Bacillus clausii KSM K16 uid58237

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56962006|ref|YP_173728.1| copper-transporting ATPase [Bacillus clausii KSM-K16]
    MKTIILRITGMTCASCSSRIEKVLLRLDGVETATVNLALEEATISYNNEKVGLGDMENRIRSIGFGIQYKEETFNVSGMT
    CSACAARIEKVVGKLEAVDHISVNLALEQANVRYQEALLSERQLKEKVEKIGFSFERVNEQEEAKKDPISLYVWVGILLS
    FPLFWAMADHFTFTEFIWVPELFMNPWFQMLLASPVQFIIGSRFYKSAYSAIKNRSMNMDVLVALGTSAAYFYSVYLAFQ
    SLATYTNHVRLLDIEIILAMVIVVGFFALYMGITQKKWSYDLLVIGPIMAIYGLGYYFAAQRLNPHEGDMPDLYFETSAV
    LITLIMVGKLLESKAKTKSTKAITTLVKGQAKTALKVNGANEEHIAVDSIQVGDLLLVKAGEKVPVDGKIVKGITTIDEA
    FITGESLPQDKTVGSFVYGSTMNITGAIVVEATTNGNETVLDDIVRVVREAQQSKAPIQRFADRISAIFVPIVVAFALFT
    FFVWYMFVSPGNMPHAFEAAIAVLVISCPCALGLATPTSIMAGSGRAAEAGILFKGGEHLELANRVDTVVLDKTGTITEG
    KPVLMHVFSLQPNEHIWLSYVNEIEKQSNHPLAEAVTVGLQERLLNVCTVNGLEELAGMGMKANGCGESVLIGNRRLLDT
    YGVSYQALDEQAKIRERKGETVLFVAVGSTVAGFLSLADELKPDSKEGINQLKRMGLDVIMVTGDNPQTAASVAEQVGIE
    KYKANVLPDGKRTLISAMQEQGAVVAMVGDGINDAPALVTADVGIAIGSGADVAVESADIALISGSLKKVGSALTVSHLT
    MANIKQNLFWALIYNSIGIPIAAAGLLAPWLAGTAMAFSSVSVVLNALRLQKKTIGQKEGTL

    >gi|56962051|ref|YP_173773.1| cadmium-transporting ATPase [Bacillus clausii KSM-K16]
    MGDEHASVYRVDGFTCANCAGKFEKNVKDLPGVKDAKVNFGASKLTVYGEATIEALEEAGAFEQLKVTKEPSRRQPFQYT
    QIPFYKKHRSILLSVLLLVFGYVFQFKYGESNIGTVGLFLTAILVGGFPLLKTGIRNVARLEFDMKTLMTLAVIGGAIIG
    EWGEVAVVVILFAISEALERFSMDRARKSIQSLMDIAPNEALIKRNGQELTVHVGDIVVGDIMIVKPGQKIAMDGIVVHG
    HSSVNQAAITGESVPVEKAVDDEVFASTLNEEGLLEIEVTKLVEDTTISKIIHLVEEAQGERAPAQAFVDKFAKYYTPII
    MVVAALVAIIPPLFAGGNWSTWVYQGLAVLVVGCPCALVISTPISIVSAIGNAAKKGVLVKGGVYLEEMASLKAIAFDKT
    GTLTKGIPVVTDFALLNPQLDQRQLFAIVAALENRSQHPLASAIVAKAEDEQLPYHDYMVENVTALTGKGITGTVNGKTY
    YVGSPKLFQERLPTRDITPFAQNIKSLQQQGKTAMLVGTETELLAIVAVADEVRPSSKEVIRKLHEAGIAKTVMLTGDNK
    QTAHAIGQAVGVADIQAELMPEDKLRFIKQWQENHGHVAMVGDGVNDAPALAAATVGIAMGGAGTDTALETADIALMGDD
    LKKLPFTVKLSRKTLNIIKANIAFAIAIKLAALLLVVPGWLTLWIAILSDMGATLLVALNSIRLIGVKE

