Sideroxydans lithotrophicus ES 1 uid46801

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291612600|ref|YP_003522757.1| DSBA oxidoreductase [Sideroxydans lithotrophicus ES-1]
    MRFLKQIVTVLTLLCATYAHAEVVAGRDYKLLNPPQPTSSGKKVEVLEFFFYGCPHCYHLHPLISAWEKKMPKDVDFQYV
    PTIFNEGWEPMAHTYYALEAMGKIRQLHDALFQAWNENVDLSDEAHISEFVGKHGVDRNRFDADYNSFTVSSKIARSNQL
    VQSFNIRGTPTIAVDGKYIISGLQPEETIRVLDEVIKIARKERNRH

    >gi|291612615|ref|YP_003522772.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MFGMNVKEIDATQLAQWVEDDGHKLRVIDVRQLEEIAHGTVPKAEALPLHVLPAKVHELDKSEKLIMICRSGARSAQACM
    FLQQQGFSNVYNLRGGMMGWVQSGFPAYRLG

    >gi|291612616|ref|YP_003522773.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MKLKKIFWTLAIIVGAALVVQQLQAADGIDAKQALSMEKQGALLLDVREPEEYKAVHAPNAKLIPLGQLGSRLPEIAAYK
    DKPIVVM
    CRSGRRSAMAVSQLRDAGYTQVSNVKGGIQAWEHDGLEVVKM

    >gi|291612757|ref|YP_003522914.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MYDTFKPQQPMGLMDFVRSAKACIKEITPKELLDKLNSKEDLLLIDVREHGEYENGHIKGAHLVPRGILEAAADPAYPKH
    LPELTAARDRQVVVY
    CATSGRSAMAAAVLQMMGFKNVLNMAGGYTKWVADGMPEIHEATF

    >gi|291612761|ref|YP_003522918.1| Disulfide bond isomerase, DsbC/G-like protein [Sideroxydans lithotrophicus ES-1]
    MFKTLLLLLLSISLAHAAETDKTAAAIKDTLIKNYEQLIGPVDQVNKSPIPGLYEVVTGDHIFYTDKTAQYLIDGQMFDL
    KGRQNITQARSQKLFAIDFSKLPLELAVKKVKGNGSRKMAYFADPN
    CGFCKKLEHELQNVNDVTLYLFLYPIFQGSAEKV
    QDIWCSADKAKTWDDLMLNGVQPKAAKCDAPIAQVLALGKSLRVNGTPALIFANGVINPGYMPAADLNKALDANNK

    >gi|291612834|ref|YP_003522991.1| Methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
    MTMTTRSSNPSDEIVHAPHPPLTEYYDSEEDRRNWVGEQFNKTASDYDRMERILGLGTGSIYRRTILGRAGLKPGMHVLD
    VGMGTGLVAKQAVRILGDASKVTGLDPSAGMIRNAKLPAGVTVVEGRAELIPLPDARYDFLSMGYSLRHVSDLSVAFAEF
    HRVLKPGGKVCILEITPPQGKIATALLKGY
    CKYAVPTLAKLIASNRDTALLWRYYWDTIEACAAPENVLRTLESAGFVNV
    RRTVDLGIFSTYLADKPL

    >gi|291612889|ref|YP_003523046.1| copper-translocating P-type ATPase [Sideroxydans lithotrophicus ES-1]
    MTQHSHSIAGGCFHCGLPIPPEADFHARLDAAERDFCCFGCQSVSAAIYEAGLQGYYQRTPEGVLLAPPPELPKDIDIYD
    FDEVQQEFTTCSGDVRDIHLLVEGIH
    CAACVWLIERGLQRTPGVLSADVNLAAKRLHLRWDNSRSKLSDLIRALGRIGYA
    AVPYDPESAEGVIQKSNRAMLYRLFFAGFAMMNMLWISIALYSGADQDQFRQFFHWIGLALATPTLLYAGYPFYRGAFGG
    LRGGHLTMDMPIAIGLSVTYAYSLYVTVMQSAVGEVYFDTVTNLIFVILIGRYLEGMFRHQAVSATKRLMELQPRVAIVM
    RDGQEQMIPIRGVKPGDHVLIKPGYKVPVDGVVLEGSSAVDESMLSGESAPVNKSAGAQVYAGTVNSNGALLVEVKAQLQ
    DTTLSKIIRLVEEAQSSKAPIQRLADTIVPWFVLVTLICATITFFIWNSHDFEIALMAATSVLIITCPCALGMATPMSIA
    VASGLGAKHGILVKNGLVLETLSKVTHFVFDKTGTLTEGKMSVAQILVASGQDEREVLRQAAAVERFSEHSAAKAIVAET
    ESRQLLHRELEASDFHATAGLGVQANVGGRCVLLGSAGWLTQQGIALDATLQAKVHELEMLAMSCVYMAQDGKHVAIIAL
    ADRLRSDARQLVDELRAAGITLTLLSGDRRPVAEAVARQLGGMEVIAEVLPQDKDQVIQRLQQRGAVVAMVGDGINDAPA
    LIRADVGIALGSGTDVSVESADIVLMYNELDKVRQATQLSRRTLLTIKQNIGLSFVYNAIMVPLAMMARVSPLVAAISMP
    ISSLIVIGNAARIRTLFKRQ

