DNA methyltransferase [Slackia heliotrinireducens DSM 20476]
    MGSFNDKVYEVVREIPYGRVTTYGAVARAIGQPRKALFVGFAMHSSADPDDPPCHRVVYKDGRVFENEDGSPSLQKLLLE
    AEGVPFLDDTHVDLDACLWHRVPTDEIGRPTDIDWEREMAEDQ

    >gi|257064525|ref|YP_003144197.1| thioredoxin reductase [Slackia heliotrinireducens DSM 20476]
    MHDIIVVGAGPAGMTAALYALRNGKSVLIIEKEGFGGQMTLSPKIENYPGTVQISGMELADQMMNQIIEQGVDFEIEEVT
    GITQENGTFTVSTDDGEHQAKAVIIATGVKHRMLGLEGEDDLVGDGISF
    CAVCDGDFYTDKVVCVAGGGNSALQEAVLLA
    TKCKEVIMLQDLEFFTGEERLQEVLFANENVSAHTNTLIKSLVTGKDGLRGVEIADRTTGESQVVGCDGLFVAIGLIPDN
    IPYAELADLNDWGYFDSDENCTTKTPGLFVAGDCRSKSIRQITTASGDGAVAALAACRYINLS

    >gi|257064767|ref|YP_003144439.1| glutathione peroxidase [Slackia heliotrinireducens DSM 20476]
    MTVHDYNVEARDGSTVSLKDYEGKVLLIVNTATGCGFTPQYEELEAMYAEYKDQGFEILDFPCNQFANQAPESDEEIHQF
    CTLKFGTEFPQFKKIEVNGENAIPLFADLATQKPFEGFGKGLKSMAMSKVAKAVDKEFGDKAYIKWNFTKFLINREGELV
    ARFEPTADMDDVKAAVAQQL

    >gi|257064837|ref|YP_003144509.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Slackia heliotrinireducens DSM 20476]
    MAKRAIFYLNQFFGGIGGEDMADHAPEFRTELVGPAQGIASAAGDDIEAVGTIICGDNFFGQREDEAVEFIKNVLTQQKP
    DIFIAGPAFNAGRYGFACAGACKAADELGITCVSGMYAENPGLEHCQSFAWVAETANAAAQMRKAIPAMANLVKKLSLGE
    EVTPEDDHYFPQGRRECILVDEIGSKRAVNMLLARLNDEPFTTELPMPSFDVVEPAPAILDLSKATIALATSGGIVPLGN
    PDHLQSASAQQWNKYDISSEDDLKSDFFTVHGGFDPVYCNEDADRVAPLDALRELEREGKIGKVYDYMYTTTGTGTAVAN
    ARAFGKEIGAELKDAGVDGVILTST
    CGTCTRCGATMVKEIERYGIPIIHMATITTISESVGANRILPTVAIPYPAGNPEL
    PPEEEKSLRVSMVERAVDGLATQVDGPTHFE

    >gi|257064952|ref|YP_003144624.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Slackia heliotrinireducens DSM 20476]
    MNITYWSDFACPYCYIGETRLKKAIDSIGMTGQIDVEMKAFELNPDASYEVTGPTLDRFAAKYGLTKDQAAERIEGISQM
    GREEGLDFNYATTLNTNMLDAHRLTKLAHSLGNTRFEELCYRAYFTDNLVMADHDVLRGLAAEAGLPAQDVERVLSSDEF
    ADAVRADEHTAYAMGVHAVPFFVIDGTYAVSGCYPTDDLADVIKQALAKSQEQETAQGAACGPDGCAL

