Shewanella woodyi ATCC 51908 uid58721

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170724433|ref|YP_001758459.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MSTFQHLSVSQLIQLSETNPETQIVDIRDAASFESAHIKDSINLNNDNLANYIAEADMDQPLIVVCYHGISSQGAAQYMV
    EQGFDEVYSLDGGYQAWRESED

    >gi|170724491|ref|YP_001758517.1| glutathione-disulfide reductase [Shewanella woodyi ATCC 51908]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNVGCVPKKVMWYGAQVAEALHLYAKDYGFDVTVNKFD
    WNTLVASREAYIERIHGSYDRGLESNKVTLVRGYGRFVNERTIEVDGQEYTADHILIATGGSPSIPNIPGAEHGIDSDGF
    FALREQPKRVAVIGAGYIAVELAGVLHSLGSETQLFVRKHAPLRSFDPMLSEALMESMATDGPTLHTNSTPESVSKNADG
    SLTLKLENGESFEVDSLIWAIGRKPSTNNIGLENTQVKLNDRGYVVVDEQQNTTNPGIYCVGDIIEGGVELTPVAVKAGR
    LLSERLFNGMADAKMDYTLIPTVVFSHPAIGTMGLSEPEAVAQYGAENVKCYTSGFTSMYTAVTAHRQACKMKLVCAGPE
    ETVVGIHGIGFAMDEILQGFGVAMKMGATKAQFDAVVAIHPTGAEEFVTMR

    >gi|170724517|ref|YP_001758543.1| redoxin domain-containing protein [Shewanella woodyi ATCC 51908]
    MIKQGERVPDGTMLGELTNEGMLTHCVTDLFAGKKVVLFAVPGAFTPTCSQSHLPGFVVLADQFKAKGVDLIACVSVNDA
    FVMKAWGDSQNASEVMMLADGDASFTKAIGLQVDTAGFGGIRSQRYAMVLEDGVVTDLNVEAPKMFEVSKAEVILDLL

    >gi|170724691|ref|YP_001758717.1| dihydrolipoamide dehydrogenase [Shewanella woodyi ATCC 51908]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIIERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKTISSHGVVFGEPQ
    IDLDKLREYKKSVIGQLTGGLGGMSKMRKVDVVNGLGKFTGPNTIEVAGEDGVKVVHFENAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVFTKKIKKKFNLMLETKVTA
    VEAKDDGIYVTMEGKKAPTEAVRYDAVLVAIGRVPNGKGLDAEKAGVNVDERGFINVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMDCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKKK

    >gi|170724768|ref|YP_001758794.1| DSBA oxidoreductase [Shewanella woodyi ATCC 51908]
    MKKALLIALALLTAPMAALAVDYKEGVHYTVINQGPATAKPEITEFFSFYCGHCYNFSKVQVPQIKANLPEGVVFKQNHV
    EFIGREMGTEMSRAFAVAHQLKVEDKIEKAIFAAIHDKKQHFTNRDDVRKLFIANGVDGKAFDAAADSFMVSAQMSQMKR
    ATENAQISGVPSLVVNGKYRVETGAIKSYDELLDIAYYLTSMK

    >gi|170724802|ref|YP_001758828.1| alkylhydroperoxidase [Shewanella woodyi ATCC 51908]
    MANLHPVEIASASDAQQLLFKKVEGAFGAVPNMFRTIGHSSAALESMWTSFGALGKGSISPALGEQIAVLVADINRCEYC
    LSAHTVLGKNAGVTKEEMELAQRGVSNDLKVQAALDFAKKLVTQHGQVSRDDIGLVKGAGFSDAELTEILAHVALNIFTN
    YTNVAFDVEVDFPKVSLS

    >gi|170724879|ref|YP_001758905.1| thioredoxin [Shewanella woodyi ATCC 51908]
    MSDKIVHLSDDSFENDVINSTLPVVVDFWAEWCGPCKMIAPILDDVAEEYEGKVTIAKMNVDQNSVSPAKYGVRGIPTLL
    IFKNGELASTKVGALSKTQLKEFIDAQL

    >gi|170724883|ref|YP_001758909.1| hypothetical protein Swoo_0517 [Shewanella woodyi ATCC 51908]
    MNNNVKALLATTALFFSCQTLASSGCAFEDQQDGMIATCSEEKQEVILTGLVEAQTMVTELADFTQGYKEYQVDTAAITP
    LKNLKEPTEIVVIIGTW
    CPDCHRETPRLIRIMEEINNPNIKVTYIGVDRAKSDPQGLAAQYEFTRIPTIIVSQQGEELGR
    IIERPETSLEIDLAKILN