    >gi|56962539|ref|YP_174265.1| thiosulfate sulfurtransferase [Bacillus clausii KSM-K16]
    MIVTPKWLYDRLGEVIVLDARFDLFDEKKGKQAYHAEHLPGALFIDMAEEMADKRIQGAGRHPLPSPEDMAQMFAKKGIS
    KDSKVVIYDDQNGGIAAARAWWMLEFLGNNNAAILDGGIQAWKNSGYPTTDEVKPPDEARFDPHVKEDWLVTAEQVKNKL
    GSAVVVDSRSRERYQGEQEPLDPKAGHIPGALNFPWGGVLGQDGNWKTTEELVQHFAALPRDREVIVY
    CGSGISACPNVL
    ALKRAGFKQVTLYAGSWSDWSSRSGYPVETGHPSQ

    >gi|56962901|ref|YP_174628.1| hypothetical protein ABC1129 [Bacillus clausii KSM-K16]
    MTEQAKWNFDNSYARLPQPFFARLKPNPVRSPKLVLFNEPLATALGLNGEALQQPEGVAVLAGNVIPEGGEALAQAYAGH
    QFGHFTMLGDGRALLIGEQITPDGNRFDIQLKGSGRTPFSRGGDGRAALGPMLREFLISEAMHALGIPTTRSLAVVTTGE
    EIWRETELPGAVLTRVAESHLRVGTFQYAAGRGEVNDVKTLADYAIKRHYPELAESENPYLSLLEQVITRQANLISQWQL
    VGFVHGVMNTDNMTISGETIDYGPCAFMDTYDPATVFSSIDTQGRYAYGNQPQIANWNLARFAETLVPLLAEDETKGVEM
    AQSAIEGFKGQYVSNWLAGIRKKLGLFNAEDGDKDFVEKLLRLMHEHEADYTNTFRLLTLGQPEKTAMNGAAEFSEWLEQ
    WQQRQSRQAQTKDEAMKLMRTNNPAVIPRNHRVEEALAAAVDEEDDSLVKQLIAVLKEPYAYSEEQERYAEVPERCQHGY
    VTY
    CGT

    >gi|56962976|ref|YP_174703.1| hypothetical protein ABC1204 [Bacillus clausii KSM-K16]
    MARIEKSPIGQTPFQQLLGHNPNILEAWGNLAAQLEREGSLSAELKEQVRRTLAQGNGCAYCKAKGKPDQHHVDEKTVLA
    TGFADVFLKNRDAIDEKLFQLLSEQFSTKEISELCAFIAFTTAQQYYGAMMGLEAESPNS

    >gi|56963006|ref|YP_174733.1| transporter [Bacillus clausii KSM-K16]
    MSVIASSQPHRDIQQNKAPALNRPQNRLVIGGLVVAAALTLFLAFTQDIVQPLLLVIGLGLGYTLFHARFGFTSAFRRLA
    SVGNGQAIRAHMVMLAVACSLFAPILAIGTTFFGAEATGNVSPVGVSLIVGAFLFGIGMQLGGG
    CASGTLYAVGGGRSVM
    FITLLFFIIGSTIGAAHFSFWMNDMPAAEPFSLATSTNLGYGGAWLVSLLIFGAAILLSLWIEKKRNPPKMAALPSASGW
    KRIFRGSWPLMAAAVALAVLNALTLLTRGSPWGVTSAFTLWGSKAADALGFNVESWGYWQGNIDALHASIFADTTTVLNF
    GVILGAFIASAAGGLFKFSNITAKNAAASVIGGLLMGYGARLAFG
    CNVGAYFSGIASFSAHGYIWGVMALGGTFLALYLR
    PLFGLSVPKPKDTFC

    >gi|56963038|ref|YP_174765.1| glutathione peroxidase [Bacillus clausii KSM-K16]
    MSVYDFSVKTSNGQDVSLSAYKGNVLLIVNTATKCGFASQFAGLEKLYNDYKEKGFYVLGFPSNQFLNQEPVADEDMEQV
    CKINFGVTFPLFAKTDVKGKHANPLFNYLKAAKKGMLSEEIKWNFTKFLVNRKGEVIKRYAPATKPETIEADVIEELKAD
    A

    >gi|56963069|ref|YP_174796.1| thioredoxin reductase [Bacillus clausii KSM-K16]
    MFDCIIIGGGPAGLNAALVLGRAKRKVLLLDENKPRNAVTHASHGFLTRDGIEPSAFKEAAYADLRKYPNIEWTQVRVGA
    MTKEQSGFSVQTEKKETYHARKILLATGLKDHLPDIAGIESFYGSSLFP
    CPFCDGWELRDRPLVVICEDERVLHSGKLIW
    NWSKDLVICTNGQRFLTDEQKKPFLANGIEIIEEEITALEGEDGQLQNIRFADGQEINRKGGFVAVDLQQAAAFGKALGC
    TYNEQGGIKTDPFGRTSVAGVYASGDTTFNGPQQLILAAAEGSKVGAGIVIDLVEEEF

