Sinorhizobium medicae WSM419 uid58549

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150375764|ref|YP_001312360.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sinorhizobium medicae WSM419]
    MSITQISQPVTPGEPAPDFVLPAVDGSGTISLADYRGRTPLFLALFIGLWCPFCRRAIAQIAASESALKSAGVETLGVVA
    TAPDNAQLYFRFRPTRLRLAADPELSTHQAYGVPRPIPTPEFLRALDTTLINPDGLFAEPLPITHAAEAIGKLDNYKYNE
    TDQADMERQWPQLKGQFLIDRAGFVRWAYIECAADGLAGLGKFPSATEVLAAARALAD

    >gi|150376002|ref|YP_001312598.1| uncharacterized peroxidase-related enzyme [Sinorhizobium medicae WSM419]
    MSEAVHEFTLEPLDWQPYVRPVKLDEATTEQLEALKVTPSNTKVSNYVLVLANEAEMLAERTPLFNDIMYSEGGLSRGGR
    EIGALAASFVNRCIY
    CASVHANRYIQLEKRPEVVDEIYRRGLDADLPDFEQALFNFGADLTAHPDNVGVYQFYHLREIGL
    DDLEILDLIHSIAIFGWANRLMHTLGEPHLKA

    >gi|150376075|ref|YP_001312671.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sinorhizobium medicae WSM419]
    MAATPPLCDFGRPAIDARLPGVDGSSHSIFDQAGPKGLVLAFICNHCPYVKAVIARIVRDASDLRAHGVGFVAINSNDSG
    NYPQDSFENMKRFASQNALPFPYLHDEDQSVAKAYGAVCTPDFFGFNKDMRLQYRGRLDASRKEIGPADLRRDLYEAMVM
    VAMFGKGPAEQQPSIGCTIKWKVSAFQV

    >gi|150376087|ref|YP_001312683.1| hypothetical protein Smed_3940 [Sinorhizobium medicae WSM419]
    MIRPWLHSLVLLLFAAFPAAAAEEPAGYRESEYRAEVPATLSGATVVSTEAAHALWKTGQVAFIDVLPRPPKPANLPEGT
    VWNEKPRLSIPSSLWLPNVGYGMLADVMQDYFRAGLEKATGGDKDRPVLFFCLDG
    CWMSWNAGKRALEYGYTHVFWYPQG
    TDGWATAGYPTERIEPEPGGQ

    >gi|150376243|ref|YP_001312839.1| alkylhydroperoxidase [Sinorhizobium medicae WSM419]
    MTARLDPFAAAPSLMKNWFSISTAVASSLEPSLIELVKIRASQINGCANCINMHTAEARAKGETEQRIYLLSAWREAPCY
    TDRERAALAWTEALTRLSEGHEHEHAYPALETEFTQEEQVKLTLMINVINGWNRLAVGFGLWVEPAAATAIAEKAVA

    >gi|150376414|ref|YP_001313010.1| methylated-DNA--protein-cysteine methyltransferase [Sinorhizobium medicae WSM419]
    MHHYHIFETASGCCGIAWSDAGIIRFQLPTRSAESTERLLLRRLQGGVPHEPPPRVAEAIVAVKAYFEGRKTDFSGFELD
    LEGQDAFFRRVYRAARKIPWGSTTTYGALAKELGAGPEVARDVGQAMAKNPVALIIP
    CHRVLAAGGKIGGFSAPGGSSTK
    LRMLEMEGVAVAPPEPAQQSLGF

    >gi|150376770|ref|YP_001313366.1| mercuric reductase [Sinorhizobium medicae WSM419]
    MNKHFDAIIIGAGQAGPSLAGRLTDAGKTVALIERKLFGGTCVNTGCMPTKAMVASAYAIHTARRGAEYGMTTGPVSVDF
    GRVMARKEKVRLDARSGLQKWLRGMTNCTLFEGHARFGGPREIRIGEELISGEQIFINVGGRAAVPALPGVNGIPYLTNS
    SIMDLAELPEHLVIVGGSYIGLEFAQMFRRFGSDVTVIEKGPRLIGREDPEVSDAIREILENEGIRIRTNAECIRFSQTA
    AGIAVGVDCTSGEPEVTGSHVLLATGRHPNTDDLGLEKAGVKTDARGYIEVDDSLRTNIPHIFAMGDCNGRGAFTHTSYN
    DFEIVAANLLDDDPRRVSDRIQTYALYIDPPLGRAGMTETEARKKGCKLLIGTRPMTRVGRAVEKGETQGFMKVIVDADT
    KDILGASILGTGGDEAIQSILDVMYAKRPYTTISRAVHIHPTVSELIPTVFGDLSPAD

    >gi|150377018|ref|YP_001313614.1| heavy metal translocating P-type ATPase [Sinorhizobium medicae WSM419]
    MTALKQTEKSTSLPMSFDFDIEGMTCASCVRRVEKAIAAVPGVASANVNLATERATVQFNGVPETTSVLRAVEKAGYAPR
    IVTEEIQIEGMT
    CASCVSRVEKALKAVPGVADASVNLATEKATVRLVSGSAEISALAAAVKGAGYGIRKATPAEAMKEDV
    DHRTAELRSLKSAVTISSLMTLPLFLLEMGSHFIPGVHDFIMGTIGMRNNLYLQFALATLVLFGPGLRFFRKGVPNLLRW
    TPDMNSLVVLGTTAAWGYSVVTTFVPAILPSGTANVYYEAAAVIVTLILVGRYLESRAKGRTSQAIKRLVGLQPKTAFVL
    HSGEFVETEITEVVTGDVIRIRPGEKIPVDGTVTDGSSYVDESMITGEPVPVQKATDSAVIGGTINKTGSITFKATKVGS
    DTLLAQIIRLVEAAQGSKLPIQALVDRVTAWFVPVVILAALLTFAAWYVLGPSPALSFALVNAVAVLIIACPCAMGLATP
    TSIMVGTGRAAELGILFRKGEALQSLRDADVVAVDKTGTLTKGRPELTDLVAAEGFEPDEVLCLVASLETLSEHPIAEAI
    VSAAKSRGIATVAVSAFEATPGFGVSGTVSGRRVLVGADRALVKNGIDITGFADEAERLGSGGKSPLYAAIDGRLAAIVA
    VSDPVKESTPQAIKSLHALGLKVAMVTGDNRRTAEAIAKKLGIDEVVAEVLPEGKVDAVRKLRQGGRSVAFIGDGINDAP
    ALAEADVGIAVGTGTDIAIESADVVLMSGDLNGVAKALALSKATIRNIKQNLFWAFVYNISLVPVAAGVLYPVNGTLLSP
    IFAAAAMAMSSVFVLGNALRLKSFDPA