    >gi|291613005|ref|YP_003523162.1| putative transcriptional regulator, Crp/Fnr family [Sideroxydans lithotrophicus ES-1]
    MQDILDIRVLASLEPISSFSPARLRELLDYCHVETVAQGNDPFKDHPPTGQSVYLLRGELEVVYEDDNRVLIRSGSEWAR
    HPIGKRQPSIRMSQALSNVQLLRVDDDLLDRMVTWDQFAYHEDARPASMKEGPDHALKKLLHSGMFSAENLSNSPFAHLP
    SANIGELLNRIEAIAVWDRDVIIREGDEGDYYYLIESGRAQVTRLVGGANLVLAELKAGDVFGEEALISDSKRNATVTMK
    SNGVLLRLKKQDFMELMQEPLLHHISYQDAKQKVAQGAIWLDVRHPPEYRYDKLPGAINVPLNDIRNAIGVLSKATTYVA
    Y
    CQSGRRSAAAAFILAQAGYDVYVLENGLWAVPKAQQQ

    >gi|291613213|ref|YP_003523370.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MRFFLRLLGSAALVLAMGTASAESFVFKDLQGHEQRLQDYRGKWVLVNFWATWCPPCLEEIPDLVSLYDAHKNKDLTVIG
    VSLDSTRESVVEFVAKKKISYPVVFGDYDQAAQVGEVDALPTSYLYDPDGKLVSYQQGMVTRSSVESYIKSKTLRK

    >gi|291613273|ref|YP_003523430.1| iron-sulfur cluster assembly accessory protein [Sideroxydans lithotrophicus ES-1]
    MINLTPNAISAVEKFMKGSATPVAGLRIAISGGGCSGFQYGMSLEEAKNEDDTVLEYGAVTLLVDPLSAPLLEGVTVDFV
    DSLNGSGFKFENPNASSSCACGSSFSA

    >gi|291613304|ref|YP_003523461.1| nitrogenase-associated protein [Sideroxydans lithotrophicus ES-1]
    MATVVFYEKPGCGNNTKQKVWLAASGHTVLAKNLLTEKWSAVRLRPFFGTLPVAQWFNPSAPRVKSGEVDPAAVDAHTAL
    EMMIAEPLLIRRPLMEVDGEFRAGFDAKAVDAWIGLNDSQPKDEPCPSGQARFPHPNPLPEGEGTSAALRAISNPCHRSE
    PCPAPKESHHA

    >gi|291613326|ref|YP_003523483.1| electron transport complex, RnfABCDGE type, A subunit [Sideroxydans lithotrophicus ES-1]
    MREYLMLLLSTVLVNNVVLVKFLGLCPFMGISKKTDTAISMGLATTFVMTMASAACWMLEHWLLVPLGMVYLRILVYILV
    IAVVVQFTEMVVRKTNPGLYQVLGIYLPLITTN
    CAVLGIPLLTTQEKLPFVNSLLYGFGSAAGFTLVLLLFAGLRERLAL
    AQVPSAFVGAPIGFITASLLALAFMGFAGLV

    >gi|291613331|ref|YP_003523488.1| electron transport complex, RnfABCDGE type, E subunit [Sideroxydans lithotrophicus ES-1]
    MSGSYARITRDGLWDNNIVFAQILGMCPTMAVTSSATNGLGMGLATTAVLLASNAIISAARDLISPDVRIPVYIVLIATL
    VTLVDVSLNAWAHDLYKVLGLYIALIVAN
    CAVLGRAEAFAAKVGVGEAAMDGLMMGLGFTLALTTIGGIREVLGAGTLFA
    NAHLLLGPAFAFLETTVIPDYKGYLLMILPPGGFMVLGFLLAARRVIERRRAERAAVAAVPEAVAG

    >gi|291613470|ref|YP_003523627.1| thiol-disulfide isomerase and thioredoxins family protein [Sideroxydans lithotrophicus ES-1]
    MKNIKVLGTGCANCKNTMKLIEEVAKAKGVEIQLEKVEQLQDIMAYGVMSTPGVVVDGKVVHAGGVPSRDKITGWL

    >gi|291613479|ref|YP_003523636.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
    MSEHIRYVTDGTFTAEVLQSPLPVLVDYWAEWCGPCRMIAPILDEVSKEYAGRLNVAKLNVDENQQTPQKYGVRGIPTLM
    LFKNGNIEATKVGALSKSQLTAFIDSHI

    >gi|291613642|ref|YP_003523799.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MDTKRKISALWKGVLLALLVSLCSAHLALADDWSLKDRNGAQYKLSEQKGKWVLVNFWAPWCPPCIAEMPGLDALQKQRK
    DLLVIGVAVMYGKTEEVTDVIRQHSISYPIVMGNEDIASDFGEMTGMPTSFLYSPAGKLVGHHYGPLTQNEVEQAIARKP
    AAAGLFTP

    >gi|291613712|ref|YP_003523869.1| glutaredoxin-like protein [Sideroxydans lithotrophicus ES-1]
    MDAKTIALEKIKKTVTENPVVLYMKGTPQFPQCGFSGRAAQVLKACGVDKYVSVNVLADQEAYDYLKFYADFPTFPQLYI
    KGQLIGGSDIMISMYEQGELQKLLETAAV