    >gi|56963091|ref|YP_174818.1| bacterioferritin comigratory protein BCP [Bacillus clausii KSM-K16]
    MVRQGEKAPDFELPANGGKTIRLSDYKGSYIVLYFYPKDMTPGCTTEACDFRDQTEAFKKEGAIVLGVSPDPADKHDKFA
    EKHGLPFPLVADEDLEAAKAYGVWQLKKNFGKEYMGIVRSTFVIGKDFTVLKEWRNVKVKNHVDDVLAFVKGQNDE

    >gi|56963232|ref|YP_174963.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Bacillus clausii KSM-K16]
    MSSLKQMYVKEMESPLGLLSIVASERGVCQIHFGEINKAQVTAKLSKAGIRPQWIHLDENEDLDICGQLREYFNGLRVEF
    DADIDLIGTPFQLKVWKELQNIGYGKTKSYKDIAQAIGAPKAVRAVGGANNQNPLPILIP
    CHRVIGSNGAMVGYGGGLTK
    KQLLLGLEGALKISS

    >gi|56963386|ref|YP_175117.1| assimilatory nitrite reductase [NAD(P)H] large subunit [Bacillus clausii KSM-K16]
    MNKEKVVLIGNGMAGIRTLEEIIKREPSRFQFTVFGAEPHPNYNRILLSSVLQGDASVSDIVLNDYDWYERNQIELFTGD
    AVVRVDCRKKEVWSASGIKRTYDRLIFATGSDPFMLPLPGAEKEGVIAFRNIAD
    CESMINAAKSYQKAVVIGAGLLGLEA
    ARGLLNLKMDVDVIHIADHLMDRQLDSDAGKMLKAELEQQGMQFHLNKKTVKINGHKRVKGISFSDQTSIKADLVVMAVG
    IRPNVQLAKQSGLKVNQAIVVNDYMETSEEDVYAVGECAEHRGIVYGLVAPLYEQGKVLAEHICTNTSNEVSGYKGSIVS
    TKLKVSGVNVFSAGAFRDQDETKSIRIHDEFAGVYKKLVVKNNQVVGAVLFGDTNDANRILSLIRSGEDISAISKAALFP
    SETNDSSPSVVATMADEETICGCNGVSKGEIVCAIKEQGLSTVAEIRQCTNASRSCGGCKPEVAELLALTTGTDIMAKPE
    PLCGCTELTHEAVVASIREMGLSYVREVISVLGWKSEEGCSKCRPALNYYLGLISPLDYTDDAHSRFVNERVHANIQKDG
    TFSVVPRMYGGVTNPEQLRKIADVAEKYNVPLLKVTGGQRIDLLGVEKEKLPNVWRDLGMRSGYAYGKTLRTVKTCVGED
    FCRFGTQDSISLGIEIEKKYEGLNTPHKVKMAVSACPRNCAESGIKDVGIVGVEGAWEIYVGGNGGVDLRSAELLCKVET
    NEEVMETISAFLQYYREQATYLERTSHWIERVGLESIKKVIFDDSIERAALIERMEMALSRHKDPWTEIVESEEKQNQLF
    EKKKIAVKQGGGM