    >gi|150377081|ref|YP_001313677.1| peroxidase [Sinorhizobium medicae WSM419]
    MSLRINDTAPDFTAETTQGTINFHEWIGDGWAVLFSHPKNFTPVCTTELGAMAGIEPEFRKRGVKIIGISVDPVESHTKW
    KNDIKVATGFDVDYPLIGDRDLKVAKLYDMLPAGAGDTSEGRTPADNATVRSVYVIGPDKKIKLILTYPMTTGRNFNEIL
    RAIDSIQLTARHQVATPANWQQGDDVIITAAVSNEDAVQRFGSFDTVLPYLRKTKQPTA

    >gi|150377172|ref|YP_001313767.1| arsenate reductase [Sinorhizobium medicae WSM419]
    MTDPIDIVIYHNPDCGTSRNTLAMIRNAGIEPHVVEYLKTPPSRPLLEQLLVRMGISVRDLVREKGTPYQELGLGDPALT
    DGQLLDAMMQHPILINRPIVVSPLGVKLCRPSEAVLEVLPQEQKGAFIKEDGQVVVDASGRQV

    >gi|150377436|ref|YP_001314031.1| redoxin domain-containing protein [Sinorhizobium medicae WSM419]
    MMTLLIIAYLGGALTILSPCILPILPFVFARAGQPFIRSTLPMLTGMAATFALVATLAAVGGSWAIHANEYGRFAAIVLL
    AIFGVSLLSPRIASMVARPVVDFGNSLLNASDKPGSAPTAASSLILGVATGLLWAPCAGPILGLVLTGAALQGANIQTTL
    LLVAYAAGAATSLALALIAGGRMFAALKQSLGISERIRQVLGAAILAGVAAIALGLDTGFLARLSYASTTAFEQAVLDRL
    HANPAAGARSEAVGNGTTVAAAGAMQPFRSSLPDEGYAPSLNGAVEWLNSPPLTTEQLRGKVVLVDFWTYS
    CINCIRTTP
    YVRAWAEKYKEQGLVVIGVHAPEFAFEKKIDNVRRAVDDFKIGYPVAIDNDYTIWRAFGNSYWPAHYLIDASGRIRYHHF
    GEGNYDQTEQAIQDLLREAGSDMEASAPVAPDAKGAEAGPDTKNIRSGETYLGYKRATSFASRENLSADASRQYSVAEPT
    LNEWGLSGIWTVGAEQATLDQANGGIAYRFSARDLHLVLGPGAAAKPVRFKVTIDGKAPGADHGADTDAGGNGTVTSTRL
    YQLIRQSGDVEARTFEIRFLDAGVEAYAFTFG

    >gi|150377460|ref|YP_001314055.1| methionine sulfoxide reductase B [Sinorhizobium medicae WSM419]
    MAYAKTDEAIRKLTPEQYRVTQENGTERPFTGEYNHNKRPGIYVDIVSGEPLFASSDKFESGCGWPSFTKPIVPANVNEL
    RDSSHGMIRTEVRSAHGDSHLGHVFPDGPQDRGGLRY
    CINSAALRFIPREEMEAEGYGAFIDQVEHI

    >gi|150377651|ref|YP_001314246.1| OsmC family protein [Sinorhizobium medicae WSM419]
    MSKVVYTGNTNTTGGREGASRSSDGRVDIKLSSPGSSDMGTNPERLFAAGWSACFLGAIARAAAERQLRVPADAAINAEI
    DLVLNDDGYVLQARLNAKLPGIETALAKSLVERAHQL
    CPYSKATRGNIAVELNVV

    >gi|150377656|ref|YP_001314251.1| OsmC family protein [Sinorhizobium medicae WSM419]
    MAFKTQRLQFSGHSGATLSARLDLPNGPLRAYALFAHCFTCSKDLAAARRIAVELAREGIAVLRFDFTGLGSSEGEFAST
    NFSSNVADLLSAADYLRQHYEAPAVLIGHSLGGAAVLTVAGDIPEVRAVATIGAPADVGHVLKNFGASLDEIEKNGEADV
    DLAGRTFLVKRQFVEDTRAHRIKDAVAGLKRPLLVLHAPLDHTVGIENATEIFVAARHPKSFISLDKADHLLTDREDAAF
    AGRIISEWLTRYLAADTPQATGPIEYVRVRETGEGKFQNAVQAGGHRLFADEPESVGGLDSGPSPYDFLAVALGA
    CTSMT
    LRLYAGHKQLKLGRIAVDVSHAKTHAKDCEECTELERSGSGRIDRFERVISIDGEVSEELREKIGEIAGKCPVHRTLEAV
    TKIKTVVK

    >gi|150377657|ref|YP_001314252.1| methionine sulfoxide reductase A [Sinorhizobium medicae WSM419]
    MTKRAVLAGGCFWGMQDLIRKLPGVIETRVGYTGGDVPNATYRNHGTHAEGIEIIFDPERISYGRILELFFQIHDPTTKN
    RQGNDIGTSYRSAIYYVDDEQKRIAEETIADVEASGLWPGKVVTEVEPVGDFWEAEPEHQDYLERYPNGYTCHFPRPDWV
    LPRRSAAE

    >gi|150377658|ref|YP_001314253.1| methionine sulfoxide reductase B [Sinorhizobium medicae WSM419]
    MTYRKTDEAVSKLTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWPSFTKPIVPANVNEL
    RDKSHGMIRTEVRSVHGGSHLGHVFPDGPQDRGGLRY
    CINSAALRFIPREEMEAEGYGGYINQVEDI

