Sinorhizobium meliloti 1021 uid57603

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16262467|ref|NP_435260.1| selenophosphate synthetase [Sinorhizobium meliloti 1021]
    MNTLAPRLTDLAHGGGCGCKLAPSVLQQLLANQPAARPFAQLLVGNDMADDAAVWQVDDNTCVIATTDFFMPIVDDPRDF
    GRIAATNAISDVYAMGGKPILALAIVGMPINKLDSTTIAKILEGGASICAEAGIPVAGGHSIDSVEPIYGLAVIGLCHPS
    EVRRNGGVKAGDALILTKGIGVGIYSAAIKKNALPPGCYEEMIGSTTLLNRIGADLAADPDVHALTDVTGFGVLGHGLEM
    ARASQLSLTLRLSAIPFLSQAYMLAEQGFITGASGRNWASYGADVVLPDDLPDWQRLLLADPQTSGGLLVACAPEKAGAL
    VEKVRLAGYPLAGIVGTAAAGAAQIKVIS

    >gi|16262603|ref|NP_435396.1| hypothetical protein SMa0280 [Sinorhizobium meliloti 1021]
    MLDRTIPHNLARKAVLYRMVMPGHTCPYGLKTKDLLQRSGYEVDDHHLTTREETDAFKAQHGVPTTPQVFIDGQRVGGYD
    DLRRFLGKPVADPKATTYRPVIVLFTLTALTAMAASHAVNGTPFTLRAAEWFIAFSMVVLAMMKLQNVESFATMFLNYDL
    LAMRWIPYSYIYPYAEGLAGVLMVAGALNWLSVPVAMFIGTVGAVSVFKAVYIDKRELKCACVGGSSNVPLGFISLTENL
    MMIAMAVWMAAGSIGLIATHAM

    >gi|16262778|ref|NP_435571.1| FixI2 E1-E2 type cation ATPase [Sinorhizobium meliloti 1021]
    MSCCSGIAVPSAGAASRTSISPEEIRLASRDLGDGLRQTAMTLPDAHCAACIAAVEGALRKISGVELARVNLSARRVTIN
    WRGNDDESPDFAAALAKIGYASHLASIEEETQDPVLASLLKALAVAGFSAMNIMILSVSVWSGADPATRHAFHLVSAALA
    LPAIVYSGRFFYRSAWAALRHGRTNMDVPISVGVLLAFALSVYDTLHNAAFAYFDASTSLLFVLLAGRTLDHLMRGRARS
    AVGALARLSPRGASVVQADEAIDYVPLSEIQPGMRLLVAAGERVPVDGVVVKGASELDASIVSGESEWRRAAPGSALQAG
    VMNLANPLTLLATASVDGSFLAEMTRMMEAAESGRSTYRRIADRAASLYAPVVHGVALLSMVAWLFGTGDLHKSVTIAIA
    VLVITCPCALGLAVPMVQVVAVRRLFERGIMARDGSAFERLNEIDTVLFDKTGTLTLGEMRLVNAGDIQPRLLSLAAAMA
    RVSRHPASVAIALADPRRPVAPVEFDSLEEVHGCGIEGRAGDAVYRLGRPSWASTAKQVDLGTSSTTVLSKDAETIAVFA
    FEETVRPGARELVQTLRSAGLSVRILSGDRSAAVSSIARQLDIEAFSAELLPGEKVEAIRALAATGRKVLMIGDGLNDAP
    ALAAAHVSIAPSSATDVGRSASDFVFLGQSLLAVRDIIQTAARADVLIRQNFAMAIAYNVVSVPFAIGGVVTPLAAALAM
    SLSSIVVVGNALRQGAKVKKGPRTFGATKPATAKI

    >gi|16263001|ref|NP_435794.1| ActP Copper translocating P-type ATPase [Sinorhizobium meliloti 1021]
    MTAFTQIEKSAAVPAPTDFGIEGMTCASCVRRVEKAISAVPGVASATVNLATERASVQFTGAPDTGGVLLAIEKAGYEPK
    VIIQEFGIEGMT
    CASCVSRVEKALRTVPGVADASVNLATEKGTVRFVSGVDVAAIEAAVRDAGYDVRKAKASGATAEPED
    RRELETRTLKRLVILSAVLTLPLFLVEMGSHFMPGVHEWIMENIGMRHNLYIQFALATAVLFGPGLRFFRKGVPNLLRWT
    PDMNSLVVLGTTAAWGYSVVATFASGLLPSGTANVYYEAAAVIVTLILLGRYLEARAKGRTSQAIKRLLGLQPKTAFVAH
    GDEFVEIQISDVVVGDVIRIRPGEKIPVDGTVLDGNSYVDESMITGEPVPVQKAAGAEVVGGTINKNGSFTFRATKVGGD
    TLLAQIIKMVETAQGSKLPIQALVDKVTAWFVPAVILVAVLTFAAWYVFGPSPALTFALVNAVAVLIIACPCAMGLATPT
    SIMVGTGRAAELGILFRKGEALQSLREADVIALDKTGTLTKGRPELTDIVPADGFEADEVLSFVASLEALSEHPIAEAIV
    SAAKSRGIALVPATDFEATPGFGVRGAVSGLPVQVGADRAFSGVGIDVSPFVVEAERLGNSGKSPLYAAIDGRLAAIIAV
    SDPIKDTTPQAIKALHDLGLKVAMITGDNRRTADAIARQLGIDEVVAEVLPDGKVDAVKRLREGGRKVAFIGDGINDAPA
    LTEADVGIAVGTGTDIAIESADVVLMSGDLIGVPKAIALSKATIRNIKQNLFWAFAYNVSLVPVAAGVLYPLNGTLLSPI
    LAAAAMAMSSVFVLGNALRLRSVNPA

    >gi|16263023|ref|NP_435816.1| hypothetical protein SMa1053 [Sinorhizobium meliloti 1021]
    MSAYLPSLAGGMLIGASAVMLLLLNGRIAGISGIVGRLLQGVGMTTNLAFVLGLLLGPLAYLLMFGSWPAVQITAGWPLI
    IIAGLLVGFGSRMGSG
    CTSGHGVLGLARVSPRSMVAVATFLTAGVAAVALLRGLAL