    >gi|170724931|ref|YP_001758957.1| aminotransferase class V [Shewanella woodyi ATCC 51908]
    MSQTTNLSQIYLDANATTPVLPQAAQAAMDAMQDLFGNPSSSHITGLKAKNLMEQTRQRAKTLLGTGEGKLIFTSGATEG
    IQTGILSGLIKAKTQIKKGKKYSILYGSTEHKAVPNSLAHWNEILGINAEIKAIPVDQFGKLDLEFIQKEVGNALMICTM
    AVNNETGVYQDLQQLEQCIREGNSKVFWLVDCVQALGKRPLNLAKTSIDYAPFSGHKLYAPKGIGFIYIREGAPFTPFIA
    GGGQESGLRSGTENLPGMAALNVIFQMLLDTDNTTFYDLNTLNDYRRQLSHSLSQAFPDIVFNHQFNNSVPTTLNFAVPG
    FSSKEIMDLFDAANIRVSSGSACSSKVTRSFVLDAMGLPVWQSESAIRLSFGPAMTQEEVDSACARIRSAAKALTNSCLM
    LDDTEQTQDKTPLNGLVQLRSGSSCTWVYADMKSKQALVIDPLPELEKRIDTLLQCQQLTPVAILDTHGHADHISGRVAL
    ANKYLSTQQSDVLGWPTNTKKVAVGDESFSVLTIGELFLVKVPTPGHTDDSISLLLSSDPMNLITSTRYAFCGDTILMGS
    LGRTNFASSSSIDMYHSLKQINRLIGQQTLLCASHDYNNEFTTTLSAEVVRNCLLQSVLTGSINQSQFAARKADLDSNLN
    DETGTEILCGAYYGDCDKAQIKEYSSDSLKQRLTVSSDVKILDIREPHEYALQHKLDTVSEQSSTENSLNTGLNIPMTRL
    VQFIQEHQMEKESEWVLV
    CRSGSRSMVAAQAMYRLGFTNVAHLKGGYALSS

    >gi|170724982|ref|YP_001759008.1| hypothetical protein Swoo_0617 [Shewanella woodyi ATCC 51908]
    MSDLPVLSEEEFKNKFPEVHQQVCDELGMGFVPAIFRCVALLNPDLAMSSWNMVRKNLCAGDLPRITKELMFSYIAHKKK
    CHY
    CTVAHHALALHHGFTEQDMAVILKDIEQIKNPSLKLVMKLADASVDNDFKRVSKLDNELCSLGFARDEITELVGMIS
    CALYMINLADSIGIDADKRFTDTIDKASLN

    >gi|170725146|ref|YP_001759172.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MKVFLKLILVLIFTSPLSAIASDLKVGDMAPNFKLQSTNGHFYQLSDYLGKQTLVLAWYPMANTHGCTLECRSLVQKGHL
    IREYNAVYMMASVDDLEDNQDFAEKQKADFPMLSDPTKETAKAYDVLNFVRVASRVTFYIGKDGKILKIDEDINAETAAE
    DIAATLKELGIEKSS

    >gi|170725160|ref|YP_001759186.1| DSBA oxidoreductase [Shewanella woodyi ATCC 51908]
    MIKHIALALTLAIAPLSSFASQFVEGKHFTQVSNKAASTQPKLTEFYSFYCHNCYNMETQYLGDIKANLNKKVKFDSKHV
    DFMNSEIGTEVMRSLGVIQALDASQKDKLTLAMFAAIQGEEEAGSHDHAHDHSAHDKPELNNRDDIKKVFAAHGIDGKKY
    DELADSKVVDSKLALWRVQQREFRVQSVPAFIVNDKYAINMGEIRSLGQLIDLINYLALDHKS

    >gi|170725186|ref|YP_001759212.1| peptide methionine sulfoxide reductase [Shewanella woodyi ATCC 51908]
    MAVERAILAGGCFWGMQDLIRKREGVIATRVGYTGGDVVDATYRNHGTHAEGIEILFDNTRTSFNEILAFFFQIHDPSTP
    NRQGNDRGSSYRSAIFYDSNEQKEQAQKMIVRMDASGIWPGPVVTELVPAGDFWEAEPEHQDYLELRPNGYTCHFPRPDW
    VLPSEE