    >gi|150377916|ref|YP_001314511.1| methyltransferase type 11 [Sinorhizobium medicae WSM419]
    MTDQAQEEVAARWNQNADQWTNDVRNGYDVYRDLFTFPAFQQCLPPIAGLEVLDFGCGEGSNTRHFARMGAKVTGIDISQ
    GLIEHARQAEVADPVGVTYKVASYSSDTGFPASSFDAVLSTMALMDGPDFQGAMCEAYRLLRPGGFVAFSVLHPCFITPG
    LQWQKDEHGRTTGL
    CVARYFDRSSFTEHWKFGNRPTGENVVPFAVPRFPRTIGDYLNAVASAGFRISRIEEPQPTEEACK
    TVPRFSRWRDLGAFLLLVVAERPI

    >gi|150377931|ref|YP_001314526.1| protein of unknown function DUF395 YeeE/YedE [Sinorhizobium medicae WSM419]
    MTDISLDRSRHLPPVTVDRAPALVAGCALLGGFLAIAQLVDLRQAALFAVGALLGVALYHGSFGFTGGWRRMVVERRGRG
    IRAQMLMIGVAAVAMIPLISAGSLGGQPLVGALAPVGVSVLVGAALFGLGMQLGGGCGSGTLFTVGGGSARMLVTLAFFI
    VGALIGTAHLPWWLTLPSFGTIDLGRQLGTGAAILATLAGLGVVSLLTALVEQRAHGDVEREPAPSRQGWTWVLYGPWPL
    VGAGLLMALLNIATLLLAGHPWSVTFGFGLWGAKAAQIAGVPVADWAFWNWPGPRTALNSSVLADITSVMNFGIILGAAI
    AASLTGKFAPKAKIPLGSVLAAAIGGLLMGYGARLSFG
    CNIGALFSGIASGSLHGWLWFAAAFVGSLAGIWMRPLFGLEG
    LARK

    >gi|150377932|ref|YP_001314527.1| rhodanese domain-containing protein [Sinorhizobium medicae WSM419]
    MRLASLAFTLTVLASSALAAEVKPLVDAEWVKAKAGDENVVILDIRDKVAETELGDKPYIEGAVVAPYASAGWRTEVDGV
    PGMLPPLEQITKLIGDLGIDNDDHVVIIPWGTDSSEFGGATRIYWTFKYLGHDEVSILDGGWRQYDAAGGARSAEPAKPE
    PATFAAEPQEELLATTEEVAAALEAGKKLIDGRPAEQYEGKSKSPIVRANGTIPGSANIEHSKLYSKDHALFARPETVKA
    LTEAVGLAADEENITF
    CNTGHWASVTWFALSEVLGNKKTSMYDGSMAEWTADPARAVENKSGT

    >gi|150377950|ref|YP_001314545.1| copper-translocating P-type ATPase [Sinorhizobium medicae WSM419]
    MSCCSGIAVPITAGAGDKSARAEEIRLASRDLGDGLRQTILTLPDVHCAACIAAVERALRKISGVELARVNLSSRRVTIN
    WRGNDDESSDFAAELAKIGYASHLASIEEDGQDPVLSSLLKALAVAGFSAMNIMILSVSVWSGADPATRHAFHLISAALA
    LPAIVYSGRVFYRSAWEALRHGRTNMDVPISVGVLLAFALSVYDTLHNAAYAYFDASTSLLFVLLAGRTLDHLMRGRARS
    AVGALERLAPRGANVIRADGAIDYVPLSEIKPGMHLLVAAGERVPVDGVVVKGASELDCSLVSGESAWKRAEPGSALQAG
    VMNVGNPLTLLATVSADGSFLAEMTRMMEAAESGRSTYRRIADRAASLYAPVVHGVALLSMFGWFYGTGDLHKSVTIAIA
    VLIITCPCALGLAVPMVQVVAARRLFERGIMARDGSAFERLNDIDTVLFDKTGTLTLGEMRLVNAGDLQPRLLSLAAAMA
    RVSRHPASTAIALAGAGRHTAPVEFDSLEEVHGCGIEGRAGDAVYRLGRPSWASNATQVDLGTSSATVLSKDGETTAVFA
    FEESVRPGARELVQTLRSAGVSVRIFSGDRSAAVSSIAGQLEIEAFSAELLPDEKVEAIRALAAKGRKVLMIGDGLNDAP
    ALAAAHVSIAPSSATDVGRSASDFVFLGQSLLAVRDIILTAARADVLIRQNFAMAIAYNVVSVPFAIAGLVTPLAAALAM
    SLSSIVVVGNALRLGARVKKGPRTFGATKPATVKI

    >gi|150377959|ref|YP_001314554.1| copper-translocating P-type ATPase [Sinorhizobium medicae WSM419]
    MSCCAVGAATMVAEGRQASPASEELWLASRALGGGLRQTELSVPGAYCGACIATIEGALRTKPEVERARVNLSSRRVSIV
    WKEEVGGRRTDPCDFLHAIAERGYQTHLFSPGGEEGDDLLKQLILAVAVSGFAATNIMLLSVSVWSGADAATRDLFHWIS
    ALIAGPALIYAGRFFYKSAWNAVRHGRTNMDVPIALAVSLSYGMSLHETIGHGEHAWFDASVTLLFFLLIGRTLDHMMRG
    RARTAISGLARLSPRGATVVHPDGSREYRAVDEIKPGERLIVAAGERIPVDGRVVYGTSDIDRSVVNGESSPAVVATGDT
    VQAGTLNLTGPLTLEATAAARDSFIAEIIGMMEAAEGGRARYRRIADRAARFYSPAVHLLALLTFVGWMLVEGDVRHALL
    IAVAVLIITCPCALGLAVPVVQVVAAGRLFQGGVMVKDGSAMERLAEIDMVLLDKTGTLTIGRPRLVNAHEIAPCRLAKA
    AAIALHSRHPIAVAIQNSARAVSPLAGGIREIPGAGIEVKTEDGVYRLGSRNFAVGNPGSDGGQSQAILSLDFRELACFR
    FEDRPRPASRESIEALARLDIATGILSGDREPVVAALAGSLGISNWHGDLSPREKVKACDAAAEAGHKALVVGDGINDAP
    VLRAAHVSMAPATAADVGRQAADFVFMHEPLSAVPFAIETSRHAGRLIRQNFALAIGYNVIAVPIAILGYATPLIAAVAM
    STSSLVVVFNALRLKRTLAAGKVAKAAALIQSGAVTS