    >gi|291613778|ref|YP_003523935.1| selenide, water dikinase [Sideroxydans lithotrophicus ES-1]
    MNDAIKLTQYSHGGGCGCKIAPAVLAEMLAAMPQPPSYPNLLVGTESSDDAAVYKLNESQAIVVTTDFFMPIVDDARDFG
    RIAATNALSDVYAMGATPILALAVVGMPVAKLPLDTIREILAGGAAVCEAAGIPLAGGHSIDAPEPIYGLVGVGVVHPDH
    VKRNDRAQAGDVLILGKPLGVGILSAALKKGELDAAGYRQMVDTATQVNRVGATLGGMDCVHAMTDVTGFALLGHLLEVC
    RGSKLGAELDFDALPFLPAALKLAEQGYSTGAADRNWSSYGAEVELPQGFPEWQRKLLCDPQTSGGLLVACAAGEADKVL
    SMFHEQGFDAACIIGRMFSEQPQVGIRVLRR

    >gi|291613907|ref|YP_003524064.1| arsenate reductase-like protein [Sideroxydans lithotrophicus ES-1]
    MKLYGIPNCGTVKKARAWLDEHGVDYEFHDFKKQGVTEAMLSGWLRQVGWQKLLKKTGPTWGQLPEAIKASIKDDTSAMG
    LMLDKPNVIKRPVLEHQGKVLATGFNETDYENLDY

    >gi|291613941|ref|YP_003524098.1| copper-translocating P-type ATPase [Sideroxydans lithotrophicus ES-1]
    MSQAENHADLQIVGMRCASCSSRLEKALNQLPEVTAVVNLATEKASVTFDPNHTNVDELIKAVRDTGFDAHVSRDFAAEK
    ADRLKAYQQEKLRFFISLALIAPMVLEMLLMPFDIHLSLPTWAAWILATPVQFWIGARFYRGAWASIKHGSGNMDLLVAL
    GTSAAYFLSVAIVIFDIHQPVYFESSAVLITLVLMGKLLEMGAKAKASSAIEKLIQLQPKIAHVERDGQILDVSAGQLRP
    DDIFIVRPGENVPVDGVVLEGASTMDESMLTGESMPQSKQANDKVYTATLNHQGMIKCRATAVGSHTQLAAVVRLVEQAQ
    GSKAPIQRLADRISGIFVPVVLVLATLTFFVWLKVDGDISSAIINAVSVLVIACPCALGLATPVTIVVASGLAAREGILV
    KDAAALERAHKLAVLVLDKTGTLTEGKPTLTSLRPSATSSVGELLRIAASLAQHSTHPLSGAVMEHAQAQATMPLPVSDF
    EESPGSGLRAKLDGIPYLLGSPSFITQQGIALDDGSILGLQKQGKTVIAIAREQVLLGYIAFADRIRPGSRIAVARLRGM
    GIRVVMLSGDNQATAKAIAEQAGIEEFIAEVSPQDKARYVASLKNDKTLVGMVGDGINDAPALAAADVSFAMKNGSDIAI
    EAADITLMRNDLNSVADAIDLSHVTLSKIRQNLFFAFAYNVLGIPLAGLGLLNPMIAGGAMAMSSVSVVSNALLLKKWKP
    GEPVPDSEVEKTVAVNTETSLSSQGTTS

    >gi|291614032|ref|YP_003524189.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MGRYFAVVVLVLAVSMPAYPALNVGAAAPNFVTQASLGGKVFTYSLADELKKGPVVLYFYPAAFTPGCIIEAHDFADAIE
    RYKALGATVIGVSHDDIEKLNKFSVSECRSKFPVAADADQSIMKSYDAILAAKPEYANRISYVIAPDSKIIYTYTDLQPG
    KHVASTLEALRRWNAGYKPDRP

    >gi|291614070|ref|YP_003524227.1| Thioredoxin domain protein [Sideroxydans lithotrophicus ES-1]
    MHMHDPHPYSYDVEEANFDERVVARSQDAPILLDIGAEWCAPCKVLGPHLERLAKEYSGKFLLAKVDADENMRIAGKHKV
    RGFPTVIAYSRGAEFDRFHSSQPDHFLRQFIDKLISHHQSGA

    >gi|291614097|ref|YP_003524254.1| peptide methionine sulfoxide reductase [Sideroxydans lithotrophicus ES-1]
    MTDIYQTAYLSGGCFWGMEELVRQIHGVLETEVGYTGGDIPDATYEIVKSGRSGHAESLKVVFDPGLLTYRHLLFEFFRM
    HNPTTRNQQGNDIGTQYRSAIFYLDEEQKRTAEEVISTVDASRGWSAKVVTEVVPFKDFWRAEEYHQRYLVKHPHGYTCH
    YVRRMQLGE

    >gi|291614147|ref|YP_003524304.1| sulfur relay protein TusD/DsrE [Sideroxydans lithotrophicus ES-1]
    MKFGIVVNEGPYQHQASDSAYLFAKAAIEKGHEVWRVFFYHDGVNNASKLTEPPQDDRNIVTRWAKLAEEHKIDLVVCVA
    AALRRGIKEENLAQGFRISGLGQLVEAGIKCDRLVTFGD

    >gi|291614156|ref|YP_003524313.1| glutaredoxin [Sideroxydans lithotrophicus ES-1]
    MIRTMVRMFFRTLRWILMPFMLLWAKLATPKGLVRSADEQHKTDLECERMVLYHFQTCPFCIKVRHEMARLSLPIKLLNA
    QHDPLRREELQQGGGKIQTPCLRITDDQGNVQWMYESNDIIKYLQHRFS