    >gi|170725187|ref|YP_001759213.1| hypothetical protein Swoo_0823 [Shewanella woodyi ATCC 51908]
    MSNKEIDLGLTFDNSYFDKLEGFYVACSGAKAPDPKLIKLNGALANRVGLTNADPTSLAQVLSGTIAPSGSSPLAQVYAG
    HQFGGFSPQLGDGRALLLGEVLDKDGIRLDIQLKGSGRTPFSRGGDGKAVLGAVLREYIVSEAMFALDIPTTRALAVVTS
    GESVMRSQYLPGAVLTRVASSHLRVGTFQFFASRGENDKVKQLADYAIARHYPKVEESEQRYLDFLCAVRDKQAELVAKW
    LLVGFIHGVMNTDNMTISGETIDYGPCAFMDDYGSDTVFSSIDRDGRYSYNNQPVMAQWDLARLAETLLPLIHDDQDEAI
    ALATTAVTGFWEVFQQHWTAGMRRKLGLSDQEEGDFALGEQLLESMSGEEVDFTQLFRQLALDLQSGSHESQKLFNNADK
    FLVWKEEWETRLAKESLTVSKRIEMMNSANPIYIPRNHQVERAIEAAEMRGDYQPFEQLLAVLATPFTLQKEAQEYAEPA
    PADFGPYTTF
    CGT

    >gi|170725190|ref|YP_001759216.1| methionine sulfoxide reductase A [Shewanella woodyi ATCC 51908]
    MGSEKLGLSGTCYWCTEAIFQSLIGVEAVEQGWISSIGEDDWFSEGVIVTFNPELISLKNLIDIHLHTHSSTRNHSMRDR
    YRSGVYAIEPQQLTEIADALMVLQSEFTERLITQAYQFNLFKPSADEMQNYYYKDTERPFCQNIITPKLNKLLHTHGDYI
    NKEKLNHSLK

    >gi|170725259|ref|YP_001759285.1| thiol:disulfide interchange protein DsbC [Shewanella woodyi ATCC 51908]
    MIFTRVCTLIFAVLLAQSAIAAPNTPTDDSKALKEKLADTLSVKVHSLQESPIPGLYEALTDRGVLYISKDGSKLFHGNL
    YDLDKGMKNLTEAAMAGPRIEMMKPLEDNMLVYKAKNEKHVVTVFTDTT
    CGYCRKLHNEMQEYNDLGITIRYLAFPRRGI
    PSANADEMESIWCAADPLQAMTDAKGGKSVKQEKCDAKIAEQYNLGQSFGVNGTPAIVLEDGSMIPGYQPPAALLKVLEA
    TN

    >gi|170725290|ref|YP_001759316.1| peroxiredoxin [Shewanella woodyi ATCC 51908]
    MNQSIINTEIKPFSATAFHKGEFVPVSEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQSMGVEVYSVSTDTHFT
    HKAWHDASDTINKINYPMIGDPTGTITRNFGVMIEEDGLALRGTFVINPEGEIKVAEVHDLGIGRSAAELVRKIQAAQYV
    AEHDGEVCPAAWQPGAETLAPSLDLVGKI

    >gi|170725291|ref|YP_001759317.1| alkyl hydroperoxide reductase, F subunit [Shewanella woodyi ATCC 51908]
    MLDTNLKNQLNTYLQNLKRPVELVVSADSSPKAQELKALAQDIESLSPLVSITEAEGKRMPSMKVTSVETQTDITFAGLP
    MGHEFTSLVLALLHTGGHPLKLDDEVIEQIKALPGEYHFETYVSLS
    CQNCPDVVQALNMMAAINPNITNVMIDGSLFQTE
    VFERDILAVPSVYLNGKVFAQGRISLTEILNKLDTGAVARQAEVIAEKEAFDVLVVGGGPAGASAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELELESGAKLRSKTVLLATGARW
    REMNVPGEQEYRGKGVAY
    CPHCDGPLFKGKSVAVIGGGNSGIEAAIDLANIVEHVTVLEFDTNLRADEVLQRKAASMGNI
    KIITQAMTTEVVGDGKRVNGLNYTDRATGESHHLELAGIFVQIGLMPNSEWLKETISLTERGEIIVDGKGETSLPGVFAA
    GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHSAPEQSQAAA

    >gi|170725299|ref|YP_001759325.1| formate dehydrogenase, alpha subunit [Shewanella woodyi ATCC 51908]
    MKELTIDGKCLSANPETTLFHIAKEAGITIPNLCQQHNGLNFPNNEKSHCNLCQVEVQTFDNQNQANTVTVKACDTQLVS
    LYSNNTQKIEVITQSTRLSLLRQAALNEILKDHFADCQAPCQQACPAGVDVQSYLFHIAQGEHTEAVKVIKQTLPLPLSI
    GRVCPAFCETECRRGLIDEPVAIRQLKRHAADLDIQDEFSYMPEKLPATGKKVAIIGSGPAGITTGYYLSNSGHDVTIFE
    AMPKAGGWLRYGIPEYRLPKAILDKEIEQLCQNGLKILTNTKLGEQIHLNQLVEDFDAVCLAIGAQKAVAMDYPGSDLAG
    CYLGVDYLKDHCTDKHLITGKKVMVIGGGNTAIDCARTAKREGAEVTLVYRRTRDEMPAELYEIEEAEHEGIKFHYLTNP
    IENHSDSQGRVMSVTLEKMRLGEPDPSGRRAPIPTGETFTQAFDTVIPAVSQTPDMAFLSDPQSQLTTGKLALTRWNTFQ
    GCEQTMSAGLSTKIDKLFVLGDSRTGPATAVAAVADGRKAAQAIEKLLTSGLSCELVQHEFNSTKSIKTANLNGDIYPNA
    PKQLKAKMPELSIKERALNFNEIELGFEPSEAMKEAARCLECACQANTDCKLRDYATEYKVDNCTQDATLSPRQFSVDNS
    SPFITFDANRCISCGACVDICQQQSGHKAISFTEEHYQALPTQEKNSVRRAPRVGFAATMLDSNCVQCGNCIQVCPTGAL
    VDARDKTQGRTKPSEQASTICTYCGIGCRLNVHVDRENNKITRVSGDPDSVVNQGMLCVKGRFGFDFITSKQRLTQPLLR
    KDKQLVPVSWSEALDFIGTKLRHIISSHGGNAVAGLASAKATNEDNYLFQKLFRAVIGTNNIDHCARL
    CHASTVTALQES
    LGSGAMTNDIPGIVDSDLIFIIGSDTSNAHPIIASHIKSAIRQHGATLLVADPKKVDIADHAKLYVSHKPGTDVMLLNAI
    MQVIIKNDWHDLDYIQARVDDYSSLYDEVMKSDYRLENAALITGVPAKQITEMANMIGTATKTAVYYAMGVTQHTSGHNN
    VTAIANLQLLCGNIGIKGGGINPLRGQSNVQGACDMGALPNYFSGYQKVDDPLVQVRFREAWGIEDLPHQIGLAATEMMQ
    ALSHGELKALYVMGENPVLSDPDQAHVLLALKKAELLIVQDIFLTETAALADVVLPANAFAEKSGHFTNTERRIQQLQTV
    VKAPGSARLDWQIIQDIANRLGADWHYRDEKQIWHEITCVTPQYRGASWQAIDSRTRNGKLGLQWPCPAENHPGTPILHT
    TKFTRGRAKMTPVSYSLPAEPTCSEYPLTLSTGRLLEQFHTGTLTRKTPGLDELGKPKVMISVFDADKLGINNGDMLKIS
    SRRGEIEICAFVTRRAQVGVLFLPFHFVEAAANKLTINAIDPIAKIPEFKICAVKVEKVSVTAELS

    >gi|170725456|ref|YP_001759482.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MFTKTLNVLLLCLTSLSLIATAKPIASNDLNVMPLMNGQMLPSAKVANLKGETLDLLSLTQGKPSIIFFYRGGWCPFCNS
    QMGQLKEIEPKLIEMGFQLIGISPDSPEKLNASMIDQKLSYTLLSDTNLNAMQAFGLAYYTSEKTTERYMKKLKLDELLK
    VTPQGDKRLVLPVPAIYISDGTGLIHFQYVNPNFRVRPAPQLIEMAASLVPM

    >gi|170725546|ref|YP_001759572.1| alkylhydroperoxidase [Shewanella woodyi ATCC 51908]
    MTDVIFNNTRFDPDLTPFHEHAKQMAKAFGYTAALDFDKNLAQLVRLRVAQVNQCSYCLILHSKTAREVGIEPAKIDNLA
    SYWESELYSEQEKVALSYCDRLTQGTDPHFHEIHEQAKCFFSEKEIAELAAIVINMNLWTRLKLAQGATPSYAE