    >gi|16263042|ref|NP_435835.1| putative cation transport P-type ATPase [Sinorhizobium meliloti 1021]
    MGIDPNHHHSRTNVHAPPAQTEGSQVPTMEGVIYTCPMHPQVRQIGPGNCPICGMALEPAVVTAETGPSAEFVDMRRRFW
    IGLVLTSPVLALEMGGHLTNLHMLLGAQTSNWLQLVFATPVVLWAGAPFFERAWRSLVTRRLNMFTLIAMGTGVAWVYSV
    IATVAPGLFPATFRSADGAVPIYFEAAAVITVLVLLGQVLELRAREQTGGAIRALLDLAPKTARRIRNDGTDEDLPLEAV
    AVGDRLRVRPGEKVPVDGTLVEGRSSVDESMITGESMPVTKEVGAKLIGGTMNKTGGFVMEAGKVGRDTMLSRIVQMVAE
    AQRSRAPIQRLADEVSGWFVPAVILIAIVAFVAWMWLGPEPRFTHGLVAAVAVLIIACPCALGLATPMSIMVGVGQGARA
    GVLIKNAEALERFEKVNTLVVDKTGTLTEGKSKVTSVVAVNGIAEDELLQVAATLERASEHPLAAAIVEAANVSRLGLGT
    AENFDSPVGKGVTGTVKGHRLVIGSHQIMSEEKVDVAPLTEKAEALRGEGATVIFVAIDGRVGGLFAISDPIKPTTPAAV
    AALMKDGVRVVMLTGDNRTTANAVARKLGITEVEAEILPEHKSEIVRRLRNEGRVVAMAGDGVNDAPALAAADVGIAMGT
    GTDVAIESAGVTLLKGDLQGIVRARQLSHATMRNIRQNLFFAFIYNAAGVPVAAGVLYPAFGLLLSPIIAAAAMALSSVS
    VIGNSLRLRSTRI

    >gi|16263112|ref|NP_435905.1| FixI1 ATPase [Sinorhizobium meliloti 1021]
    MSCCASSAAIMVAEGGQASPASEELWLASRDLGGGLRQTELSVPNAYCGTCIATIEGALRAKPEVERARVNLSSRRVSIV
    WKEEVGGRRTNPCDFLHAIAERGYQTHLFSPGEEEGDDLLKQLILAVAVSGFAATNIMLLSVSVWSGADAATRDLFHWIS
    ALIAGPALIYAGRFFYKSAWNAIRHGRTNMDVPIALAVSLSYGMSLHETIGHGEHAWFDASVTLLFFLLIGRTLDHMMRG
    RARTAISGLARLSPRGATVVHPDGSREYRAVDEINPGDRLIVAAGERVPVDGRVLSGTSDLDRSVVNGESSPTVVTTGDT
    VQAGTLNLTGPLTLEATAAARDSFIAEIIGLMEAAEGGRARYRRIADRAARYYSPAVHLLALLTFVGWMLVEGDVRHAML
    VAVAVLIITCPCALGLAVPVVQVVAAGRLFQGGVMVKDGSAMERLAEIDTVLLDKTGTLTIGKPRLVNAHEISPGRLATA
    AAIAVHSRHPIAVAIQNSAGAASPIAGDIREIPGAGIEVKTEDGVYRLGSRDFAVGGSGPDGRQSEAILSLDFRELACFR
    FEDQPRPASRESIEALGRLGIATGILSGDRAPVVAALASSLGISNWYAELSPREKVQVCAAAAEAGHKALVVGDGINDAP
    VLRAAHVSMAPATAADVGRQAADFVFMHERLSAVPFAIETSRHAGQLIRQNFALAIGYNVIAVPIAILGYATPLVAAVAM
    SSSSLVVVFNALRLKRSLAAGRGATPGTLIHSGAVTS

    >gi|16263495|ref|NP_436288.1| methionine sulfoxide reductase B [Sinorhizobium meliloti 1021]
    MTYRKTDEEVSKLTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWPSFTKPIVPANVNEL
    RDNSHGMIRTEVRSAHGDSHLGHVFPDGPQDRGGLRY
    CINSAALRFIPREEMEAEGYGGYFNQVEDI

    >gi|16263496|ref|NP_436289.1| methionine sulfoxide reductase A [Sinorhizobium meliloti 1021]
    MTKRAVLAGGCFWGMQDLIRKLPGVIETRVGYTGGDVPNATYRNHGTHAEGIEIIFDPERISYRRILELFFQIHDPTTKD
    RQGNDIGTSYRSAIYYVDDEQKRIAQETIADVEASGLWPGKVVTEVEPVRDFWEAEPEHQNYLERYPNGYTCHFPRPNWV
    LPRRSAAE

    >gi|16263497|ref|NP_436290.1| hypothetical protein SMa1898 [Sinorhizobium meliloti 1021]
    MAFNTQRLQFSGHSGATLSARLDLPNGPLRAYALFAHCFTCSRDLAAARQIGAELAREGIAVLRFDFTGLGSSEGEFAST
    NFSSNVADLLSAADYLRHHYQAPAVLIGHSLGGAAVLAVAGEIPEVRAVATIGAPADVGHVLKNFGASLEEIDKNGEADV
    DLAGRTFLIRKQFVEDTRAHRIKDAVGRLKKPILILHAPLDHTVGIENATEIFVAARHPKSFISLDKADHLLTDPEDAAF
    AGRIISEWLTRYLAADTPQGAGPIEHVHVRETGEGKFQNAIQAGGHRLFADEPESVGGLDAGPSPYDFLAIALGA
    CTSMT
    LRLYAGHKQLKLGRIGVDVSHTKIHAKDCEECTETERGDSRKIDRFERVISIEGEVSEELREKIVEIAGKCPVHRTLETV
    AKIETVVK

    >gi|193782772|ref|NP_436537.2| OsmC-like protein [Sinorhizobium meliloti 1021]
    MTTQEKVLYTGKTHTTGGREGFARSDDAQLDVRLSPPGGGKAGTNPEQLFAAGWSACFIGALGLAASKHKLTLPAETAVD
    AEVDLAKSDGGFFLQARLAVSLPGIDADLARSLIAEAHQT
    CPYSKATRGNIEVDLTLA