    >gi|291614158|ref|YP_003524315.1| protein of unknown function DUF395 YeeE/YedE [Sideroxydans lithotrophicus ES-1]
    MDAAVVTKTIVWWGFGLGIVFGFIANKTNFCTMGAVSDVVNMGHWGRMRAWLLAIAVAMIGTNALAYFGYLDLSKTIYTG
    SNFPWLAYIVGGLCFGVGMTLASG
    CANKTLVRVGGGNLRSVVVFIYLGFAALVTLKGILGAFRVNVLQAPAVTIQLDHGQ
    TLPALLSGIGGLAPNTLQMVMAGVIGLAMMVFVFKDEKFRKNLDNNLAGLIIGLLVVGGWFVAGHLGYGENPDTLEMTYL
    GTNSHLAESMSFVAPTAYTLEYWAYWTDTSNIVTFGIATVFGVGIGSFLYALFTRSFRWEAFSSAQDMFYHIIGGTLMGF
    GGVTAMGCTIGQGITGVSTLSLGSILALASIIAGAAVTMKIQYALLMRES

    >gi|291614167|ref|YP_003524324.1| Disulfide bond isomerase, DsbC/G-like protein [Sideroxydans lithotrophicus ES-1]
    MNAFSYLVLLLFFFSNAALADEAAIKAAMEKRFPYEQVISVHKTPYLGLYEVVLNDQLVYTDENMSYLFSGNIIDMHTMQ
    NLTEEREKQLYAIDFDSLPLDLAIKNVKGNGKRRLAVFTDPN
    CPYCRRQEKEMVGLTDATIYTFVLPILPGSKEKAEAIW
    CSSDRLKAWEDHMLKWKDPKPGKTCDTSALTRIAAAAKKLNIVVTPTLVFEDGIMNPGWLRLELLDERLTSSSPKKK

    >gi|291614213|ref|YP_003524370.1| protein of unknown function DUF255 [Sideroxydans lithotrophicus ES-1]
    MTNHLAHETSPYLLQHADNPVDWHPWSAATLQLARDLGKPILLSIGYSACHWCHVMAHESFEDEAVAAVMNELFINIKVD
    REERPDLDQIYQNAHQLLSRRSGGWPLTMFLAPDGTPFYSGTYFPKQARYGLPGFPALIQDIAHAYKEQRGELAEQGKQI
    VAALAAWQPEKSATDSTLDASPIATSIRQHSENFDRVNGGFGGAPKFLHPAELDLLLQQTHATHDAQTRHIVLFTLQQMA
    QGGLYDQLGGGFCRYSVDAEWDIPHFEKMLYDNGLLLGLYSDAWLSSSDPFFARIVEQTAAWVMREMQSPQGGYYASLDA
    DSEHEEGKFYVWQRNDIRDLLSAAEYALIQPHYGLDSTPNFENHAWNLRVSQPLGEIAQKLGLGEEQAAMLLAAAKTKLF
    AAREQRIRPGRDEKILGSWNGLMIAGMAKAARIFGREDWLHSAQQAMDFVRTTLWQDGRLLATHKDGKTHLNAYLDDHAY
    LLNAALELLQAEFRSPDLSFAVQIADALLARFEDVRNGGFFFTSHDHEALIQRNKTAQDNATPSGNGIATQGLLRLAELT
    GDIRYTDAAERCLKLFFPIMQRAAGQFSSLCTALGEALQPPSMLVLCGAEIETAAWRAAVAAKYLPGLMIIVLNGDEASL
    PSSLDKPRSATTTAWLCHGTQCLPPITSLDELLTEL

    >gi|291614230|ref|YP_003524387.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MKNLHVLPDNLPVPQDDGACAHLQGMQMPSLSLPSTADRTVDLGSESGIVVAYFYPMTGRPDAPPMIGWNEIPGARGCTP
    QTCAFRDHHAELRGLGATVYGVSAQSSEDQKEAMQRLHLPFELLSDGAFELTSALRLPTFEYNALRLIKRLTLILEDGKI
    VKVFYPVFPPNENADNVMAWLRANRA

    >gi|291614251|ref|YP_003524408.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Sideroxydans lithotrophicus ES-1]
    MMRFILPLVAFLVLAVFLYIGLGLDPHEVPSPLIDKPAPAFTLPQLHDPKKQFSMQEMKGKVWLLNVWSSWCVSCKEEHP
    VLLSLSQQNIVPIYGLDYKDKKEDAEMWLRQAGDPYTLSVMDSDGRVGINYGVYGVPETYVIDKTGIIRFKQIGPVTDQN
    LREKILPMVAELQNK

    >gi|291614444|ref|YP_003524601.1| DSBA oxidoreductase [Sideroxydans lithotrophicus ES-1]
    MQVEIWSDVICPWCYIGKRHFEQALAGFVHGDKVNVIWRSFELDPDAPHQREGTLQEYLAKKYRVSLEEAAAMNERVTSV
    AKEAGLEYRLAAARPGNTFDAHRLLHFAASRQLGDRATERIMHAYFSESLPVGDRAALAHLAPEFGIAETDALALLESSE
    YSDRVRADEARAEEFGIKGVPFFVIDEKIGVSGAQPVDTFTKVLQQATQAA

    >gi|291614451|ref|YP_003524608.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MPKQAVADFTLPATGGAEFTLHPIRSKSLVIYFYPKDNTPGCTTEAQQFRDLYAEFRTAGSEIVGISRDSIRSHENFKTK
    FTLPFALLADEDEAACNLFGVMKQKMMYGKQVRGIERSTFVLDSKGIIRKEWRGLKADGHAQEVLDFVQTM