    >gi|56963388|ref|YP_175119.1| assimilatory nitrate reductase electron transfer subunit [Bacillus clausii KSM-K16]
    MGSESRQRLVLIGNGMAGVRVVEEVLKLAPRQFAITILSEEDRPSYNRILLSSVLQGKQTLHSIGIHPFQWYVDHGIELR
    LGEEATRIDPVAQKVYTDKGELAYDKLVIATGSEPFVLPVPGVEKEGVFVFRTIRD
    CERLTEWSTRYQKAAVIGGGLLGL
    EAAQGLAHLGVDVSVIHLSDRIMERQLDETAARLLKQSLESKGIHFLLQKQTAEISGEERVTGLLFHDGTTLSADFVVMA
    AGVQPNIAIAKESNIPTKRGIVVDDRLRTDVSGVYAVGECAEHNGISYGLVAPLYEQAKVLARELCGLPGLYYNGTVLAT
    QLKISGVNVFSAGETTCSGTCTVLKTLNEITGQYKKLLFKEDCLAGAVLFGNTRQSDQLLQLIRANTPLSDDEKTQLLTE
    DGTAFERELASLPASHLICNCNAVSKGDIMSAMAAGQHTIAQIKAGTKAASSCGGCEVRVAAMLESFKHGQLQATVDIAE
    RKPLCPCTSLTEQQVAQSIAEKRLVVFSDMSEKLGWKNKNGCRVCREVSAYYAGLFFPGGAPKERNGKQENDGSYTITLP
    HIAGRLSTDQLKQFALMAEELQVPRIDFSARNQVQLKGLTEKQLPYVFEQLDMPPAVLAGKRLQVAIDDSHYNWPEGRHL
    AERLLDLFNCVPFPAETEVCVTLAARRHELAAIRLSRSPLNWEVAIGSELFCSNDSVEGTFQLVCALLQYFRQSAQYSEN
    IHAWLVRKGAVHVREVVFDAAC

    >gi|56963489|ref|YP_175220.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus clausii KSM-K16]
    MAHLERYSRQLLFSGIGEEGQQRLLNSRVLIVGVGALGTVLANHMVRSGIGHIRIVDRDYVEMSNLQRQMLFTESDVEQA
    LPKAVAAKQMLEKVNGSVHIEAFVEDVTIQNVDRLMEGMDLVLDGTDNFKTRFLLNDACFKKGIPFGYGGAVSARGMSAF
    LVPEKTPCLRCFITSGASPGET
    CDTVGVIAPVVDIVASYQVVEAMKYLVGATDQLRRSVQTFDLWGNYDHKLKFQAPKSN
    CPTCQLHEYPALQVEQEAETTLCGRDTVQIATGSRFQLKEWAAKLQPIATVKETPFLLRVSLPEGEQLVLFPDGRVLVQG
    TEDISRARTLFSKYIGD

    >gi|56963512|ref|YP_175243.1| methionine sulfoxide reductase B [Bacillus clausii KSM-K16]
    MTKPQKDELKKKLTPIQYFVTQENGTEPPFQNEYYETEEEGIYVDVVSGKPLFSSKDKYDAGCGWPSFTKPIDEAEIIEK
    EDRSHFMVRTEVRSKNADSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKAKLKEAGYGAYEKLFD

    >gi|56963542|ref|YP_175273.1| thioredoxin [Bacillus clausii KSM-K16]
    MKKRSWTLAVLVGACVAIVFFVWQFNGESKPVQAGDHLLDMELDVYKGASASFSDYQDGVLVLNVWASWCEPCIREMPAL
    MEVAEDYRNKGVSVITVNSQSKELRPEDAIEFIEEQGLTLPVFFDSEGAFMQAFKPSSLPTTYIIDQNNVVTDVLVGEVT
    KEMLDNKLQELL

    >gi|56963550|ref|YP_175281.1| organic hydroperoxide resistance protein [Bacillus clausii KSM-K16]
    MADIVYTSSATAQGGREGHVKSDDATIDLDLVKPGSKKEGSNPEQLFAAGYASCFDGALNLMAEKAKKEIDSTTTAHISL
    VKDPSDGGFQIGAELEVVVKGVSEEEAQELVEKAHEF
    CPYSKATRGNIQVKLTAKAE

    >gi|56963597|ref|YP_175328.1| thiol-disulfide oxidoreductase [Bacillus clausii KSM-K16]
    MGKSKKKRSIIRFTVLFAIVCAIGYTIYANAASEQGAVKVGEPATNFALVDLEQERFELGQNQGKGVFINFWGTFCEPCE
    REMPYIENAYEQYKDEVEMIAVNVDEAPLTVQSFINRHGLTFPVAIDERREVTRAYGIGPLPATILVDEHGIVQKVHTGA
    MTEEMVHEFFQSIVPDA