    >gi|15963786|ref|NP_384139.1| thioredoxin protein [Sinorhizobium meliloti 1021]
    MATVKVDTANFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEIATELAGKVKVVKLNIDENPELAAQYGVRSIPTLAMF
    KGGEVADIKVGAAPKTALSSWISNAVA

    >gi|15963877|ref|NP_384230.1| putative heavy metal transporting ATPase protein [Sinorhizobium meliloti 1021]
    MTGIFRETRFRVDGMDCASCAAKIDTAVRRVAGVEDVNVSVAAGTMTVRHAARDDIGAQVMRKVGVLGYGLSPLDVAAER
    QPAQSEHACCGHDHAAGSAHGEASHDHGHSTALPASTKPSSRFTAPLPWWRTAKGKLTLACGVALASAYAIGQFVPATEP
    WIFTLAMLVGLLPIARRALMAALSGTLFSIEMLMTIAAAGAVFIGAGEEAAMVVFLFLIGELLEGVAAGKARASIQALTA
    LVPKSALLEENGRTVEVPAESLAPGAIVLVRPGDRLPADGIIVSGESSVDEAPVTGESTPVLKEAGANVFAGTVNGDGAL
    RVRVTAAAADNTIARVIRLVEEAQEKKAPTERFIDRFSRYYTPGVVLVAALVAVIPPLFFGGLWQDWIYKGLALLLIGCP
    CALVISTPAAIAASLSAGARRGLLIKGGAVLENLGRITAVAFDKTGTLTEGRPKLTDIVGFGRSEAEILGYAAALEQGSS
    HPLAHAVLSRAEADGLALLPVEGARAIGGKGVAASADGVELFLGSPEAARERAPLAAEDLARIETLQGEGKTVSVLVVGG
    RAAGALAMRDEPRADAAAGLRALADQGLRVVMLTGDNRATAEAIAGRLGGIEAHAGLLPEDKQRIVSRLRAEGLVVAKVG
    DGINDAPALAAADVGIAVGGGTDVALETADAASLHARVSDVAAMVKLSRVTMRNIHQNIAIALGLKAVFLATTIAGVTGL
    WPAILADTGATVLVTINALRLLR

    >gi|15963919|ref|NP_384272.1| putative methylated-DNA--protein-cysteine methyltransferase transcription regulator [Sinorhizobium meliloti 1021]
    MNVVTSIPTDITPEGTDYDTVRRVIAMLTEDYREQPSLESLARRLGQSPTQLQKVFTRWAGLSPKAFLQAVTLDHAKRLL
    RQEDMPLLETSIEVGLSGPSRLHDLFVTHEAMSPGEWKARGAGLTIRYGFHPSPFGTALVMVTDRGLAGLAFADSGEERA
    SFEDMAARWPNATYVEDSAATARYAARIFDPDRWCAEEPLRIFLIGSDFQIRVWQTLLQIPLGKATTYSRIAENLGQPTA
    SRAVGAAVGRNPISFVVP
    CHRALGKTGDLTGYHWGLTRKRAILGWEAGKA

    >gi|15963942|ref|NP_384295.1| molybdopterin biosynthesis protein MoeB [Sinorhizobium meliloti 1021]
    MTTDATLAPSEIARYARHIVLPEIGGPGQQKLKAARVLVIGAGGLGAPALQYLAAAGVGTLGIVDDDVVSLSNLQRQVIH
    ATADIGRPKVESAAAAIDALNPHVKVVAHPVRLGPANADALFRQYDLVVDGSDNFDTRYLAADTAEAAGVALVTGAVGRF
    DGSVTVLKPYGTDAEGHPNPSYRDLFPEPPPPGTVPT
    CAEAGVLGALTGVIGTLQAMEAIKLVTGIGEPLIGRLLLYDAL
    AAQFNTIRYRRGTR

    >gi|15963963|ref|NP_384316.1| methionine sulfoxide reductase A [Sinorhizobium meliloti 1021]
    MFLIDMFNKKTILPDAATALPGREEEIPTATTHFVSGRPLQGPYPEGMKKVLFGMGCFWGAERLLWEIPGVYVTAAGYSG
    GLTPNPTYQETTTGLTGHTEVVLVVYDPAKVSLQRLLKTFFEEHDPTQGMRQGNDVGTTYRSAIYVYDEEQLAEANAARN
    AFQKALRVYNHDREITTEIAKAGPFYFAEDYHQQYLAKNPDGYCGLRGTGVSCPIGA

    >gi|15964018|ref|NP_384371.1| hypothetical protein SMc00345 [Sinorhizobium meliloti 1021]
    MSEKPRVTILYCTQCNWLLRAGWMAQELLSTFADTLGEVALIPGTGGNFEIRVDGALIWERKRDGGFPGPKELKQRIRDV
    IEPERDLGHTDRS

    >gi|15964056|ref|NP_384409.1| putative glutathione S-transferase protein [Sinorhizobium meliloti 1021]
    MTAQLTLISHHLCPYVQRAAIALHEKGVPFERVDIDLANKPDWFLKISPLGKVPLLRISQDGGEAILFESTVICEYLEET
    QAGPKLHPADPLARARHRGWMEFGSAILSDLWVYETTQDGATLEAKRNVLKSKFATVEAELGSGPYFAGSAFSLVDAVFA
    PIFRYFDVFDTISDSGVFQGLPRVTAWREALAGRPSVKAAVGEDYPQRLMAFLEKHEAALLKTERVAA

    >gi|15964059|ref|NP_384412.1| hypothetical protein SMc00386 [Sinorhizobium meliloti 1021]
    MTVTIYGIKNCDTMKKARNWLDSRGTSYDFHDYKAEGIDRARLERWCAELGWETLLNRSGTTFRKLDEADKRDLTADKAI
    ALMLEQPSMIKRPVLEAHGKLLVGFKPELYEAEFGA

    >gi|15964113|ref|NP_384466.1| putative oxidoreductase protein [Sinorhizobium meliloti 1021]
    MAVDVMPVDVAIVGGSYAGLSAALQLARARRSVVVVDAGARRNRFAESSHGFLSRDGEAPAAIAAHGREQLLAYPNVRFV
    EGTADTAGRDGANLVVSVQGENIAARRLILATGVVDELPSIPGLQERWGRAVFH
    CPYCHGYELGQGRIGVLATGEHSFHQ
    AMMLPDWGPTILFANEAFEPDAAQAAMLEARGVEIERERVVAVDGAKASVVLDGGRSVSLEGLFVASRTRMASDLPAALG
    CEFEDGPLGPYIRTNEAKETSVEGIYACGDAARGAGSVSHAVGDGVTAAVAAHKSLIFGVH