    >gi|291614454|ref|YP_003524611.1| methionine-R-sulfoxide reductase [Sideroxydans lithotrophicus ES-1]
    MDNHEKTEDEWREELTPEQYEVCRECGTEPAFTGEYWDCHDIGVYRCVCCGQPLFDSETKYESGTGWPSFWQPISEDAVE
    YREDDPTGMDRIEVCCASCDAHLGHVFEDGPDPTGLRY
    CINSASLALDRK

    >gi|291614478|ref|YP_003524635.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MTDYNICIGMPTVEALHLGKPVTIQREQNPAAIIRADYAPTARKCPPYCIQPMQLAPGVETLGELEVLDCLKRIREGERN
    LMVVDSRTPDWYAKGTIPGAANIPYAQNMAGEATDLPGLKRTLIESFGVKETAGAYDFSNACTLAVFCNGPW
    CGQTPNYI
    RTLLSLGYPASKLKWYRGGMQDWCSLGLTVI

    >gi|291614598|ref|YP_003524755.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MKWLILFGLLAAFALLVSQMARAGELPKVGEAAPDFELPDQNGVKHSLKQFSGSWLVLYFYPKDDTPGCTQEACAFRDDL
    HKLTAMGAQVVGISVDDSTSHAEFARKYHLPFPLLADGSTEVAARYGALMDLWLFKFAKRYTFLIDPQGRIAKVYEKVDT
    SRHSTEIIEDLKQLTMKGK

    >gi|291614663|ref|YP_003524820.1| thioredoxin [Sideroxydans lithotrophicus ES-1]
    MSDPKHIVCPHCDAVNRVPSDKLASQPTCGKCKQALFTAHPVELNATNFMQHISRSDVPVLVDFWAPWCGPCRSMAPAYE
    QAAQRLEPGMRVAKLNTEEAQQLAAQYNIRSIPTLAVFKGGRELARQAGAMDAANIVAWAKSKIL

    >gi|291614706|ref|YP_003524863.1| Disulfide bond formation protein DsbB [Sideroxydans lithotrophicus ES-1]
    MLKYWDSMSKRWLYLAGALVVGALFCSALYLQYVLRQEPCPLCMIQRVIFIVIGVLFFIAALFNAGRVGSRIYSALIALF
    AAGGIAVAGRHIWIQHLPKDQIPA
    CGPGLDFMLKHFPMSDVLQELMHGSGECAAKGWTFLTLGIPEWSLIWYILLGVFAL
    FVGWKKR

    >gi|291614711|ref|YP_003524868.1| iron-sulfur cluster assembly protein IscA [Sideroxydans lithotrophicus ES-1]
    MTISLTENAAKHVQNFLAKRGKGVGLRLGVRTSGCSGMAYKLEFADAVDSEDLQFVSNGVTVLVDQHSLPYIDGMELDYT
    REGLNEGFKFNNPNVKDQCGCGESFKV

    >gi|291614743|ref|YP_003524900.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MPIQVVQLQAGTDAPQFELADADMQMFSLSEHRGKNIVLYFYPKDDTPGCTMEANEFSDHEDEFARYGTIVVGVSRDDCI
    SHATFRDKYGLSVQLLSDMDGRVCRKYGVLYEKEVDGHKKLCIQRSTFIIGKQGELRHVFYGVHAHGHPQEILKLIKEMK


    >gi|291614755|ref|YP_003524912.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MERYDDLVAEALTRVKEIMPWDLSRALAAGSKPVLLDVREPAEFDLLRIPGSINVPRGVLEQSCEWDYDETVPELAAARD
    QEIVVI
    CRSGKRSVLAADMLQRMGFAKVVSLKTGVRGWSDYEQPLTNAKGEELDADAGDELLAPRVKPEQRKPK

    >gi|291614847|ref|YP_003525004.1| electron transport complex, RnfABCDGE type, A subunit [Sideroxydans lithotrophicus ES-1]
    MTDYLLILVSTVLVNNIVMVKILGLCPFMGVSKKLEAAIGMGAATTFVLTLGSGASYLIQHYLLGPDLAYLTTLSFIVVI
    AGIVQFTEMAIKKTSPELYQILGIYLPLITTN
    CAVLGIPLLNVQAKHDFMQSLLFGFGGAVGFTLVMILFAGIRERLEGA
    DVPGIFKGSAIAMVTAGLMSLSFMGFSGLVK

    >gi|291614852|ref|YP_003525009.1| electron transport complex, RnfABCDGE type, E subunit [Sideroxydans lithotrophicus ES-1]
    MNLQEYKDIVHNGLWKQNPGVVQLLGLCPLLAVSSTVVNGVSLGLATSLVMALSGASIAPIRSYVPNEIRIPVFILIIAV
    LVTVVQYLMNAYMYGLYVVLGIFIPLIVTN
    CIVLARVEAFASKNNALSSALDGFAMGLGLTAVLGVLGAMRELLGKGTLF
    SGIDLALGDVAKDWVLHIIPNYKGFLIAILPPGAFIGLGLLIAGRNWLNLRAAQKRQGPTAVPAPVDGGCSPAMH

    >gi|291614871|ref|YP_003525028.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MADFKIITVAELPNLIASGNAQLVDVRTDAEIARGRIAGAICLPLHLLPMRLQDLDAKKSTVFYCQMGGRSAQAAAFAAA
    QGLGDVYNLQGGITAWAHAGGNIVV