    >gi|257065152|ref|YP_003144824.1| NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Slackia heliotrinireducens DSM 20476]
    MINGTEKILVCCGTSCIANGALDVADAIEQELAARGINGVEVCVTRTGCSGECEQGPIVRFMPRDLMYYRVTVRDAAAIV
    DSLEGEPVKKLLFKKDKQFFEHMDDNPFYALQHKVVLKDVGIIDPLSLDDYIARGGYEGLKRALKMTPDEIITEVEKSGL
    RGKGGAGFPTGRKWRTAAGYDVFPKYIVCNGDEGDPGAFMDGSTMEGSPHAVIEGMIIGALAIGAEEGVLYIRDEYALAR
    DHIQHAIDDAYAAGILGESILGTDHKLDLSIVRGGGAFVCGESTALMASIEGRVGEPRAKYIRSVQRGLFDNPTVLNNVE
    SLASIPTILRDGGEKYAEIGTDNSKGTKVFAMVGKVKHTGLVEVPMGTTLRTLIYDIGGGIIGDRPFKAIQTGGPSGGCI
    PEELLDLPVDFDTLVEYGAMMGSGGMIVMDDRSCMVEVARYYVDFLCEESCGKCTPCREGLRQMRAILTDICEGRGKPGD
    IELLERIGHTMQDASL
    CALGRTAPNPVLTTIKFFRDEYEAHIDGKECPAGVCAKLTQFAIEPEACTGCGMCMRACPAGAI
    SGDRREPHVIDPHLCIACGSCREACHFDAVLTERRPA

    >gi|257065193|ref|YP_003144865.1| peroxiredoxin [Slackia heliotrinireducens DSM 20476]
    MSLIGKEIEDFTVKSFHNGEIETVTKDDVLGKWGLFFFYPADFTFVCPTELEDLANNYEEFQKAGCEIYSVSCDTEFVHK
    AWHDESERIGKVTYQMLADPAHVLAKQFKVLIKNAGQAERGAFIVDPEGTIQVEMITAGGIGRNADELLRLLKAAQFVAD
    HGDQVCPAKWQPGEETLAPSLDLVGLL

    >gi|257065194|ref|YP_003144866.1| thioredoxin reductase [Slackia heliotrinireducens DSM 20476]
    MTDTKNLYDAVVIGGGPAGLTAAIYLSRARYRTLVVEKDRIGGQITITHEVVNYPGVLATTGEALTRTMRQQAEGFGAEF
    KIAEVTNLDMDPNEDGVKIVHTDKGDIACHAVLMATGASPRLAGFEGEEDFQGHGVAY
    CATCDGEFFTGKEVLVVGGGFA
    AAEEAVFLTKYASHVTILVRKDDFSCAASVSEPAKTNPKITIRYNTRIASIAGDTALRSAVLENTKTGERETWKPAGDNE
    TFGVFVFAGNTPATELANGIAEVDDRKFIVIDEHNMTTKPGLFAAGDVCNKALRQVATAVGEAASTASEMERYIKAQQEA
    TGLTPQVKEPEQLPAAPAKAEPAAAKTQPGGLFTGDVLAQLNAVFARMETPLVLRLSLDDRPVSTELRGYMEELAKLTDK
    LSVDIVVAPEGDDLPKVELCRADGAWTGLAFHGVPAGHEFTPFVLGLYNASSAGQAIEDADRAAAYAIDRKVDITVAIGL
    S
    CTMCPDLVQACQRIATLNDNVTAQVYDVAHFPSLQQKYDIMSVPCLIINDGEKETVEFGRKNISGVLELIG

    >gi|257065197|ref|YP_003144869.1| hypothetical protein Shel_25130 [Slackia heliotrinireducens DSM 20476]
    MDFLNSKQGLIVAGLIVGALTAVLAATGNPANMAICAACFIRDMAGSMYLHTAAPVQYFRPEIVGFVAGSFLIAVATKEY
    RSTAGSSPMIRFVLGFIMMLGALVFLGCPLRMVIRMSAGDLNAWVALIGLAAGAITGAVFLKQGFSLGREVDTNKATGAV
    LPIILVVLLIIGLATGAYAASEKGPGSMHAPVAVALIVALVIGAIAQKTRICFVGGIRNLFLMKDYTLLLPIASLFVVML
    VFNIATGGFKASFDGQPIAHSQHIWNILGLYAVGFGGVLAGG
    CPLRQMVLAGQGSSDAAITFVGMLVGAAFAHNFGIASA
    AAAAATAETEAVVGGPTIVGQVVLVASIAVLFIIAVTNLRKRKVVATAE