    >gi|150378079|ref|YP_001314674.1| molybdopterin biosynthesis protein MoeB [Sinorhizobium medicae WSM419]
    MLRQERLSRLRESLSRISVEEARRKQKAGVKLIDIRDAEETAKGSPVGAVRISRSFLELQIENVAPDADTELMVLCASDT
    RALFAADDLNRLGYSSVHWVDGGFQAWEAAGLPVEKHRQLSPAEKERYARHLSIPEVGAEGQALLLSKKVALVGAGGLGS
    PLAFYLAAAGIGTLGLIDSDRLERSNLQRQILHTDDRIGELKVSSAAKSLQAFNPDVALNLHEIRLNENNALEILADYDL
    VIDGSDNLATRYVVSDASTLLSIPMIYGAIFRFEGHVSAFWPNGPSGGPCYRCLFPEKLPASLTPS
    CSEVGVLGVLPGVI
    GTIMATEAIKILLGIGDPLIGRLLTYNALDCSFHDLEVPANPHCEQCQSNRDLPRMRAGL

    >gi|150395301|ref|YP_001325768.1| methylated-DNA--protein-cysteine methyltransferase [Sinorhizobium medicae WSM419]
    MLFDLPNDDILYDALLARSSDYEGQAFVCVKSTGIFCRLSCPARKPKRENSIFFDSVSACVNSGFRPCQRCRPLEQVSGK
    DPLVKDLLRLLDSRPDHRWTEGDLVRRGFDPSTVRRAFKRSLGVTFLDLARQRRMGEAARQLSVGSSVIEAQIDAGYESP
    SGFRTAFARLVGEAPAKSQGRVLLFADWVETPLGPMVAVADRTHLHLIEFHDRRALPAEMEKLKRKTLSAVVRGRTPPID
    QAERELKNYFAGRSADFRTPLAMDGSAFERQVWAELVAIPAGETRSYSDIARKIASHQAVRAVARANGANCFAILVP
    CHR
    CVGADGSLTGYGGGLQRKRWLLRHEGRMHPAELFKGWDGEEPVQAGALSV

    >gi|150395312|ref|YP_001325779.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Sinorhizobium medicae WSM419]
    MVKQLTPDICVIGGGAAGLTVAAGAAAFGVPVVLVEKGPMGGDCLNHGCVPSKALIAASRHAHSIRVAAEFGIAAAGPVI
    DQERLTARIQSVIVGIAPHDSVERFTSLGVEVIKDEACFVDNRTIAAGDRLIRARRFVIATGSSPAIPPIPGLAETPFLT
    NETLFSLKRLPRHLVVIGGGPVGLEMAGAHRRLGVEVTVVDKTEALSGQDPELAAIVLDGLRAEGVHLHERTAIHAVERT
    ERGIRLRCENGNGPFGIEGSDLLVAAGRAPVHASLGLDAAGIRHDPKRIEVGPNLRTSNRRVYAIGDAAGGLFTHQASYH
    ARLVLQQILFRLPAREKPFIVPRVIFTEPELAHVGLTEERAREAAPGATILRLDYSANDRSRTDGLGRGLIKVVVGRRGR
    VLGAAIAGSGAGEMINLWAFAVANRLTLKHFQTYVAPYPTLSEIGKQAAISYYSPMARNRLLRTVLRFLRHFG

    >gi|150395382|ref|YP_001325849.1| alkylhydroperoxidase [Sinorhizobium medicae WSM419]
    MQPRLNFAKAAPEAYKAVAALETYVKGSGIEPRLLHLIKLRASQINGCAYCVDMHSKEARHSGLSEQWINLVCVWRESPH
    FDERERAVLGWTEALTNVAETRAPDHAYEALRAHFDEEEMTKITVAIGTINVWNRLCVGFRALPPIDAPAKAA

    >gi|150395754|ref|YP_001326221.1| redoxin domain-containing protein [Sinorhizobium medicae WSM419]
    MNIAVGDKLPNVTFKEKTAEGPVEVTTEQLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDL
    HVMGAWATHSGGMGKIHFLSDWNAAFTRAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNVEESPGQATASGAAAMLEQ
    L

    >gi|150395769|ref|YP_001326236.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
    MSASQISLPKRLLSGVAVAMLALALAACSDEKQEAASTAPTETTATPDTTTTASTAAKPAALSEAKPAAEVAQASTPAAK
    VELPTPEGTVDAAKLLEPGALPEMALGEASAPVTIVEYMSMT
    CPHCANFHNDTFDAIKTKYVDSGKVRFIVREFPFDPRA
    AAAFMLARCAPEGQYFPMISMLFKQQEQWAAAQNGRDALLQLSKLAGFTQESFEACLTNQKLLDDVNAVMQRGAKEFGVK
    STPTFFVNGEHYSGDMSVDVMSALIDSKL

    >gi|150395795|ref|YP_001326262.1| glutathione S-transferase domain-containing protein [Sinorhizobium medicae WSM419]
    MLKLFYTPGTCSLASHIALEEAGAAYEVHRVDFSKAEQTKPDYLSINPKGRVPALVTDRGILTETPPILAYIAQSFPKAR
    LAPLDDPFEFARLQSFVSYLCSTVHVAHAHARRAGRWADDPAAQEAMKAKVPQNMGDCFALIERTMFAGPFVLGDSYSIA
    DPYLFTIASWLESDGVDPARFPRILDHRNRMGERQAVAKVLAAVQA

    >gi|150395801|ref|YP_001326268.1| OsmC family protein [Sinorhizobium medicae WSM419]
    MPILYRTTASATGGRAGQAKSQDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKFVAGKEKIKLSEDTTVT
    GTVGIGPRDDGTGFFIDAALEISSPGVEKAVLEDLVQKAHIV
    CPYSHATRGNVDVKLTVA