    >gi|291614907|ref|YP_003525064.1| iron-sulfur cluster assembly accessory protein [Sideroxydans lithotrophicus ES-1]
    MNTVTDLQDPLLFTDNAANKVKQLIEEEGNAELKLRVFVSGGGCSGFQYGFTFDEVANEDDTVMNKNGVQLLIDPMSFQY
    LVGAEIDYTEGLEGSQFVIKNPNATTTCGCGSSFSV

    >gi|291614928|ref|YP_003525085.1| OsmC family protein [Sideroxydans lithotrophicus ES-1]
    MKARIKWVEEVSFLGETESGHAVLMDGPPAGGGRNLGPRPMEMLLIGTGACTAYDVVTILKKARQQISDCVVDIQSERAE
    KDPKVFTGIHLHFVVTGKNLRPEQVERAIHLSAEKYCSASIMLGKTAKVTHDFEIIEG

    >gi|291614936|ref|YP_003525093.1| electron transport complex, RnfABCDGE type, A subunit [Sideroxydans lithotrophicus ES-1]
    MGHESVSQIFISTLLTNNFVLAMFLGLCPFLGVSGRLGTAFPMGVATTFVMLVASLCAYGLNLLLGYFHLEFLRLISYIV
    VIASSVQLVEMVMKKYSPALFRALGIYLPLITTN
    CAVLGVALFQTARDYNFTQSLAFASGGGAGFTLALVLMASLRERLQ
    LSNVPTLVQGTALSLILAGLLSLTFMGFAGLGGGE

    >gi|291614937|ref|YP_003525094.1| electron transport complex, RnfABCDGE type, E subunit [Sideroxydans lithotrophicus ES-1]
    MSLPNQADESITFDTFMEGVWRQNPVFVMVLGMCPTLAVTVSAVNGLSMGAATTFVLTSSCFLISLIRNLVPKEVRIATY
    IVIIATFVTLVDYLIQATSLKLYEALGAFIQLIVVN
    CIILGRAEAHASKNPPLKAVVNALGMGVGFTIGLFTLGGTREIL
    GAGKLFGISLFGEHFQPWVVMVLPPGGFFVLGGWLLLFALFRGKPATEGGHHHGA

    >gi|291614962|ref|YP_003525119.1| dihydrolipoamide dehydrogenase [Sideroxydans lithotrophicus ES-1]
    MSQTIEIKVPDIGNFKDVAVIEIAVKAGDHVEKEQALISLETDKATIDVPSPVAGVVKQLKIKVGDKVSEGSIILLLESQ
    DLGTGNSDLAKPAASAPQVAAAAPTKSQIQNPKSTVKGDIHAEVVVLGAGPGGYTAAFRAADLGKQVVLIEKHASLGGV
    C
    LNVGCIPSKALLHVAKVITEAEEVSHHGVTFGKPKIDIDGIRGWKESVISKSTGGLAQLAKQRKVQVVQGVAKFTSPNSL
    VVQTADGEKIVTFDNAIVAAGSSVARIPGFPYEDERIIDSTGALALKDVPKRMLVIGGGIIGLEMATVYDALGSKISVVE
    LMDQLMPGADKDMVKPLHTRIAKRYEAIMLKTKVTKIEATKAGLKVTFEGEQAPAEPQVYDKVLMAVGRRPNGREIAAEA
    AGLIVNERGFIPVDKQMRTNVPHIFAIGDIVGDPMLAHKAVHEGKVAAENIAGHKAFFEPLTIPSVAYTDPEVAWMGLTE
    TQAQAKGTPFEKASFPWVASGRAGSVGRPEGATKVLLDPQSRRILGMGIVGVNAGELIAEAVLALEMGADMEDIGLTIHP
    HPTLSETLCFAAEMAEGTITDIMAPRKK

    >gi|291614994|ref|YP_003525151.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MPNDLVSKFRTSRWRGLAVNVLLFVAVIGGIRAWQHRDMVSGTAPALQGTTLAGQPYRLPTHPAHPVLVHFWATWCPICR
    AEQGSIAAIARDDPNVITVAMQSGKPEAVARYMGEQQIDFPVVNDADGSISNAWGVHGVPASFIIAPDGRISFIEVGYTT
    SIGLRLRLWLAGI

    >gi|291615038|ref|YP_003525195.1| electron transport protein SCO1/SenC [Sideroxydans lithotrophicus ES-1]
    MSLRNLLLCLLFPLLASCGEQSLPSPFQAGDVTAKYAHADFHLKDATGKPVSLADYRGKVVALFFGYTHCPQICPTTLAE
    LAHMMKLLGKDADRVQVLFVTLDPQRDTPELLAKYPAAFYPTFKGLYGDSAETAQAAKAFGVTYEKHMNKDGGYDLDHSA
    GTYFISPRGRPILLSPFWQHSDSWVQDVRILLSFK

    >gi|291615068|ref|YP_003525225.1| glutaredoxin 3 [Sideroxydans lithotrophicus ES-1]
    MAKIVMYCTEICPYCVRAEHLLQRKGIKDIEKIRIDLQPEMRDLMIEKTGRRTVPQIFINGQHVGGYDDMAALDRAGKLD
    TMLANNL

    >gi|291615069|ref|YP_003525226.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MLQFLQNNIWMVLIALTSGAMLFWSFFGNRLRGIQEVNSIAATQLINHKNALVLDVREQSEYDAGHILNSKLIPVGKLLE
    RIGELEKYRDRPIVAV
    CRSGQRSASACTLLGKQGFAQVYNLNGGVMAWQKAGLPLEK