    >gi|15964190|ref|NP_384543.1| putative transcription regulator protein [Sinorhizobium meliloti 1021]
    MLFDLPDDDILYDALLARSSDYEGQAFVCVKSTGIFCRLSCPARKPKRENTLFFDSISACVNSGFRPCQRCRPLEGASGK
    DPLVKELIELLDRRPEHRWTEGDLVRRGFDPSTVRRAFKRSLGVTFLDLARQRRMGEAARQLSGGASVIEAQIDAGYESP
    SGFRAAFGRLIGQAPAKSQGRVLLFADWIETPLGPMVAVADQTHLHLIEFHDRKALPAEVENLKRKTHSAVVPGRTPPID
    QVERELNDYFAGRSADFRTPLALDGSAFERQVWAELVAIPVGETRSYSDIARKVATPQAVRAVARANGSNCLAIVVP
    CHR
    CIGADGSLTGYGGGLRRKQWLLRHEGRMRPVGLFREWDGEKPVQAAAPTM

    >gi|15964194|ref|NP_384547.1| hypothetical protein SMc01724 [Sinorhizobium meliloti 1021]
    MISRRDLLMAGAALAAVVALRGLVWPVRAVAGEAFEITRTDAEWRALLGEDRYRVLREEGTEPPFSSALDNEKRNGVFHC
    AGCELPVYSSDAKYDSGTGWPSFWQALPGAIGTREDDTLFVTRTECHCRRCGGHLGHIFDDGPPPTGKRH
    CINGLALSFV
    PETA

    >gi|15964202|ref|NP_384555.1| putative mercuric reductase protein [Sinorhizobium meliloti 1021]
    MAKILTPDICVIGGGAAGLSVAAGAAAFGVPVVLVEHGRMGGDCLNYGCVPSKALIAAAKHADAIRKAAEFGIASAEPIV
    DHEHLTARIQSVIEAIAPHDSAERFTSLGVEVIKETARFVDDRTVAAGDRMIRARRFVVATGSSPAIPPIPGLAETPFLT
    NETLFGLKRLPRHLLVIGAGAVGLEMAGAHRRLGADVTVVDSAAALSGQDPELAAIVLDGLRAEGMLLHERTVIRSAEQT
    ETGIRLICENESGPFEIEGSDLLVAAGRAPNHGSLDLDAAGIRHCPKHVEVGADLRTSNRRVYAVGDAAGGLFTHQASYH
    ARLVLQQILFRLPGRERTTIVPQVIFTAPELAQVGLTEERARESARGARTVRLDFSASDRARTDGLDRGLIKIVVGRRGR
    VLGAGIAGPGAGEMIGLWAFAVANRLTLRHFQTYVAPYPTLSEIGKQAAISYYSPMARNRLLRTAIRFLRNFG

    >gi|15964296|ref|NP_384649.1| hypothetical protein SMc02239 [Sinorhizobium meliloti 1021]
    MQSRVNFAKAAPDAYKAVAALDSYVKGSGIEPRLIHLIKLRASQINGCAYCVDMHTKEARHSGLSQQWINLVCVWRESPH
    FDERERAVLGWTEALTNVAETRAPDDAYEALKAHFNEEEMTKITVAIGAINVWNRLCVGFRALPPIDAPAMAA

    >gi|15964501|ref|NP_384854.1| hypothetical protein SMc00803 [Sinorhizobium meliloti 1021]
    MMTAHAIGTREEWLAARLDLLEAEKNLTRRSDELAKWRRELPWVRIDKAYRFETDEGEASLRDLFKGRSQLLVYHFMFGP
    DYTAGCPS
    CSAIADGFNGIVAHLENHDVAFSAVSRAPLAKLTAYKRRLGWSFPWASSDDGAFNRDFCVWFTEQQQREGGI
    EYNFRREPPIPEQPASEPLAGRTVREWDASGSEGPVAQIAAMTGTDVATYTRDRPGVSAFALEDGIVYHTYSSYARGLDG
    LWGMYQWLDRTPKGRNENGIWWRRHDEYAQG

    >gi|15964668|ref|NP_385021.1| peroxiredoxin protein [Sinorhizobium meliloti 1021]
    MTIAVGDKLPNATFKEKTADGPVEVTTELLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDL
    HVMGAWATHSGGMGKIHFLSDWNAAFTKAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNIEESPGQATASGAAAMLEL
    L

    >gi|15964683|ref|NP_385036.1| hypothetical protein SMc00023 [Sinorhizobium meliloti 1021]
    MSASQTSLPKRLLSGVAVAALAMALAACSDEKKEAASTTPAETTASTDATTTASTSQAPAAASVAKPATEVAQASTPAAK
    VELPKSEGSVDMAKLLEPGALPEMALGEANAPVTIVEYMSMT
    CPHCANFHNDTFDAIKAKYIDSGKVRFIVREFPFDPRA
    AAAFMLARCAPEGQYFPMVSMLFKQQEQWAAAQNGRDALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVK
    STPTFFVNGEHYSGDMSVDVMSALIDSKL

    >gi|15964709|ref|NP_385062.1| putative glutathione S-transferase protein [Sinorhizobium meliloti 1021]
    MLKLFYTPGTCSLASHIALEEAGAGYEVHRVDFSKAEQTKPDYLTINPKGRVPALVTDRGILTETPAILAYIAQSFPKAR
    LAPLDDPFEFARLQSFLSYLCSTVHVAHAHARRAARWADDPAAQEAMKAKVPQNMADCFALIERTMFVGPFVRGDAYSVA
    DPYLFTIAGWLESDGVDPARFPRILDHRNRMAERPAVAKVLAEVQS

    >gi|15964715|ref|NP_385068.1| hypothetical protein SMc00040 [Sinorhizobium meliloti 1021]
    MPILYRTTASATGGRAGQAKSKDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKFVAGKEKVKLAEDTTVT
    GTVGIGPRDDGTGFFIDAALEISSPGVEKAVLEDLVQKAHIV
    CPYSHATRGNVDVKLTVA