    >gi|257065204|ref|YP_003144876.1| Glycine reductase complex selenoprotein A [Slackia heliotrinireducens DSM 20476]
    MSILAGKKVVVIGDRDGVPGEAISACVETAGGEVVFSSTECFVCTAAGAMDLENQRRVKEFAEQFGPENVVVVVGASEGE
    AAGLAAETVEAGDPTFAGPLTGVQLGLACYHVCEPEMKEEFDEAVYEDQVGMMEMVLDVDDIIEEMTGIREDYCKY

    >gi|257065205|ref|YP_003144877.1| thioredoxin domain-containing protein [Slackia heliotrinireducens DSM 20476]
    MSMLELDKKTFAPEVLEAEGTILVDFYGDGCVPCAALMPHVHELSDKYDGQLKFCALNTTKARRVAIGQQVVGLPTVAIY
    KNGEKVEEVCKDDATPESVEEMIKRNL

    >gi|257065206|ref|YP_003144878.1| thioredoxin-disulfide reductase [Slackia heliotrinireducens DSM 20476]
    MENVYDVIILGAGPAGLAAGLYAGRSRMNALLIEKGQDGGQIATTSEIENYPGQAVDTEESGPSLIARMSKQVEHFGCNR
    VADTVTAVELQGDVKKVIGKKGEYCAKSIILATGAHSRPIGCENEAQFVGKGISF
    CATCDANFFTDLEVYVVGGGDSAVE
    EAMYLTGFARKVTIIHRRDELRAAKSIQEKAFANPKLNFMWDSVVEEVGGDEGVLATMKVRNVKTDEVTVIEADEDDGMF
    GLFGFIGFLPNTDLYEGQIELERGYVVTDDNMKTNVPGVFAAGDLRKKSLRQVVTAAADGAIAATQALKYCED

    >gi|257065207|ref|YP_003144879.1| glycine reductase, selenoprotein B [Slackia heliotrinireducens DSM 20476]
    MEKIKVLHYINQFFAQIGGEEEADHPVEFFEGEVKGPGLAFMQQFGEEAEIVGTIVCGDGYFNEHIDDTLAKVLEFVDRV
    HPDLLIAGPAFNAGRYGVACGAVASAVQEKLGIPALTGMYIENPGVDMYRDKVVIASTKNSAAGMRAAVKSMAPLALKLA
    RHEQIGASCEDGYISQGIRVNFFEKKRGSKRAVEMLLAKLAGKPYTTEYPMPNFDRVDPQPAVVDLSKATIALVTSGGIV
    PKGNPDLIESSSASHYGEYDITGVDDLTSDTYETAHGGYDPTYANDDADRVLPVDVLRDMEREGRIGKLHNKFYTTVGNG
    TAVASAKAFAAEIGQKLVASGVDAVILTST
    CGTCTRCGATMVKEIERAGLPVVHICTVTPISMTVGANRIVPAVAIPHPL
    GNPALSADEEKKLRRSIVEKALNALATPVDGQVVFKD

    >gi|257065213|ref|YP_003144885.1| NADPH-dependent glutamate synthase beta chain-like oxidoreductase [Slackia heliotrinireducens DSM 20476]
    MTMLSVAPKSAYDSRIADVLGPFQRRIEAMPPGTCPIAVQLVLLETGGAQTCGKCVPCRDGIPQLAALMRSVLNCEADEC
    TLDTMRQLAQMIKDTSD
    CAIGYEAGKMALEGLDAFAEEYRSHVQNKMCAEGVGQTVPCETKCPAHVNIPAYIGLVLEGDC
    EGAVKMIRKDNPWPTACALICEHPCEARCRRTLIDAPLNIRGIKKYAVDNAPADTVPVPKRLPDSGRKVAVVGGGPSGLT
    CAYYLALMGHQVTVYEGRKKLGGMMRYGIPAYRFPRERIDQDIRAILSVGGIDVRYETIIDDVEMARLSYDYDAIYVAVG
    AQGGKSLKIDGVDANGVMSAVQLLERIGDGDYPDFSGKKVVVIGGGNVAMDCARTSVRAGAEEVTVAYRRRIEDMTALHE
    EIEGAMSEGVEFMTLQSPLRIEKDEDGNVAALICQPQYIGAVKRGRPAPVDANKPTVRLEADIILIAVGQDIHSAPFEKF
    GMKAERTRFVADENLRAEGFKNIFVGGDCQTGPKSAIMAIGAGKVAARNIDEYLGFHHKLDPEVEVPKARPNVREAYGRV
    NIVERPARERGRDFDHIEIPLCEEEVMQECSRCLRCDAFGCGVLEGGRVQYV