    >gi|170725565|ref|YP_001759591.1| iron-sulfur cluster assembly accessory protein [Shewanella woodyi ATCC 51908]
    MSEEIAEQATEQDELPIQFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVD
    PMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|170725858|ref|YP_001759884.1| hypothetical protein Swoo_1501 [Shewanella woodyi ATCC 51908]
    MTHYQRAPELHVSEWLNTPEPITLAQLKGEVVVLHAFQMLCPTCVSHGLPQAQALHKLFADEKVNILGLHTVFEHHQVMD
    KAALKVFISEYRLSFPIGIDTPSTQGVIPKTMQEYMLRGTPSIIVIDKQGQIRLSHFGHIPDLALGKIVGQLVAEPFETD
    KHTSPSKDTDIFKPQEERAEKGCDQTGCSI

    >gi|170725873|ref|YP_001759899.1| OsmC family protein [Shewanella woodyi ATCC 51908]
    MKKLYETNATASAGRNGKVSSDDGLLSLALSYPKEMGGSGEATNPEQLFAAGYSACFSNAILHVAREVKVPLTEAPVTAT
    VAIGAKEEGGFELTAALSITLELLEAQAVEIVKTAHQV
    CPYSNAVKGNIDVVLTLNGKSI

    >gi|170726033|ref|YP_001760059.1| hypothetical protein Swoo_1679 [Shewanella woodyi ATCC 51908]
    MFFRTYILFIFCIFVQFYPQVEATEVNISTSIEPELSAAFQARTAWLEDRKVIKGNSSSPQFINQLILSDSPYLLSHSLQ
    PVDWIEWEPEFESGFQSNGQLIFISIGYST
    CHWCHVMAEESFADREIAEHLNSSYINIKVDREQWPLVDERFKSALELLK
    GEAGWPLNVILTPEGQVIWIDSYLSKAKFSKVIRGLANRWHNKPEAIKSLAARIDKKLKAELGIGNEQSMGKTLSKSEWR
    ALLPKMHQNIHNSLIAEQGSSGPRFFRAYWALGLLDEYLRSGDKKLLMTVESHLDIILLSPVYDMVEGGFHRYAVDGDWQ
    VPHFEKMLYTQANMIRVLAKAYGLTGKGHYSIAMEQTSDWVETWLKNDFGYSSAVSALSEGEEGKYYLRAADTGSQEVGE
    QLVSIDNLTRDWRDSKTFQQLNESRANRIKPLIDEKVIVSWNSLYAVSLLEAYEVTQEKKFLDRANLLLDSLWLNARKDN
    QLNRILFHGRASIPAQMEDYAWFATALLKLSFYQAWADEEFENVTKEKALKKNIEKSIETATQRAVWLLDRLGNKVEGGK
    GDKLTNLTLDGELPSTYAAAFGAITNGRQMIGKREYKVWLNRLTRFFNPKPQSIISQYSFVTLMADKVKKVNVNQAVFAK
    GHGKVTLEQKQGKLSLLFDMEPGWHVNANPASSEKYIATQVSMADLGDVEVKGESFKVNYPEATHKKLGFNDESLALYEG
    IFEIELRDIVDNSSPQKVNIRIQACSDSLCLLPEDIFFFQ

    >gi|170726098|ref|YP_001760124.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella woodyi ATCC 51908]
    MKKAQKHEVQVSGSQVRYMADKHLLTPIADRLVKSPVGVLHIKANSLGISHLGVAKEGVELLKEDGGERFESALQHLSQL
    EVELQEYFSGTRQEFNVSLAPKGTEFQAQVWQALTELGYGRTCSYGDIAEKIKRPKAVRAVGAANGANPIAIIVP
    CHRVI
    GKNGKLTGYAYGLNMKQQLLSLEGESSGS

    >gi|170726114|ref|YP_001760140.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MQHNPAFLALVESILPQIMEMSVDEYQNSSDWELIDVREDHEWLKGHLPKAHHLGRGIIERDIETRFADKETPILLYCGG
    GYRSALAAMNLQLMGYSKVRSLTGGYKAWIERQLPIVQA