    >gi|150395820|ref|YP_001326287.1| hypothetical protein Smed_0596 [Sinorhizobium medicae WSM419]
    MPRKGGRRLPPCRCIVMSSVPTQPASETPPFRFENSYARLPANFYGRVQPTPVTEPWLIKFNRPLAEELGLDVRAIECDG
    AAIFSGNLIPEGAEPLAMAYAGHQFGTFVPQLGDGRAILLGEVTDTSGRRRDIQLKGAGQTPYSRRGDGRAALGPVLREY
    VVSEAMHALGVPTTRALAATVTGQPVYREQILPGAIFTRVAASHIRVGTFQLFAARGDMDSVRMLADYTIDRHYPELKDD
    ERAYLALFKAIAARQASLIARWLHVGFIHGVMNTDNMTISGETIDYGPCAFMDGYDSKTVFSSIDQFGRYAYANQPAIGQ
    WNLARLAETMVTLFDPVADTAVNLANDALGEYGTIFQKHWLDGMRRKIGLITDEDEDLDLVQSLLTLMQKGKADFTLTFR
    RLAASAENVGADMELASLFEEPEATSPWLERWRRRLTREPQMEIERAASMRAVNPAFIPRNHRVEQAINAATEDADFSLF
    EALVDVTSRPYEDQPGRSAYAAPPKPGEEVLQTF
    CGT

    >gi|150396133|ref|YP_001326600.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sinorhizobium medicae WSM419]
    MPHDGIVIVGSGHAGARAAQSLRANGWQHRISVIDGEGCAPYERPPLSKAVLSGKSRPEDAVLFPQDFVEQHGIDFRSGV
    RAVGIDRDTRQVRLSNDDAVSYGRLLLTPGAEPRLLDIPGRELEGVFSLRTAVDACGLSGQLLPGADVVIVGGGLIGLEV
    AASAIQRGCSVTVIEAGPRLMTRAVPPELAELIRLLHETRGVRFILGRQAVALLGSQRIEALRMDDGSTLACTAALISIG
    VTPRTDLALAAGLEIENGIAVDCFLKTSDPFIYAAGDACAFKNGDGSRLRLECWKNAEDQGALAARNMMGANEPYTPMPW
    MWSDQYDRTMQIAGHPELGEQHVARHCPDGSLLVYHLDANDAIVGVSGFGSLREIARGVRTGQMLMQRGIHPAKEALQNP
    KIDLKAAAKVAAG

    >gi|150396177|ref|YP_001326644.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
    MTLKMKMIATASVIALAAGVVLPAPAAALDAKQKEEFGAFIKEYLLANPEIMLEVQEALSAKQRAKQQESAQAAIAGNSE
    AIFNSTHDIALGNPNGDVTIVEFFDYN
    CGYCKRALSDMDAILAEDKNVRFVLKELPILGPESLAAHKVSAAFRTVAPEKY
    GDFHRALLGSEERATEETAIAVAAKLGVTEEQLREKMEDGSYDASMREAYSLASDLGITGTPSYVIGNEAVFGAVGAPEI
    EEKVANMRACGKTVC

    >gi|150396301|ref|YP_001326768.1| dihydrolipoamide dehydrogenase [Sinorhizobium medicae WSM419]
    MAENYDVIVVGSGPGGYVTAIRSAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILDHANHAKNYGLTLEGKITAN
    VKDVVARSRAVSARLNGGVAFLMKKNKVDVIWGEAKLTKPGEIVVGSPSRPAVQPQNPVPKGVKGEGTYTAKHIILATGA
    RPRALPGIEPDGKLIWTYFEAMKPAEFPKSLLVMGSGAIGIEFASFYRSMGVDVTVIELLPQIMPVEDAEISAFARKQLE
    KRGLKIITDAKVTKVEKGANDVTAHVETKDGKVTPMKAERLISAVGVQGNIENLGLEALGIKTDRGCIVTDGYGKTNVPG
    IYAIGDVAGPPMLAHKAEHEGVICVEKIAGVPGVHALDKGKIPGCTYCDPQVASVGLTEARAKELGRDVRVGRYSFNANG
    KAIALGEDQGLIKTIFDKMTGELLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTVFPHPTLSEMMKESVLDAYGRVLN
    A

    >gi|150396375|ref|YP_001326842.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium medicae WSM419]
    MHETVTLSDAAARRIAAILQAEKDKSAMRVSVEGGGCSGFSYKFDLVDAENADDLILEKHDAKVLIDSLSLVYMGGSEID
    FVDNLLGQSFQIKNPNAVASCGCGTSFSV

    >gi|150396466|ref|YP_001326933.1| thioredoxin reductase [Sinorhizobium medicae WSM419]
    MTARHTKVLIIGSGPAGYTAAIYTARAMLSPVLIAGMEQGGQLMITTDVENYPGYADPVQGPWMMEQMLKQAIHVGTEIV
    NDLVTDVDLSVRPFRIRTDSGTDWTADALIIATGAKAKWLGIETEPTFMGFGVSA
    CATCDGFFYRNKDVIVVGGGNSAVE
    EALYLSNLAKTVTVVHRRDAFRAEKILQERLFSKPNVKVIWDHEVLEYLGTPAKPPMPASVNGVKLRNTKTGETSEMVID
    GVFVAIGHAPAVELFKGKLRQKPNGYLWTAPDSTATDVPGVFAAGDVTDDIYRQAVTAAGMGCMAALEAEKYLAGHMPVA
    IAAE

    >gi|150396581|ref|YP_001327048.1| rhodanese domain-containing protein [Sinorhizobium medicae WSM419]
    MNVENANRSDFVVSADWLEQRLSDPAVRIVDASWYLPAQNRDPKAEYAAAHFPGAVFFDQDAIADQTSVLPHTLPSPEAF
    AKAVGAMGIGENDVIVVYDGPGIFTAPRVWWMLRVMGARNVFVLDGGMDGWKAEGRPVTAQLPNPEPRVFKASIDRRAVT
    SFERMKDVVENRLAQIADARSAGRFSGEEPEPRAGMRSGHMPGARSLPSGVFSEGGKFKDLDQLSRTFADAGIDLSKPVV
    TT
    CGSGVTAAIITLALQSLGHKDNTLYDGSWSEWGSRPDTPVATGKE