    >gi|56963607|ref|YP_175338.1| NADH dehydrogenase [Bacillus clausii KSM-K16]
    MKIIVIGCTHAGTTAVKNLLRLHPDADITVYERNDTVSFLSCGIALHVGGVVEHAEDLFYSSPQELAALGASMHVLHDVI
    NVDNENKKIRVRNLQTGEQFTDKYDKLVFTTGSAPVIPSIPGVGLKNIQLCKNYYQAQQIIKKATNAQKIAVIGAGYIGI
    ELVEAFATNGKDVTLIEGANRILNKYLDHEFTDKIETTLREHHVTLALGEKVESFIGNSAGGVQAVQTSKQTHEADLVLL
    CVGFKPLTDLIKDKVDTLENGALLVNEYMQTSDPNIFAAGDNCAVFHNSANHMAYIPLATNATKMGTLVAYNIKRPTFAY
    KGTQGTSGLKLYDLNIASTGLTEEAAAIYGLDVRSFTFTDHERPTFMPSAEEVRIKLVFEQESLRIVGAQVMSKTDQTHL
    MNTVSVCIQQQMTVTDLAFADFFFQPHYSKPIHLLNSLALNILEQREPMQKTAEVRVST

    >gi|56963809|ref|YP_175540.1| thioredoxin [Bacillus clausii KSM-K16]
    MDFSLPQLSTNQTWQLSKEAAGRAVMLTFWTSWCPDSERDLAAKMPLAAHADQNKLQFVTVNVTGREGNVDLQAYLQKRG
    WDFLVLQDRGTALYDHFNCKGVPTTVLLNNRHEQTAQFGEQAKLPDILAELALLID

    >gi|56963811|ref|YP_175542.1| thioredoxin [Bacillus clausii KSM-K16]
    MINISYSELRAALDAGKDGWVYVHSPFCGACKKAEQMLSIIEESKETFSFWQVNIQLAPEWARSAQIESVPALLYYKKGR
    LQAKMYRLFSVMEILSNMKEVENDVNGL

    >gi|56963883|ref|YP_175614.1| hypothetical protein ABC2118 [Bacillus clausii KSM-K16]
    MIHQFLLDATWNGGRNSTGTIQTGNLSHSISIPKEMGGPGIGTNPDEMLLGAAATCFLITYAAMLERAQIEVESLTLHAE
    ADVDVTNNIFEFRAIRHFPTVVLKEQTQLEKAERLAFKAESS
    CMITKAVAGNVAVSVTPNVKAVDRDE

    >gi|56963905|ref|YP_175636.1| methionine sulfoxide reductase A [Bacillus clausii KSM-K16]
    MAIEKAMFAGGCFWCMVQPFDQLPGIKAIVSGYSGGHTKNPTYEQVKTGETGHYEVVEITYDSEQFPYSKLLELYWPQID
    PTDDGGQFQDRGSQYRTAIFYYTEEQKQLAEASKAELNNSNRFNKPIVTAILPASTFYRAEEEHQDFYKKQPKAYKQDRA
    QSGRDEFIAMNWKENKPR

    >gi|56964182|ref|YP_175913.1| dihydrolipoamide dehydrogenase [Bacillus clausii KSM-K16]
    MVVGDFAQEVDTLVVGSGPGGYVAAIRAAQLGQKVTIVEKGSLGGVCLNVGCIPSKALIQAGHRAHLAKSSEDIGIRAEN
    VAIDFEKVQEWKGSVVKKLTGGVEGLLKGNKVEIIRGEAYFSGEDTVKIMDEKSSSTYKFKH
    CIIATGSSPIEIPNFKYT
    DRVINSTGALALKEVPKKLVVIGGGYIGIELTGAYSNLGSEVVVLEGTKQILPGFEKQMAKLVERKLKKNGVTFHTEAMA
    KGVEETDNGVKVTAEIKGEEKVIEADYVLVTVGRKPNTEEIGLEGIGVEMDDRGYIKVDKQGRTSVKNIFAIGDIVPGPA
    LAHKASYEAKVAAEAISGEPSEVDYLAIPAVCFSEPELATVGYNEAQAKEAGYDVKVAKFPFAANGRALSLNDADGFMKL
    VTRKEDGLVIGGQIAGPNASDMIAEIGLAIEAGMTAEDIALTIHAHPTLGEITMEAAEVALGTPIHTL

    >gi|56964192|ref|YP_175923.1| hypothetical protein ABC2427 [Bacillus clausii KSM-K16]
    MALKLRSEMPELTGATEWLNGEVVKGDLIGDKPTLIHFWSISCGLCKEAMPNVNEFRDQYKDELNVIAVHMPRSEKDLNI
    DEIKQVADEHGITQPIFVDSEHKLTDAFENEYVPAYYVFDKEGQLRHFQAGGGGMKMLTKRVNRVLGIKEEK