    >gi|257065224|ref|YP_003144896.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Slackia heliotrinireducens DSM 20476]
    MTKKVIYYVNQFFGGIGGEDTADFEPEIREGQVGPAVAANGQLKDAEITHTIICGDNFMGSNTEEALSRILGFLEDKEFD
    LLIAGPAFQAGRYGVACGNVCKAVGEKFGVPTVTSMNVENPGVEMFKKDTYIMDGANAAAKMRKDLKNLVGFANKLLSGE
    PLQGAEIEGYFPRGIRHEIYLEDKHENTAAYRGVQMLIKKIKGEPFQTELVVPVKDVVEPAAPVNLSEAVIAMITTGGIV
    PVDNPDRIQSASATRWGRYNIEGVDKLPNRASGGYKTIHAGFDPAAADADPNVIMPIDAMRQLEKEGKFARLHNYFYSTV
    GTGTTESEAARMAEEMIPYLKEDGVNAIILGST
    CGTCTRCGATMVKVFERAGFPIVHMCNLIPVSTTVGANRMVPTISIP
    YPLGDPNTLPEEQWKLRYHRCGVAVDALATPVEGQTVFKVKI

    >gi|257064524|ref|YP_003144196.1| anaerobic ribonucleoside-triphosphate reductase [Slackia heliotrinireducens DSM 20476]
    MYQVVKRDGKIVDFSIDKISVAITKAFDALNKQYHPSVIELIALHVTSDFEDKIVDDKITVEDIQDSVEKVLSESGYADV
    AKAYILYRRQREKVRNVNSALLNYKDLVDNYLKINDWRVKENSTVTYSVGGLILSNSGAITANYWLSEVYDDEIAEAHRS
    AAIHLHDLSMLTGYCAGWSLKQLIQEGLGGVPGKITSSPASHLSTLCNQMVNFLGIMQNEWAGAQAFSSFDTYLAPFVKV
    DNLSQKEVKQCIQSFIYGVNTPSRWGTQAPFSNITLDWTVPNDLKNLNAIVGGKEMDFTYGECQHEMDMVNKAFIDIMIE
    GDANGRGFQYPIPTYSITRDFNWDETENNKLLFEMTAKYGTPYFSNYINSDMEPSDVRSMCCRLRLDLRELRKKSGGFFG
    SGESTGSIGVVTINLPRIAYLATDEADFYARLDHLMDVAARSLKTKRAVITTLLDKGLYPYTKRYLGTFENHFSTIGLIG
    MNEVGLNANWLRADLTDERVQRFARDVLNHMRNRLSDYQEMYGDLYNLEATPAESTTYRFAKHDKEKYPDIITANMNGTP
    YYTNSSHLPVGYTEDVFSALDIQDDLQTLYTSGTVFHAFLGEKLPDWKAAANLVRKIAENYKLPYYTMSPTYSVCKDHGY
    LTGEQFTCPHCGAKTEVYSRITGYYRPVQNWNDGKAQEYKDRKVYNIGHSTLTHQGPNPAPVDDVIWEAAQERGCCEPAQ
    VLMTPEAEPEVESAPAPAADNPQIILFKTPT
    CPNCRAAGALLDKAGIAYQAVNADESKELVEKYGVKQAPTLVVLKDDGF
    ESYRNVSNIKGWIKER