    >gi|150396612|ref|YP_001327079.1| DSBA oxidoreductase [Sinorhizobium medicae WSM419]
    METVNIDIVSDVVCPWCYLGKNRLAQAIANVSGEINVAVQWRPYQLNPDLPPEGVDHKQHLAAKLGGQAAVDDAHRMLEN
    LGMEDGVAFNFDAVKVSPNTLDAHRLIRWAATSGEAAQAELVNLLFKAYFEEGRNVGEHTVLLDIAEQGGLERPVIAALL
    ASDADKQAVKQEIDMAREIGVTGVPCFIIEQQYAVMGAQSVEVLSSALREIAQMKAEHPAH

    >gi|150396676|ref|YP_001327143.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419]
    MGFAIMSLTDAAANRVRSIVENAGGEAKGIRVSIKKGGCAGMEYAIDLVTEPSSKDDLVEHEGAKVWVAPEAVLYLLGTQ
    MDFETTTLRSGFTFNNPNQTSACGCGESVELKPADLAALAARGDAVVRAS

    >gi|150396688|ref|YP_001327155.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sinorhizobium medicae WSM419]
    MAGLRQGDVAPEFELPREGGGTISLAALRGGPVVLFFYPKDDTKGCTQEAISFSALKEEFQSAGIMIIGISPDSAKSHDR
    FTRKHGLTVALASDEDKAVASAYGVWVEKSMYGRKYMGVERTTFLIDRQGVISRVWEKVKVPGHADEVLAAAKAI

    >gi|150396720|ref|YP_001327187.1| glutaredoxin-like protein [Sinorhizobium medicae WSM419]
    MSGINDFIDAEVKTNDVVLFMKGTPQFPQCGFSGQVVQILDYVGVDYKGINVLADADLRQGIKDYSSWPTIPQLYVKGEF
    VGGCDIVREMFQAGELQSLLQGQGISVKGAA

    >gi|150396780|ref|YP_001327247.1| glutathione reductase [Sinorhizobium medicae WSM419]
    MTAFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQFSEHFEDAAGFGWSVGESRFD
    WAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELVGPNAVKLLASGKTVTAERIVVAVGGHPSPHDALPGNEL
    CITS
    NEAFDLAALPEAILIAGGGYIAVEFANIFHGLGVNTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQAVSAN
    SDGRRVATTMKHGDIVVDQVMLALGRVPNTKDLGLEAAGVKTDERGAIIVDAFSRTSTPGIYAIGDVTDRVQLTPVAIHE
    AMCFIETEYRNNPTSPDHDLIATAVFSQPEIGTVGISEEEAARKFEEIEVYRAEFRPMKATLSGRKEKTIMKLIVNAADR
    KVVGVHILGHDAGEMAQLLGISLKAGCTKDDFDRTMAVHPTAAEELVTMYRPSYRVRGGETIV

    >gi|150396838|ref|YP_001327305.1| thioredoxin domain-containing protein [Sinorhizobium medicae WSM419]
    MNTTTPDEHPSAIVKVDTSNFSEEVLKPAEPVIAIFSFDGCGHCAIIAPLLEEIATELAGKVKIVKVSDTENPELAKQYG
    IYGFPMLALFKGGEVNDIFLGAAPPNIETKLRSWISKTVQTPKMNTTPEYPTAIVEGDVSAFPEEGLKSAEAVIVHFWGN
    R
    CPPFELIEPILEQVATELAGKVKVIKLNIGENRDFATQYGVDGFPMLAMFKGGEVAGIYDGGSLGSWISHAMA

    >gi|150397064|ref|YP_001327531.1| thioredoxin domain-containing protein [Sinorhizobium medicae WSM419]
    MPTAPNEHPTDGKVDTCTFPEEVLNSPLPVVAAFSGDRCLPCDAVAFSLKQIATELAGKVKVVKIDVDENLDLAAQYGVR
    EVPTLLMFKGGEVADIYVGTGSLRSWISEALA

    >gi|150397066|ref|YP_001327533.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sinorhizobium medicae WSM419]
    MESNKILSMESRAPALKVRDWVRGEPLASFQPGKLYILEFCGTTCDGCERAMLNLIELQESYKDSGVEVVTVAAHESAAS
    SDEARGKLDAWLAKFPELNFPVAFDDTGAMNTLWMEPSFSIVIPRLFVIDRDGYIAFIGHPDKLHDVLPHLLDGTWRTSA
    QAKATESERIAEDEPKARKHALLKPIRGKRRAAEGIGDWMTALTAVEEGIALDPDSYNLRAYQVHLLLDKMWDMENGLVV
    LWQFVREAIDRGDAHWLVTAMMQIFRQSLPSAERFAMGEVLSEHILALDLAQCNLPASQLFPKVARHYYEIGNKDRAVEL
    LELALKSLEGHGAKERPQLDLLQTLANYKGETVCSGDVCVVPRTNISTGATPKAETKNLDERGALE

    >gi|150397237|ref|YP_001327704.1| alkylhydroperoxidase [Sinorhizobium medicae WSM419]
    MSTVAPPPDPEADPRVKAVFDDIRATRKSDFINNMWLWLAFDPDLLERTWAEVKTVMAMPSPLDPLMKEMLYIAVSVTNG
    CGY
    CIHSHTAAAKVKGMTDAEHADLMRVISLAAKTNQLAMALQVPVDTVFDASGETKASERPA

    >gi|150397581|ref|YP_001328048.1| peroxiredoxin [Sinorhizobium medicae WSM419]
    MLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQLPDFEKLNSEFRALGIEEIYC
    VSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAIVNNGVVEQWFEEEGYSDNCDSDPY
    GVSSPQNILAALKSRKLAA

    >gi|150397707|ref|YP_001328174.1| glutaredoxin 3 [Sinorhizobium medicae WSM419]
    MASVVIYTRQFCGYCTRAKRLLESKGVDFIEYDATYAPELRQEMIEKSKGGRTFPQIIINDVPVGGCDDLHALDRAGKLD
    DLLAA

    >gi|150397733|ref|YP_001328200.1| redoxin domain-containing protein [Sinorhizobium medicae WSM419]
    MPDQKKRPPARKLFAIAALLGVIAGAAAVYVKETGSGNGGDAPTADASCPLAAQKVASLTPLMRGQVAAMTPAANARPIG
    GLDFAGPDGKPLTLAAFAGKTVLVNLWATW
    CVPCREEMPALNALQQALGGDRFEVVAINIDTGADDKPKAFLDEVGVQAL
    GYYRDASMGVFNTLKKEGLAFGLPATLLLDEKGCLIGSMNGPAAWDSDDAKKLIEAAMAPPAAS