    >gi|195970189|ref|NP_385097.2| hypothetical protein SMc00117 [Sinorhizobium meliloti 1021]
    MSENRMPKITKTNEEWRAALTPEQYRVTREHGTERPFTGPFLDNKRHGTYKCVCCGRALFRSDTKFDSGCGWPSYFAPVD
    PDAIAEYVDRSHLMVRTEIRCADCDAHLGHVFPDGPPPTGLRY
    CLNGTAMTFEED

    >gi|15964828|ref|NP_385181.1| arsenate reductase protein [Sinorhizobium meliloti 1021]
    MTVTIYHNPACGTSRNTLAMIRNAGIEPTVVEYLKNPPSRAELEAMIAAAGLTVRQAIREKGTPFAELGLGDPSRSDEEL
    LDAMLEHPILINRPFVVAPLGTRLCRPSEVVLDILPDTHKGPFSKEDGEAVLDAGGKRIV

    >gi|15964948|ref|NP_385301.1| hypothetical protein SMc01757 [Sinorhizobium meliloti 1021]
    MVKSLKDLLAEANGSVPKLSPAEAAEKMRSGDVLIVDVRDPTEVQQTGRIKGAVNVSRGMLEFRADPESQYHNPVFQKDK
    TILLH
    CASGGRSALAGKTLQDMGYSAVYNIGGFKDLAEGGIETEPA

    >gi|15965075|ref|NP_385428.1| hypothetical protein SMc01342 [Sinorhizobium meliloti 1021]
    MTLKMKMIAAASLIALAAGVALPGPAAALDAKQKEEFGAFIKEYLLANPEIMLEVQEALTSKQRAKQQETAQAAIADNKK
    AIFNSDYDIALGNPDGDVTIVEFFDYN
    CGYCKRAMSDMDDILAKDKNVRFVLKELPILGPDSLAAHKVSAAFRVIAPEKY
    GDFHRALLGAEERATEETAIAVAAKLGVTEAQLREKMDDGPYDASVREAYTLANELGITGTPSYVVGNEAVFGAVGAPEI
    EQKVANMRACGKTVC

    >gi|15965203|ref|NP_385556.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1021]
    MAENYDVIVVGSGPGGYVTAIRSAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILDHANHAKNYGLTLEGKITAN
    VKDVVARSRGVSARLNGGVAFLMKKNKVDVIWGEAKLTKPGEIVVGAPSKPAVQPQNPVPKGVKGEGTYTAKHIIVATGA
    RPRALPGIEPDGKLIWTYFEAMKPEEFPKSLLVMGSGAIGIEFASFYRSMGVDVTVVELLPQIMPVEDAEISAFARKQLE
    KRGLKIITDAKVTKVEKGANDVTAHVETKDGKVTPIKADRLISAVGVQGNIENLGLEALGVKTDRGCIVTDGYGKTNVAG
    IYAIGDVAGPPMLAHKAEHEGVICVEKIAGVPGVHALDKGKIPGCTYCDPQVASVGLTEAKAKELGRDIRVGRYSFGANG
    KAIALGEDQGLIKTIFDKKTGELIGAHMVGAEVTELIQGFVVAMNLETTEEELMHTVFPHPTLSEMMKESVLDAYGRVLN
    A

    >gi|15965274|ref|NP_385627.1| hypothetical protein SMc02075 [Sinorhizobium meliloti 1021]
    MQETVTLSDAAARRIAAILQAEKDKSAMRVSVEGGGCSGFSYKFDLVDAANADDLILEKDNAKVLIDSLSLVYMGGSEID
    FVDNLLGQSFQINNPNAVASCGCGTSFSI

    >gi|15965320|ref|NP_385673.1| thioredoxin reductase protein [Sinorhizobium meliloti 1021]
    MTARHTKVLIIGSGPAGYTAAIYTARAMLSPVLIAGMEQGGQLMITTDVENYPGYADPVQGPWMMEQMLNQAIHVGTEIV
    NDLVTDVDLSVRPFRIKTDSGTDWTADALIIATGAKAKWLGIETEPTFMGFGVSA
    CATCDGFFYRNKEVIVVGGGNSAVE
    EALYLSNLAKTVTVVHRRDAFRAEKILQERLFAKPNVKVIWDHEVLEYLGTPAKPPMPASVNGVKLRNTKTGETSDMAID
    GVFVAIGHAPAVELFKGKLRQKPNGYLWTAPDSTATDVAGVFAAGDVTDDIYRQAVTAAGMGCMAALEAEKYLAGHMPAA
    IAAE

    >gi|15965374|ref|NP_385727.1| putative thiosulfate sulfurtransferase protein [Sinorhizobium meliloti 1021]
    MNGENENKSRFVVSADWLEQRLDDPSVKIIDAAWYLPAQNRDAKAEYAAAHIPGAVFFDQDAIANRTSALPHTLPSPEAF
    SEAVGAMGISENDTIVVYDGPGIFTAPRVWWMFRIMGAENVFVLDGGMDGWKADGRPTTTEVAKPSPQAFNAVFNPNAVT
    SFERMRDVVEHRLSQIADARSAGRFAGEEPEPRAGMRSGHMPGARSLPSGVFSDKGRFKDLDALRRTFADAGIDLTKPVV
    TS
    CGSGITAAIITLALQSLGHKDNTLYDGSWSEWGSRPDTPVAIGKE

    >gi|15965397|ref|NP_385750.1| hypothetical protein SMc00952 [Sinorhizobium meliloti 1021]
    METVNIDIVSDVVCPWCYLGKNRLDQAIANVAGEINVAIQWRPYQLNPDLPPEGIDHKEHLAAKLGGQAAVDEAHRTLEG
    LGVEDGIAFDFDAVKVSPNTLDAHRLIRWAATGGEAAQDAVVSLLFKANFEEGRNLGDQAVLLDIAEQAGLERPVIAALL
    ASDADKDAVRQEIDMAREIGVTGVPCFIIEQQYAVMGAQSVEVLTSALREIAQMKAEHPAH

    >gi|15965483|ref|NP_385836.1| hypothetical protein SMc00301 [Sinorhizobium meliloti 1021]
    MGFAVMSLTDAAASRVRSIVENAGGEAKGIRISIKKGGCAGMEYAVDLVSEPNSKDDLIEQQGAKVWVAPEAVLYLLGTQ
    MDFETTTLRSGFTFNNPNQTSACGCGESVELKPADLAALAERGDAVVRAS