    >gi|291615124|ref|YP_003525281.1| UBA/THIF-type NAD/FAD binding protein [Sideroxydans lithotrophicus ES-1]
    MDDQQLLRYSRHILLQEIGIEGQQRLLGSCALIIGVGGLGSPAALYLASSGVGKLTLCDHDSVDFSNLQRQIIHRTGTVG
    QPKVVSAQSALHEINPEVECVALAIRADEAQLGELIAQADVVLDCSDNFETRYAVNRACLAQRKPLVSGAAIQFHGQVAV
    FDYRNDDAPCYNCLFPEDSEAEELR
    CATTGVFAPLVGIIGTLQAAEALKLLMGIDRGLSGKLLSINALDMNILRSSLSKD
    PACRTCGDITAERRVNS

    >gi|291615130|ref|YP_003525287.1| thioredoxin reductase [Sideroxydans lithotrophicus ES-1]
    MEKPAQHHRLIILGSGPAGYTAAIYAARANLKPTLITGMAQGGQLMTTTEVDNWPADVNGVQGPELMQRFQQHAERFNTE
    ILFDHIHTARLQQKPFLLIGDAGSYTCDALIISTGASAQYLGLPSEEAFMGKGVSG
    CATCDGFFYRNQDVAVIGGGNTAV
    EEALYLANIARHVTLVHRRDSFRAERIMVDHLMEKVKEGKITLQLNQTLDEVLGDDSGVTGMRIKQVQGSATQEIKVAGV
    FIAIGHKPNTDIFAGQLEMDNGYIVTRGGRLGNATATSIDGVFAAGDVQDYIYRQACTSAATGCMAALDADKYLSELR

    >gi|291615132|ref|YP_003525289.1| Peroxiredoxin [Sideroxydans lithotrophicus ES-1]
    MAVLVGKQAPDFNAVAVMGNNEINETFNLKKQIAGKYAVVYFYPLDFTFVCPSEIIAFDHRLEEFKKRNVEVIGVSIDSH
    FTHLAWKNTPVDKGGIGQVRYTLVADIKHEICKAYDVEAEGGVAYRGSFLIDRAGVVQHQVVNNLPLGRNIDEMLRMVDA
    LQFTEEHGEVCPAGWSKGKAGMNASPDGVAKYLASHAKEL

    >gi|291615190|ref|YP_003525347.1| methylated-DNA/protein-cysteine methyltransferase [Sideroxydans lithotrophicus ES-1]
    MDYQAIISAPFGKLGIRCSDTDLLGIEFLPGKTKSQPPQSAMAKTICAELEAWLADAKHEIDLSFELDGTHHQCNVWQAM
    LDIPCGQTLTYGELAKQIGSSAQAVGQACGSNPIPVVIP
    CHRVVGKTGLGGFMGHAEGDSLDIKRWLLAHESYSSLSPKG


    >gi|291615222|ref|YP_003525379.1| peptide methionine sulfoxide reductase [Sideroxydans lithotrophicus ES-1]
    MLTIKVIRSFFLGGLGLMLGLGTFTNAGAVPAEQTAVFAGGCFWGVDAVFKHVRGVSNVVSGYSGGSAETAHYEMVSQGD
    TGHAESVRVRFDPAQVSYQQLLQVFFYVAHDPTELNRQGPDTGSQYRSVIFYTSAEQQKAAQDYMQKLNAEHVFRGPIVT
    QLVPLKQFYPAEEHHQNYLELHPYQPYIVFNDMPKLDRLHKTFPALYQ

    >gi|291615223|ref|YP_003525380.1| cytochrome c biogenesis protein transmembrane region [Sideroxydans lithotrophicus ES-1]
    MLIFLLAYLGGVLTILSPCVLPVLPFVFARSERSFRRSGLPVLIGMAVTFAVLASLAAVGGAWLVEVNQYGRYAAMALLL
    LLGLALIFPSWSERMMRPFVVFGGRLQQRADQQGSIKGSLLLGVAVGFLWAPCAGPILGLVLAGAALNGANLHSALLLFT
    FAAGAATSLAVALLASGRVIAWMKRSFGVEEWVRRVLGVAVVAGIVVIAFGWDTRFLAQFTSANTTAAEQHLIRQLAQRP
    AAIEVAETGMAAPLNGATEWINSPALSMEALRGKVVLVDFWTYS
    CINCLRTLPYLKAWDEKYREQGLVIVGVHAPEFAFE
    KDLHNVEQAVRELGIRYPVAVDNQYAIWNAYQNEYWPAHYLIDAQGHIRHEHFGEGAYRETEQMIQTLLKEAHQNLAFKD
    GFVRVQGAGALAAATDMDRSPETYVGYGRQENFASPEAIERDKPARYTAPRKLKADHWALSGSWRVGKESAQLDAAGGGI
    SYRFRGRDLHLVLGPHSGKPVRFRVTLDGAAPGKDHGVDTDAQGNGVIREQRLYQLVRQSGKIRDLTFKIEFLDADSEAF
    AFTFG