    >gi|150397980|ref|YP_001328447.1| rhodanese domain-containing protein [Sinorhizobium medicae WSM419]
    MTDMLTTSRRPETPGQFLVAALYHFISFPRFADFREPLQAICDANGVKGTLLLAHEGINGTIAGSEEGIATVLAFLRAQP
    EFADLVHKESRASAMPFLRMKVRLKKEIVTMGVENIDPKKVVGTYVEPKDWNALISDPETLVIDTRNDYETAIGVFQGAV
    DPKTKTFREFPEWVRNNSGLHNKPKIAMY
    CTGGIRCEKATAFMKEQGFEEVYHLKGGILKYLEEIPPEESLWEGACFVFD
    ERVSVTHGLQEGEHTLCHACRQPLTTEDLRSPLHEEGVSCVNCHDTRTEEDRERYRQRQRQIVLAKKRGARHLGS

    >gi|150398027|ref|YP_001328494.1| dihydrolipoamide dehydrogenase [Sinorhizobium medicae WSM419]
    MKEISCKLLVLGAGPGGYVTAIRAAQLGVNTVIVEKAKAGGTCLNVGCIPSKALIHAAEEYDKLRTAASGKSPLGLSLNA
    PAIDLGRTIAWKDGIVGRLNSGVTGLLKKAGVKAVIGEGRFVDGKTVDVETETGLQRIRAEALVIATGSAPIELPDLPFG
    GNVISSTQALALTKIPETLAVVGGGYIGLELGTAFAKLGSKVTVLEALDRILPQYDADLSKPVMKRLGELGVEVFTGTAA
    KRLSADRRGLFAEENGRAFEVPAEKVLVTVGRGPVTEGWGLEEIDLDRSGGFIRIDDQCRTSMRGIYAIGDVTGEPMLAH
    RAMAQGEMVAEIVAGRKRSWDKRCIPAVCFTDPEIVGAGLSPEEARTAGIDTRIGQFPFQANGRAMTTLSEDGFVRVVAR
    ADNHLVLGIQAVGHGVSELSATFALAIEMGARLEDIAGTVHAHPTQSEAFQEAAFKALGHALHI

    >gi|150398133|ref|YP_001328600.1| dihydrolipoamide dehydrogenase [Sinorhizobium medicae WSM419]
    MAYDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHVAEHGLDALGVEVATPKLNL
    QKMMAHKDATVKSNVDGVAFLFKKNKIDGFQGLGKVLGQGKVAVANEKGEEQVLEAKNVVIATGSDVAGIPGVEVPFDEK
    IIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEYLDTILGGMDGEVAKQLQRMLTKQGLDFKLGAKVT
    GVVKSDEGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTEGLGLAKAGVVLDQRGRVEIDQHFQTSITGVYAIGDVVRGP
    MLAHKAEDEGIAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGRTEEELKAAGVAYKVGKFPFTANGRARAMLQTDGFAK
    ILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFFKPIHM

    >gi|150398152|ref|YP_001328619.1| peptide methionine sulfoxide reductase [Sinorhizobium medicae WSM419]
    MLRLLLGFFVTCFLLLPARAAEPQYAIFAGGCFWCVESDFDAVPGVLETISGYAGGKSANPTYETYVRGGHREVVRIKFD
    PDRVSFAALVGVLFRTTDPTDGGGQFCDRGFAYTTAIYALNERQAMGAKAEKIKAEAELGRPIVTPVEGAAKFWPAEDYH
    QDFGKRNPIRYWYYRNGCGRNRTVEKLWGDRAYAGVSH

    >gi|150398230|ref|YP_001328697.1| alkylhydroperoxidase [Sinorhizobium medicae WSM419]
    MSEVSEKLKDAQRRIAALAKASPELFGGFARVSKVAAASGSFTSTQKELMAVAIAVSKGCEDCILYHVDAALKHGAKEAE
    LVEALEVAVEMSGGPAVMYGAKALEIMRALQ

    >gi|150398239|ref|YP_001328706.1| thioredoxin [Sinorhizobium medicae WSM419]
    MSGSDNPYQGSFGSQMTGSASFGVRPESAAGGPNGLIPDDLIRETTTAAFSRDVLEASRQQPVLVDFWAPWCGPCKQLTP
    VIEKVVKEAAGRVKLVKMNIDDHPSIAGQLGIQSIPAVIAFVDGRPVDGFMGAVPESQIKEFIDRIAGPGTDDATAEIEN
    VLGEARALLDAGDAQNAAGLYGAVLQADPENATAVAGMIECMIALGQLAEARQALSGLPEALANEASVAAVSKKLDQIEE
    ARKLGDPTALERQLALDPDDHGARLKLAKIRNVEGDRAAAAEHLLTIMKRDRSFEDDGARRELLSFFEVWGPKDPATIAA
    RRKLSSILFS

    >gi|150398282|ref|YP_001328749.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Sinorhizobium medicae WSM419]
    MTNARDERAPGAIRYLVAALPLLIFAVLALIFWSQLNSGRDVSEIPSALIGTKAPTLDMPRLEGAVAPSGRPMPALTDTA
    VKGKLTLVNVWASW
    CVPCRQEHPVILALSKDPRLTVVGINYKDRNENALRFLGELGNPFSAIGVDPNGKAAIDWGVYGIP
    ESFLVAADGTILYKRAGPFDEKSLREGLLPAIEKALAGS

    >gi|150398433|ref|YP_001328900.1| thioredoxin [Sinorhizobium medicae WSM419]
    MATVKVDTSNFQKEVLNSAEPVVVDFWAEWCGPCKMIAPSLEEISTELAGKVKVVKLNIDENPELAAQYGVRSIPTLAMF
    KGGEVADIKVGAAPKTALSSWISNAVA