    >gi|15965494|ref|NP_385847.1| putative bacterioferritin comigratory protein [Sinorhizobium meliloti 1021]
    MAGLGQGDVAPEFELPRDGGGSISLAALRGKPIVLFFYPKDDTKACTEEAISFSALAKEFQEAGIALVGISPDSAKSHDR
    FTQKHGLTVALGADEDKAAANAYGVWVEKSMYGRKYMGVERTTFLIDRQGVISRVWEKVKVPGHADEVLAAAKTL

    >gi|15965534|ref|NP_385887.1| hypothetical protein SMc00538 [Sinorhizobium meliloti 1021]
    MSGINDFIDNEVKSNDVVLFMKGTPQFPQCGFSGQVVQILDYVGVDYKGINVLADADLRQGIKDYSNWPTIPQLYVKGEF
    VGGCDIVREMFQAGELQSLLQGQGISVKGAA

    >gi|15965607|ref|NP_385960.1| glutathione reductase [Sinorhizobium meliloti 1021]
    MSAFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFAEHFEDAAGFGWTVGESRFD
    WAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGPNTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHEL
    CITS
    NEAFDLPALPESILIAGGGYIAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSAD
    ADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPGIYALGDVTDRVQLTPVAIHE
    AMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEEAARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADR
    KVVGAHILGHDAGEMAQLLGISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG

    >gi|15965896|ref|NP_386249.1| hypothetical protein SMc01460 [Sinorhizobium meliloti 1021]
    MSTVAPPSGPESDPRVKAVFDDIRATRKSDFINNMWLWLAFDPDLLERTWAEVKAVMATPSPLDPLVKEMLYIAVSVTNG
    CGY
    CIHSHTAAARAKGMTDAEHADLLRVISLAAKTNQLATALQVPVDPVFDASGRT

    >gi|15966220|ref|NP_386573.1| hypothetical protein SMc01834 [Sinorhizobium meliloti 1021]
    MMLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQLPDFEKLTSEFRTLGIDEIY
    CVSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAVINNGVVEQWFEEEGYSDNCDSDP
    YGVSSPQNILAALKSKKLAA

    >gi|15966330|ref|NP_386683.1| hypothetical protein SMc02350 [Sinorhizobium meliloti 1021]
    MPKTQSNSITLGTRAADFVLPDAGGNLFTLAEFKDSPALLVAFISNRCPFVVLIREALAKFAGDYAGQGLAVVAINSNDA
    QAFPEETLERVGAEVKAYGYGFPYLKDASQSVAKAYGAACTPDFFLYDRERRLVYHGQFDDARPGNGKDVTGADLRAAVD
    AVLKGKDVGTTQVPSIGCNIKWTAGNEPSWFPTAA

    >gi|15966371|ref|NP_386724.1| glutaredoxin 3 protein [Sinorhizobium meliloti 1021]
    METMASVVIYTRQFCGYCTRAKKLLESKGVDFTEYDATYAPELRQEMIEKSRGGRTFPQIIINDVPVGGCDDLHALDRAG
    KLDDLLAA

    >gi|15966399|ref|NP_386752.1| putative thiol:disulfide interchange redox-active center transmembrane protein [Sinorhizobium meliloti 1021]
    MPDQKKRPPALKLFALAALLGVIAGAAAVYVKETGSGNGGVTPTADASCPLAGQKVASLTPVMRGQVAAMTPADKARPIG
    GLDFAGPDGKPLTLAAFAGKTVLVNLWATW
    CVPCREEMPALNALQQTLGGDRFEVVAINIDTGADDKPKAFLDEVGVHAL
    GYYRDASMGVFNTLKKEGLAFGLPATLLLDEKGCLLGSMNGPAVWDSDDAKNLIEAALAPPAGS

    >gi|15966640|ref|NP_386993.1| hypothetical protein SMc03156 [Sinorhizobium meliloti 1021]
    MTDMLTTSRRPETPGQFLVAALYHFVSFPRFADFREPLQAICDANGVKGTLLLAHEGINGTIAGTEEGIAAVLACVRAQP
    EFAGLIHKESRASAMPFLRMKVRLKKEIVTMGVENIDPKKVVGTYVEPKDWNALISDPETLVIDTRNDYETAIGLFQGAV
    DPKTKTFREFPEWVRNNSGLHNKPKIAMY
    CTGGIRCEKATAFMKEQGFEEVYHLKGGILKYLEEIPPEESLWEGACFVFD
    ERVSVTHGLQEGEHTLCHACRQPLTPEDLQSPLHEEGVSCIHCHDTRTEEDRERYRQRQRQIMLAKKRGARHLGS

    >gi|15966688|ref|NP_387041.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1021]
    MKEISCKLLVLGAGPGGYVAAIRAGQLGVNTVIVEKAKAGGTCLNVGCIPSKALIHAADEYHRLRAAASGKGPLGLSLSA
    PAIDLRRTIAWKDGIVGRLNGGVTGLLKKAGVKAVIGEGRFVDGKTVDVETETGLQRIRAEAIVIATGSAPVELPDLPFG
    GSVISSTQALALTDVPQTLAVIGGGYIGLELGTAFAKLGSKVTVLEALDRILPQYDADLSKPVMKRLGELGVEVFTRTAA
    KRLSADRRGLLAEENGRAFEVPAEKVLVTVGRRPVTDGWGLEEIDLDHSGRFIRIDDQCRTSMRGVYAIGDVTGEPMLAH
    RAMAQGEMVAEIVAGHKRSWDKRCIPAVCFTDPEIVGAGLSPEEARAAGIDVKIGQFPFQANGRAMTTLSEDGFVRVIAR
    ADNHLVLGIQAVGHGVSELSATFALAIEMGARLEDIAGTIHAHPTQSEAFQEAALKTLGHALHI

    >gi|15966801|ref|NP_387154.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1021]
    MAYDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHQAQHGLEALGVEVANPKLNL
    QKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKGEEQVLEAKNVVIATGSDVAGIPGVEVAFDEK
    TIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAKQLQRMLTKQGIDFKLGAKVT
    GAVKSGDGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGDVVRGP
    MLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKIGKFPFTANGRARAMLQTDGFVK
    ILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFFKPIHM

    >gi|15966821|ref|NP_387174.1| peptide methionine sulfoxide reductase protein [Sinorhizobium meliloti 1021]
    MLRLLFGFLVTCFLLLPARAAEPQYAIFAGGCFWCVESDFDAVPGVLETISGYAGGKSANPTYEDYAKGGHREVVRVKFD
    PDRVSYAELVGVLFRTTDPTDGDGQFCDRGFAYTTAIHALNERQAMDAKAEKIKAEAELGRPIVTPVEGAAKFWPAEDYH
    QDFGKRNPIRYWYYRNGCGRNRTVEKLWGDRAYAGVSH

    >gi|15966937|ref|NP_387290.1| putative thioredoxin protein [Sinorhizobium meliloti 1021]
    MSGSDNPYQGSFGTQMTGSASFGGQPASAASGPNDLTPDDLIRETTTAAFTRDVLEASRQQPVLVDFWAPWCGPCKQLTP
    VIEKVVREAAGRVKLVKMNIDDHPSIAGQLGIQSIPAVIAFIDGRPVDGFMGAVPESQIKEFIDRIAGPAADNGKAEIES
    VLADAKALIDAGDAQNAAGLYGAVLQADPENAAAVAGMIECMIALGQVAEARQALSGLPEALAGEAAVAAVSKKLDQIEE
    ARKLGDPAALERQLALDPDDHAARLKLAKLRNVEGDRTAAAEHLLTIMKRDRSFEDDGARRELLSFFEVWGPKDPATIAA
    RRKLSSILFS

    >gi|15966987|ref|NP_387340.1| putative thiol:disulfide interchange protein (cytochrome C biogenesis protein) [Sinorhizobium meliloti 1021]
    MTDAETPQDERRPGALRYLMAALPLLIFAVLALIFWSQLNSGRDVSEIPSALIGTKAPMLAMPPLEGAATPSGEPMPALD
    DAAVKGKLTLVNVWASW
    CVPCRQEHPIILELSKDPRLNVVGINYKDRNENALRFLGELGNPFSAIGVDPNGKAAINWGVY
    GIPESFLVAADGTILYKRAGPFDEKSLREGLMPAIEKALAGS

    >gi|16263780|ref|NP_436572.1| hypothetical protein SM_b20029 [Sinorhizobium meliloti 1021]
    MTARLDPFAAAPSLMKSWFSISTAVASSLESSLIELVKIRASQINGCANCINMHTAEARAKGESEQRIYLLSAWREAPCY
    TDRERAALAWTETLTRLSEGHAHAAAYEALKAEFTEEEQVKLTLMINIINGWNRLAVGFGLWVEPAAAKAIAEKAVA

    >gi|16263924|ref|NP_436716.1| hypothetical protein SM_b20176 [Sinorhizobium meliloti 1021]
    MTRLRLHSLVLLLLAAFPAAAAEEPAGYRESEYRAEVPATLSGATVVSTEAAHALWKTGQVAFIDVLPRPPKPTNLPEGT
    VWNEKPRLSIPSALWLPNVGYGQLADAMHAYFRAGLEKATGGDKDRPVLFFCLDG
    CWMSWNAGKRALEYGYTRVFWYPQG
    TDGWTAAGYPTERIEPEPGGR

    >gi|195970066|ref|NP_436727.2| hypothetical protein SM_b20194 [Sinorhizobium meliloti 1021]
    MAATPPLCDFGWPAFDARLPGVDGFTHSIFSQAGPKGLVVAFICNHCPYVKAVIARIVRDAIDLRAHGIGFVAVNSNDAG
    NYPQDSFENMKRFASQNALPFPYLHDEDQSVARAYRAVCTPDFFGFNKDMKLQYRGRLDASRKEIGPADLRRDLYEAMVM
    VALFGKGPAEQQPSIGCTIKWKVSAFQV

    >gi|16263954|ref|NP_436746.1| hypothetical protein SM_b20213 [Sinorhizobium meliloti 1021]
    MRPSAIRYRSPCYETQSGYLALVPCSACQARPPPQEAQVQCRGTKMILFTIAYLAGALTILSPCILPVLPFVFSRAGQPF
    ARSVLPMLIGMVLTFAGVATLAALGGDWAVQANVAGRYAAIAVLAGFGVTLLSTRAAALFTRPAVALGSRLSQKMAGQPP
    SVGASLLLGVATGLLWAPCAGPILGLVLTGAALHGANVETTLLLAAYAAGAATSLALAVLAGGRVFAAMKRSLGLGERLR
    QGLGIAVLAGVAAIALGLDTGQLARLSYASTAAIEQSLLDGVRGDSVEDRASTAVGGEGPAYRSDLPVEGMFPPLDGAVE
    WVNSKPLSVEQLRGKVVLVDFWTYS
    CINCIRTIPYVRAWAEKYRDQGLVVIGVHAPEFAFEKRIANVRSAVTDFDIRYPV
    AIDNDFAIWRAFGNSYWPAHYFIDAEGRIRHHHFGEGDYARSERVIQELLAEAAGSRRGDSGFVQPDATGAEAAPDLANL
    QSGEDYVGYMRASNFVSPERVAADAAHEYTAGEPRLNQWSLAGNWTVGAEQATLNRAGGAITYRFSARDLHLVLGPGENG
    RRVRFQVKVDGAAPGPDHGSDIDSDGYGTVGETRLYQLVRQSGEVRERTFEIRFLEPGVEAFVFTFG

    >gi|16264016|ref|NP_436808.1| hypothetical protein SM_b20278 [Sinorhizobium meliloti 1021]
    MSETVHEFTLEPLDWQPYVKPVKLDEATPEQLEALKVTPSNTKVSNYVLVLANEAEMLAERTPLFNDIMYSEGGLSRGGR
    EIGALAASFVNRCIY
    CASVHANRYIQLEKRPEVVDEIYRRGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGL
    DDLEILDLIHSIAIFGWANRLMHTLGEPHLKE