    >gi|56964193|ref|YP_175924.1| 2-cys peroxiredoxin [Bacillus clausii KSM-K16]
    MTEKRMVGKQAPRFEMDAVLPNKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITALSDRYDEFEDLDAEVIGVSTD
    TIHTHKAWINTSRDDNGLGDLAYPLAADTNHAISREYGVLIEDEGVALRGLFIISPEGELMYSVVNHNNIGRDVDETLRV
    LQALQTGGLCPANWKPGQATL

    >gi|56964217|ref|YP_175948.1| dihydrolipoamide dehydrogenase [Bacillus clausii KSM-K16]
    MAENYDLVIVGGGIGGYVSAIRAAQEGLKTALVEQALLGGTCLHKGCIPSKALLRSAEVLRTAKEASVFGVATGPVAFDF
    AGAQKRKQEIVDRLAQGVKALMSKGKIDVYEGRGRMLGPSIFSPSPGTISVDLANGDNQMLIGKNVILATGSVPRPLPHT
    PFDGKQILSSDDVLQLKELPASMVIVGGGVIGIEWASMLVDFGVSVTVVEASETILPTADQAVAAEMEKQLKARGVVFYT
    NAQLDEQTVATTSSGIKATVHQNQEEHTIEADKMLVAIGRVANVSDIGIDNTDIALAHGCIAVNEYGQTKESHIYAVGDC
    VGGLQLAHVAAHEGIAAVSHIIGKQVEPVDPLAVPSCVYSFPEAAQVGMTETQAREAGHAVKIGTFPFAMNGKALIHGEA
    GGFVKLIADKDTSDLLGVHIIGTHATDLISEAALAKFLDAADFELAETVHPHPTLAEAIGEAALAVDGYAIHK

    >gi|56964257|ref|YP_175988.1| hypothetical protein ABC2492 [Bacillus clausii KSM-K16]
    MDAQTIILIVLTVVLIVFIASRFYKPKYLKTLSQDEFIKGYRKAQLIDVRETREYEGGHILGARNIPLSQMRQRLSEIRQ
    DQPVYLY
    CQSGTRSKQAAKLLRKKRGVQDISYLKGGFRNWTGKVKKK

    >gi|56964293|ref|YP_176024.1| transcriptional regulator Spx [Bacillus clausii KSM-K16]
    MVTLLTSPSCTSCRKAKAWLEEHDIPFEERNIFASPLSVEEVKQVVRMTEDGTDEIISTRSKVFQELDVELESLPLQKLF
    TIISDNPGLLRRPIIFDEKRLQVGYNDAEIRRFLPRKVRTFQLQEAQRLVN

    >gi|56964299|ref|YP_176030.1| thiol-disulfide oxidoreductase [Bacillus clausii KSM-K16]
    MIRSIRRSILFFILVAAILVVGWFHFKTESIFRHVEAIVHAMEEGVHEGKAAPTFALPTLSGGIGEFDPKKGAHSYTMVH
    FFATW
    CYPCQEEMPLIVEAEKRLRQQGDHFVAVNLTSEETSTQEVKAFLTHFNASFDPLLDKEGDIQKQYQIFGIPTTLI
    VDREGRIVRRINGAMDEGMLTELPPFSVAGAGL

    >gi|56964335|ref|YP_176066.1| hypothetical protein ABC2570 [Bacillus clausii KSM-K16]
    MARSEDGIVQLSTEEMKSFLINKADEPIIIDVREVEEYENGHLPGVPLIPMNEIPSMVAGMDQSKSYVFVCRSGRRSQNT
    ALYLREQGFSNVRNYEGGMLAWDGELEYGQEWVVKDVEELYK

    >gi|56964419|ref|YP_176150.1| hypothetical protein ABC2654 [Bacillus clausii KSM-K16]
    MSKDYRVLLYYYYTTIEDPEGFAKEHLAFCKSLQLKGRVLVAKEGINGTVSGLKEHTDAYMEAMKANPLFEGIVFKVDEE
    EQHVFKKMHVRPRPELVTLRLNEDDVNPNELTGKHLSPKEWREAMLAEDTVVIDARNDYEYDVGHFRGAIRPDIKAFREL
    PDWIRQNKEQFENKRILTY
    CTGGIRCEKFSGWLKKEGFEDVAQLDGGIVTYGKDPEVKGELWDGKCYVFDERLTVPINHV
    APTVVGKDYFDGKPCERYVNCANPECNKQILCSEENEHKYLRGCTPECRVHPRNLYVKEHQLSPEEHQARLDALGEKLPA
    RL