    >gi|150398525|ref|YP_001328992.1| heavy metal translocating P-type ATPase [Sinorhizobium medicae WSM419]
    MTGIFRETRFRVEGMDCASCAAKIDTAVRRVSGVEDVNVSVAAGTMTVRHAARDDVGAQVMRKVGGLGYRLSPLRGERDR
    QDAGEGVCCGHDHSVNEASHRHDHGDDKVLPAAARTAGATAPLQWWQTAKGKLTLACGLSLAAAYVIGTFVPASDPWIFT
    LAMLVGLMPIARRAFMAAISGTPFSIEMLMTIAAAGAVFIGAGEEAAMVVFLFLIGELLEGVAAGKARASIQSLSALVPK
    SALLEENGRTVEVPAESLAPGAVVLVRPGDRLPADGVIVAGESSVDEAPVTGESTPVLKGAGADVFAGTVNGDGALRVCV
    TAAAADNTIARVIRLVEEAQEKKAPTERFIDRFSRYYTPAVVLVAALVAIVPPLFFGGLWQEWIYKGLALLLIGCPCALV
    ISTPAAIAASLSAGARRGLLIKGGAVLETLGGITAVAFDKTGTLTEGKPKLTDIVGFGRSEAEVLGYAAALEQGSSHPLA
    RAVLWRAEADGLTPAPVEDARAIGGKGVAAFANGVELFLGSPEAAGERAPLDAGEKAEIEALQRAGKTVSVLIVGGKAAG
    ALAMRDEPRADAAAGLRALAEAGLRVVMLTGDNRATAEAIAGRLGGIEAHAGLLPEDKQRIVNRLKTEGFVVAKVGDGIN
    DAPALAAADVGIAVGGGTDVALETADAASLHARVSDIAAMVRLSRVTMRNIHQNIAIALGLKAVFLVTTIAGITGLWPAI
    LADTGATVLVTMNALRLLASPVKR

    >gi|150398562|ref|YP_001329029.1| methylated-DNA--protein-cysteine methyltransferase [Sinorhizobium medicae WSM419]
    MNVATSIPTDITPEGTDYDTVTRVIAMLTEDYREQPSLESLARRLGQSPTQLQKVFTRWAGLSPKAFLQAITLDHAKRLL
    RQEDLPLLETSIEIGLSGPSRLHDLFVTHEAMSPGEWKARGAGLTIRYGFHPSPFGTALVMVTERGLAGLAFADSGEEHA
    SFEDMASRWPNAIYLEDSAATARYAARIFDPDRWSAEEPLRIFLIGSDFQVRVWQTLLKIPLGKATTYSKIAENIGQPTA
    SRAVGAAVGRNPISFVVP
    CHRALGKAGDLTGYHWGLTRKRAILGWEAGKA

    >gi|150398585|ref|YP_001329052.1| molybdopterin biosynthesis protein MoeB [Sinorhizobium medicae WSM419]
    METHMTTGATLAPSEIARYARHIVLPEIGGPGQQKLKAARVLVIGAGGLGAPVLQYLAAAGVGTLGIVDDDVVSLSNLQR
    QVIHATEDIGRAKVESAAAAIDALNPHVKVITHALRLGAENARELFDAYDLVVDGSDNFDTRYLAADTAEAAAVALVTGA
    VGRFDGSVTVLKPYETDADGHPNPSYRDLFPEPPPPGAVPS
    CAEAGVLGALTGVIGTLQAMEAIKLVTGIGEPLIGRLLL
    YDALAAQFNTIRYRRGKR

    >gi|150398606|ref|YP_001329073.1| methionine sulfoxide reductase A [Sinorhizobium medicae WSM419]
    MFLIDMFNKKTILPDAATALAGREGEISTAADHFVSGRPLKGPYPDGMKKVLFGMGCFWGAERLLWEIPGVYVTAAGYSG
    GLTPNPTYQETTTGLTGHTEVVLVVYDPARVSFQRLLKTFFEEHDPTQGMRQGNDVGTTYRSAIYVYDEEQLAEANAARN
    AFRKALKAYKHDREITTEIAMAGPFYFAEEYHQQYLAKNPDGYCGLRGTGVSCPIGA

    >gi|150398651|ref|YP_001329118.1| putative selenoprotein [Sinorhizobium medicae WSM419]
    MSEKPRITILYCTQCNWLLRAGWMAQELLSTFADTLGEVALIPGTGGNFEIRVDGALIWERKRDGGFPGPKELKQRVRDV
    IEPERDLGHTDRS

    >gi|150398691|ref|YP_001329158.1| glutathione S-transferase domain-containing protein [Sinorhizobium medicae WSM419]
    MMTAQLTLISHHLCPYVQRAAIALREKDVPFERVDIDLAKKPDWFLKISPLGKVPLLRIPRDGGEAILFESTVICEYLEE
    TQAGPKLHPSDPLARARHRGWMEFGSAILSDLWVYETTRDGGTLEEKRRMLEMKFATVEAELDSGPYFSGGAFSLVDAVF
    APIFRYFDVFDRISDHRIFDGLPRVTAWREVLAERPSVKAAVAEDYPQRLTAFLEKHEAALLKTERAAA

    >gi|150398694|ref|YP_001329161.1| arsenate reductase and related [Sinorhizobium medicae WSM419]
    MTVTIYGIKNCDTMKKARNWLDSRGTSYDFHDYKVEGIDRAQLERWCAQLGWETLLNRSGTTFRKLDEADKQDLTAEKAI
    ALMLRQPSMIKRPVLDADGRLLVGFKPELYEAAFGA

    >gi|150398751|ref|YP_001329218.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sinorhizobium medicae WSM419]
    MSVDAAPVDVTIVGGSYAGLSAALQLARARRSVVVVDSGARRNRFADTSHGFLSRDGEAPAVIAAHGREQLMAYPNVRFV
    EGMADTVSRGGANLIVSIQGEKIAARRLILATGVIDELPSLPGLQERWGRAVFH
    CPYCHGYELGQGRIGVLATGENSFHQ
    AMMLPDWGPTTLFANDVFEPDAAQAAMLEARGVEIERQKVVALDGPKATLVLEGGRTVSLEGLFVASRTRMASGLPAALG
    CAFEEGPLGPFIRTNEAKETSVEGVYACGDAARSAGSVSHAVGDGVTAAVAAHKSLIFDVH