    >gi|291615224|ref|YP_003525381.1| methionine-R-sulfoxide reductase [Sideroxydans lithotrophicus ES-1]
    MQRRDFLLAVSGMALAYSARSLAKTPDANDQVTIMRFSDDGKPLGRVTLAKVHKEAEWKARLSPLAYEVTREQGTEMAFS
    QPGYNRHEPGLYRCVCCDNALFDAATKYDSGTGWPSFWQPIAAENVREIRDHMFGMTRTEVRCALCDAHLGHVFDDGPQP
    TGLRY
    CMNTVALRFVPRPK

    >gi|291615254|ref|YP_003525411.1| Methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
    MLFTRPQAQAFYDRFGSKQDAQAFYEDAALDDLIAHAAFEQAASVFELASGTGRFALRLLGRHLPATASYLGIDLSSTMI
    GLATQRIAPYADRAKVMQTDGTMQFPLPDHSVDRVVCVYLFDILPEDDIRQAIAEAHRVLKPGGKLCVASLTQGVTVASR
    IVSTLWSLAFRLHPALVGG
    CRPLRLDRFFDFANWSPDRRNVVVKFGVPTEVVVATPK

    >gi|291615296|ref|YP_003525453.1| Rhodanese domain protein [Sideroxydans lithotrophicus ES-1]
    MYGSINLRQTLIALSVIFLAGIWMANVNSHHYDIKNVTISEADSLIKAGALVIDVRDQDKFNFRHIPGAILIPLEVLRAG
    IPLSLAAFKSRPIVIY
    CNEGLSHGPEGTAILQKAGFAKAVNLESGIEGWAKSGMPIQRG

    >gi|291615297|ref|YP_003525454.1| alkylhydroperoxidase like protein, AhpD family [Sideroxydans lithotrophicus ES-1]
    MSTSYKALTQEISKELSRFRKEVSVPMAGFDAMAKSAMAEGVLSALNKELIATAIAVATRCEGCVGYHVRGLVKLGATRE
    QVNEMLAVAVYMGGGPSLMYAAEVLHAFEEFQQQ

    >gi|291615306|ref|YP_003525463.1| cytochrome c biogenesis protein transmembrane region [Sideroxydans lithotrophicus ES-1]
    MIRRLLLILLLCTATMAHASIFSFGSKKPTFLPADQAFSLEVHSIDQRTLIASFNVTPSYYLYRNKITFSTPDGKTRIAS
    VTLPKGETKNDPNFGTLEVYHQSFQTEIVLENADAAKPLVLNASYQGCSDNGLCYPPIEKTFNVALAQTVSAAGPESISP
    AVPGNENTQIAKLFKNGSFWLIVSFFFGAGLLLSLTPCVFPMIPILSGIIVGRGHKITHMHAFFLSLAYVLGMAITYAIA
    GVAAGYSGNLISNALQTPWVLGSFAAVFVVLSLAMFGLYELQLPTALQSRLSDTSNKLHGGHISGVFAMGALSAIIMGPC
    VAAPLAGALLYISQTHDAVLGGVALFVLALGMGAPLLLIGTSAGALLPKAGAWMEAVKRFFGVLMLAMAIWIVSPVIAVS
    VQMMLWAALLIFSAIYLHALDPLPHNAHGLNKLGKGMGILALLLGVAYLIGALSGARDMLRPLGNIVHASAETPATLRFE
    RVKGITGLDARITRAKGQTVMLDFYADW
    CVSCKEMERFTFSDSTVQAKLKNAVLLQADVTANDADDKALLQRFQIFGPPA
    TLFFDAAGKELSDFRVTGYQDAPQFLQSLKNTGL

    >gi|291615317|ref|YP_003525474.1| Redoxin domain protein [Sideroxydans lithotrophicus ES-1]
    MTKDTAKKPATTLGGAPVTLFGTFPGAGQQAPDFTLVDKDLKDVSLQNFAGKRKVLNIVPSLDTAVCATSTRKFNEAAGK
    LNNTVVLVISADLPFAMNRFCVAEGLQNVVTLSLMRGRDFMRNYGVKIADTALAGLTARAVLVLDDKDKIIHAELVDDIK
    HEPNYDAALAALDKSEQVAAP

    >gi|291615384|ref|YP_003525541.1| glutaredoxin [Sideroxydans lithotrophicus ES-1]
    MKKCLLLLSLLMFTNAHAGELYRSIDSSGKVHYGDSPLQDSEDVEELKVGKEPTPDEPLPYETQRAKQNFPVTLYTFPGC
    GSGCDQARDLLSKRGVPFTEKSLVQQEDIEAFRKASGDSQIPAVSIGNTWVKGFLAEQWNNELDIAGYPKKVLTYRPPRP
    ATPAAAQPAQ

    >gi|291615398|ref|YP_003525555.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sideroxydans lithotrophicus ES-1]
    MVSLQPPLCDFGWKARPFDLPGVDGKRHTLESARGKNGLLVMFICNHCPYVKSIRDRIMRDVRELQQHGINSIAIMSNDP
    ADYAEDSFDNMKLVAQQYDYPFPYVWDETQQVARDYGAVCTPDFFGFNAALELQYRGRLDASRKEAVPDAQRDLFNAMLQ
    VAKTGQGPREQIASMGCSIKWRE

    >gi|291613472|ref|YP_003523629.1| OsmC family protein [Sideroxydans lithotrophicus ES-1]
    MIFHVSTSRIDAHGSLARCKSAEVFLDTDLAGRSDAFNPAELLLAALSACIIKGVERVTPILKFELRGVEVRIEGIRQDA
    PPKMESITYEIIVDSDERERRLELLHDNVRKYGTVFNTIAPGTQLSGTLRRKNLA