    >gi|56964433|ref|YP_176164.1| thioredoxin [Bacillus clausii KSM-K16]
    MAIVNATDQNFTEETKEGLVLVDFWAPWCGPCKMIAPVLEELDGDLGDKAKIVKVDVDENQETAGKFGVMSIPTLLVLKD
    GEVVDKAVGFQPKEALEELLNKQM

    >gi|56964507|ref|YP_176238.1| thiol peroxidase [Bacillus clausii KSM-K16]
    MQITFKQKPVTLAGTQVQVGEKAPDFTVLANDLSEVTLADSKGKVRLISVVPSLDTGVCDQQTRRFNEEAAKLDNTAVLT
    ISVDLPFAQKRWCASAGIDNVQTLSDHRDLSFGEAYGVVIKELRLLARSVFVVNADDEIVYVEYVNEVTEHPNYEAALEA
    AKNA

    >gi|56964536|ref|YP_176267.1| thioredoxin [Bacillus clausii KSM-K16]
    MEHIQSEQQFNEIKANETAVFLFSADWCPDCRVIEPILPRIEVDFPTFTFYYVDRDKFIDVCAAHDIFGIPSFLVYANGK
    EVDRFVSKDRKTEEEIVAFLTKAEAAID

    >gi|56964569|ref|YP_176300.1| hypothetical protein ABC2805 [Bacillus clausii KSM-K16]
    MDNYDVIIVGGGPSGLMASVAAAQQGAHVLLLDKGNKLGRKLAISGGGRCNVTNRMERKQLIENIPGNGRFMHSPFAVFD
    NESIIAFFEGLGIRLKEEDRGRMFPVNDKAQTVVDTLLAQIRKLDVTIRTNARVADIIVEDGQVVGVALEDGQRLGTKAL
    IIATGGKSVPHTGSAVYLIGTKNNLPTIQGGYFM

    >gi|56964696|ref|YP_176427.1| hypothetical protein ABC2932 [Bacillus clausii KSM-K16]
    MITLTDSAASQIEAMKKEEGDASLMLRIGVKGGGCSGLSYAMGFDNEQDEEDTKIHVNGIDVLIDKESEPIVKGLVIDYK
    QNMMGGGFTLDNPNAIANCGCGASFRTAANAGTPEDC

    >gi|56964744|ref|YP_176475.1| hypothetical protein ABC2980 [Bacillus clausii KSM-K16]
    MNRESHTTTEQHLGRYKKGVGTYEEKMPAFSRTYNEFTDQCFKDGALSKKQKHLMALGMSVYAQDEYCIIYHTKGCVDHG
    ASEEELLETIAVATAFGSGAAFSQGATLVQEAFGEFAKELQ

    >gi|56964751|ref|YP_176482.1| arsenate reductase [Bacillus clausii KSM-K16]
    MGVTVYQYPKCSTCRNALKWLDEHGVSYEAIHIVEAPPTSTTLKELHQKSGLPLKAFFNTSGKKYRELDLKNKLGEMSDE
    EQYQLLASSGMLIKRPIVTDGTKVTLGFKEDQFQDMWSTF

    >gi|56964788|ref|YP_176519.1| glutaredoxin [Bacillus clausii KSM-K16]
    MNVDFYTKKGCPLCDKGYALLKELADSYSLVIQCHDIYQDDVLLEKYQLKIPVVCIDDQEIGYGLLEKESLQKQIERIRS
    IKQ

    >gi|56964802|ref|YP_176533.1| thioredoxin reductase [Bacillus clausii KSM-K16]
    MAEETIYDVIIAGAGPAGMTAAVYTSRANLNTLMLERGMPGGQMANTEDVENYPGFDHILGPDLSNKMFEHAKKFGAAYA
    YGDIKEIIDEGDTKRVIAGSKEYRAKAVIVSTGAEYKKLGIPGEQELSGRGVSY
    CAVCDGAFFKERELIVVGGGDSAVEE
    AVYLTRFAKKVTIVHRRDQLRAQKILQDRAFNNPKVDFIWNKVVTEINEKDGKVGGVTLKDTKTGEVSNMEADGVFVYIG
    MLPLNESVQNLGITNEEGYIVTNEEMETKVPGIFAAGDVREKSLRQIVTATGDGSIAAQNVQHYLENLSEAEKVEK