    >gi|195970039|ref|NP_437349.3| mercuric reductase [Sinorhizobium meliloti 1021]
    MWTTLPPGASISPEVVMNKHFDAVIIGAGQAGPSLAGRLSGVGKTVALIERKLFGGTCVNTGCMPTKAMVASAYAIHTAR
    RGAEYGMTTGPVSVDFGRVMARKEKVRLDARSGVEKWLKGMKNCTVFEGHARFEGPREVRIGDELISGERIFVNVGGRAA
    VADLPGVNDVPYLTNSSIMDLAELPEHLVVVGGSYIGLEFAQMFRRFGSDVTVIEKGARLIGREDPEVSDAIREILENEG
    VRIRTNAECIRFSNHADSVAVGVDCTSGEPEVSGSHVLLATGRHPNTDDLGLDKAGVKTDERGYIEVDDSLRTNVPHIFA
    MGDCNGRGAFTHTSYNDFEIVAANLIDNDPRRVSDRIQTYALYIDPPLGRAGMTETEARKKGHKLLVGTRPMTRVGRAVE
    KGETQGFMKVIVDAETDEILGASILGTGGDEAVQSILDVMYAKKPYTMIARAVHIHPTVSELIPTVFGDLSSA

    >gi|16264738|ref|NP_437530.1| putative exported sulfurtransferase, rhodanese protein [Sinorhizobium meliloti 1021]
    MKMRIASLAFTLSVLASSALAADISPLVDAEWVKANAGDKDVVILDIRDKVAETELGDKPYIQGAVVAPYASAGWRTEVG
    GVPGMLPPLEQITKLIGDLGIDNDDHVVIVPWGTDSTEFGGATRVYWTFKYLGHEEVSILDGGWRQYDAAGGTRSAEAVK
    PEPATFHAEPQEKLLATTEEVAAALKAGVKLIDGRPAEQHQGKSKSPVVRANGTIPGSINIEHSKLYSQDHALFARPETV
    KALTEAAGLAAEEENITF
    CNTGHWASVTWFALSEVLGNKNTTMYDGSMAEWTADPARPVENKSGT

    >gi|16264739|ref|NP_437531.1| hypothetical protein SM_b21550 [Sinorhizobium meliloti 1021]
    MPHRRRDFEMTDISFDRSRYLPSAVVDRGPALVAGGALLIGFLVIAQLIDLRQAALFVVGGLLGVALYHGSFGFTGGWRR
    MVVERRGRGIRAQMLMIGVAALAMIPLISAGSLGGQPLVGALAPVGVSVLVGAAMFGLGMQLGGGCGSGTLFTVGGGSAR
    MLVTLTFFIVGALIGSAHLPWWLTLPSFGTIDLGRQLGTGTAILATLAGLGLVALATALIERRAHGNIEREPEPSRPGWT
    WLLYGPWPLVGAGLLMALLNVATLLLAGHPWSVTFGFGLWGAKAAQAVGVPVATWEFWNWPGPQAALSASVLADVTSVMN
    FGIVLGAAAAASLAGKFAPKAKIPLGSMLAAVVGGLLMGYGARLSFG
    CNIGALFSGIASGSLHGWLWFATAFVGSFVGIW
    MRPLFGLDGFKKK

    >gi|16264766|ref|NP_437558.1| putative copper-transporting P-type ATPase protein [Sinorhizobium meliloti 1021]
    MTALKKIEKAAPLPVSTNFGIEGMTCASCVRRVEKAITAVPGVASANVNLATERATVQFDGEPDTLAVLHAIEKAGYAPR
    IATEELQIEGMT
    CASCVSRVEKALKAVPGVADAAVNLATEKATVSLISGTADLSALEAAVRGAGYELRKTKPAEASAGDE
    DHRAAELGSLKSAVTISVLMTLPLFLMEMGSHFISGVHELIMGTIGMRNNLYLQFALATLVLFGPGLRFFRKGVPNLLRW
    TPDMNSLVVLGTTAAWGYSVVATFVPRVLPSGTANVYYEAAAVIVTLVLLGRYLESRAKGRTSQAIKRLVGLQPKTAFVL
    RGGEFVEAQISEVVAGDVIRIRPGEKIPVDGTVIDGSSYVDEAMITGEPLPVQKTADSAVVGGTINKTGSITFKATKVGS
    DTLLAQIIKLVETAQGSKLPIQALVDRVTGWFVPAVILAAVLTFAAWYTFGPSPALSFALVNAVAVLIIACPCAMGLATP
    TSIMVGTGRAAELGILFRKGEALQRLRDADVVALDKTGTLTKGRPELTDLVAAEGFEADEVLFLVASLETLSEHPIAEAI
    VSAAKSKGIATAAVNGFEATPGFGVSGSVSGRQVLVGADRALATNGIDVSGFSTEAELLGASGKSPLYAAIEGRLAAIVA
    VSDPVKETTPQAIRSLHELGLKVAMITGDNRRTAEAIARKLGIDEVVAEVLPEGKVEAIRKLRQGGRSVAFIGDGINDAP
    ALAEADVGIAVGTGTDIAIESADVVLMSGDLNGVAKAIALSKATILNIKQNLFWAFAYNVSLIPVAAGVLYPVTGILLSP
    IFAAAAMAMSSVFVLGNALRLKSVNPA

    >gi|16264837|ref|NP_437629.1| Ahp/CTSA family anti-oxidant protein [Sinorhizobium meliloti 1021]
    MSLRINDTAPDFTAETTQGTINFHEWIGDGWAVLFSHPKNFTPVCTTELGAMAGIEPEFRKRGVKIIGISVDPVESHSKW
    KNDIKVATGFEVDYPLIGDRDLKVAKLYDMLPAGAGETSEGRTPADNATVRSVYVIGPDKKIKLILTYPMTTGRNFNEIL
    RAIDSIQLTAKHQVATPANWQQGEDVIITAAVSNEDAVQRFGSFDTVLPYLRKTKQPTA

    >gi|16265163|ref|NP_437955.1| putative methylated-DNA--protein-cysteine methyltransferase [Sinorhizobium meliloti 1021]
    MNHYHIFETARGFCGIAWSDAGITRFQLPTRSAESTERLLLRRLPDGAPHEPPPRVAEAVAAVKDYFEGRETDFSRFDLD
    LQGQGAFFENIYQAARKIPWGSTTTYGALAKELGAGPEAARDVGQAMAKNPVALIIP
    CHRVLAAGGKIGGFSAPGGSSTK
    LGMLEMEGVKVAPPEPAQQSLGF