    >gi|56964918|ref|YP_176649.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Bacillus clausii KSM-K16]
    MESNNKPILYWSLLTFRDLNFYIASTSKGLVFVGSPNKPFEELSEWAKKRFSRSPLVEAAEKLEPYAVEITEYLEGKRKT
    FTVSFDYDGTAFQLAVWNALCAIPYGQTRSYSDIANSINKPAAVRAVGAAIGANPVLITVP
    CHRVVGKNGSLTGYRGGFE
    MKTRLLDLERQGLSSNE

    >gi|56964995|ref|YP_176726.1| copper-transporting ATPase [Bacillus clausii KSM-K16]
    MSEKKAAISITGMTCAACATRIEKGLNKIEGVSQATVNLANEKATITYDSNKTEPSAFTEKIDKLGYGVRLEKAVFNVKG
    MT
    CAACATRIEKRLQKMPGVKEANVNLAIERATVVYNEAETNEQEMIRVVDKLGYQLEREAASSGNTKEEESQKRFGLFL
    FSAILSLPLLWTMVTHFEFTSFLYVPDMFMNPWVQLALATPVQLIVGAPFYKGAYKALANKSANMDVLVALGTSVAYVYS
    IFLGWEWYQNGQVGMPELYFEAAAVILTLIVLGKWFEARAKGRTSKAISTLLGLQAKTARVIRNGNEVELPIEEVKAGYE
    LIIRPGEKIPVDGYVKSGTSSVDESMITGEALPVSKKADDSLIGATLNKQGSLRMIATKVGKDTALAQIVKVVEEAQGSK
    ADIQRIADRVSGVFVPVVVLLAAATFLIWYTLIDPGNIRAAIVPFITILVIACPCALGLATPTSIMAGSGRAAELGLLFR
    GGEHLENTRSITTVVLDKTGTVTKGTPQLTDIVPAEGIDENELLAIVASAEFESEHPLANAIVQGAADRAISLREAEAFE
    ALTGYGIRAKVDGVVIHIGTRKLMEQATIEYAILEERMEELEQQGKTAMLVSIGTDIAGLVAVADTVKETSKEAVERLHE
    LGLEVIMLTGDNERTAKAIAAEVGINHVIAGVLPEEKSNEVKRLQEDGKRVAMVGDGINDAPALAVADVGMAMGTGADVA
    IETADVTLMRGDVNSVADAFLMSKKTMRNIKQNLFFAFFYNSAAIPIAAAGLLAPWVAGAAMAFSSVSVVANALRLQRIR
    MPQRGAASQ

    >gi|56965633|ref|YP_177367.1| NADH oxidase [Bacillus clausii KSM-K16]
    MKYIIIGGDAAGMSAAMQLVRKDAQADITVLERGEHYSYAQCGLPYWIGGEIESDRKLIARDADTYRIKHGIDARINHEV
    KAVDTKQKTVSGDGFCLAYDKLLIASGASPVIPDWENGDLKGIYTLKTIPDAKKIIAALGTEKKTVTVIGGGSIGLEVAE
    NLAKANHHVRILERAKRLAMNFDKEMADYIHEKAIDEGIELELNHEIIGFSGDKDGHVTGIRTNLTECPTDIVIVAVGVR
    PNTDFLRNTDIHLNNNGAIRVNRYMETNVPDVYAAGDCATQYHRLINKDMYYPLGTHANKQGRIAGLNMCGNTRVFMGIV
    GTQIYQFFDLALARTGLSSREIEEIGYPYKCVQAKLPHVAGYYPTNETIHIRLQFHAETGVVLGGQFIGTKGVDKRCDVL
    ATALYHGMTMQDLEELDLGYSPPFNSVWDPLQQTARRRP

    >gi|56965702|ref|YP_177436.1| thioredoxin [Bacillus clausii KSM-K16]
    MKKLLIIGAGVLALFIVLIIIQTVNNNNRLANNDLYDKDDLNAATIDQLNDENYQNIIMPDALAEKLEAGEDAVVYFFSP
    T
    CQYCKKATPKLMDVAGEEDIYIDQFNVLEYDDSAYGIEYTPTLIYFEDGKEVDRIVGDHTKDEFRTFLETTKAQ