    >gi|170726131|ref|YP_001760157.1| iron-sulfur cluster assembly protein IscA [Shewanella woodyi ATCC 51908]
    MAISMTPAAAERVKSFLDSRGKGIGLRLGLKTSGCSGMAYIIEFVDDLNADDEVYEIDGVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|170726291|ref|YP_001760317.1| carboxymuconolactone decarboxylase [Shewanella woodyi ATCC 51908]
    MPLVTPLLESNEEVAQLARFFNETLGFCPNSVLTMMRRPKIAKAFIELNMAVMDNQGRVTSLLKRLIAYVSSNVTGCRYC
    QAHTIRAAERYGAEQAQLDNIWEYKTHPAFTDAERAALDFSVAASTVPNGVDEELNQRLHQYWEEDEIVEILGVISLFGY
    LNRWNDSMATTLEEGAIASGESLLALKGWEVGKHTN

    >gi|170726325|ref|YP_001760351.1| glutathione S-transferase domain-containing protein [Shewanella woodyi ATCC 51908]
    MFPTSRLFFNIKSHNIGSNDPIHKEIMTLATLYSFRRCPYAMRARLGIYLSGNQVMLREIILKDKPQAMLDVSPKGTVPV
    LITSTQQVIDESLDIMQWALSQNDPHNMLLQGNLEQQKVAMALIKTNDENFKPWLDRYKYADRYPEFSDTYYREKGEQFI
    SQLEKLLTQGDNLLGHNESIADHAIYPFVRQFAHVDKVWFEQAPYPNLHRWLANHLNSDAFTAIMKKYPLWLDNEQEYLF
    GAGH

    >gi|170726513|ref|YP_001760539.1| glutaredoxin-like protein [Shewanella woodyi ATCC 51908]
    METNETVEKIKQQIAENPIIVYMKGSPKLPSCGFSSQVAQIMINCNAQFAFVDILQHPDIRSELPKYANWPTFPQLWVEG
    ELIGGCDILTEMYQKGELQTLITETAAKYQSEENPS

    >gi|170726520|ref|YP_001760546.1| arsenate reductase [Shewanella woodyi ATCC 51908]
    MTQVTIIHNPRCSKSRQTLALLEENKCDIQVVEYLKSPLVKSEIEGLLEKLNLTAREIMRTKETEYKEQGLGELNLTEEQ
    LIRAIVKTPKLLERPIVLANNKAAIGRPPENVLSIL

    >gi|170726526|ref|YP_001760552.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MKTLTSGELAPMFTLKNQQDESISLEACLAQGPVLVYFYPKASTPGCTVQACGLRDSREDLSELNVTVLGISPDPVAKLA
    RFSDKQSLNFSLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRLSFLIGQDGKVAHVFNKFKTKDHHEVVLKHLKEG

    >gi|170726540|ref|YP_001760566.1| arsenate reductase and related [Shewanella woodyi ATCC 51908]
    MTLFGIKNCDTVKKARKWTEANGLNIPFHDFRVDGLTKEQLESWVETLGWEPLFNKRSTSFRNLSDEEKSDIDQAKAIEL
    MLTHPTLIKRPVLAADGKALVGFKEAEYKAWFNL

    >gi|170726569|ref|YP_001760595.1| redoxin domain-containing protein [Shewanella woodyi ATCC 51908]
    MVKRLNYHYDKLTSIIFVVAISLLPMNMVWAEPRLDIEVKGGDGQTYSLSELRGQVVYIDFWASWCGPCRKSFPWMDEMH
    NKYADKGLKIVAVNLDFDSTLADQFLQQLPAQFTIAYDVEHKVAKEFEILGMPSSYLFNRKGELVNTHVGFYGENLMEYE
    TEIVKLLNESK

    >gi|170726626|ref|YP_001760652.1| peptide methionine sulfoxide reductase [Shewanella woodyi ATCC 51908]
    MAVATFGAGCFWGVEHFFKQVPGVLKATCGYMGGKDSTNCYEEVKTGETGHAEVVQVEFDELQVTFEDILDVFWKNHNPT
    SLNRQGGDIGSQYRSTIFFHDKAQKAAAELSKLSLARSGKWGARHIVTEIVPLLTFHRAEEYHQNYLEKNELPSCHIAY

    >gi|170726767|ref|YP_001760793.1| heavy metal translocating P-type ATPase [Shewanella woodyi ATCC 51908]
    MKHCDCFHCGEPVQTGSQFTTRINDSDELMCCPGCQAVSQAIIDAGLTNYYKFRTEPGSKQTALVPDELSTFSAFDLPEI
    QQDFVYSKSDISTVSLSIDGIT
    CAACAWLIEHKLKHIAGIQSIVVNTTTERAQVSWLTDQIKLSDILNHISQIGYQAAPY
    QVDEQEKQSKESSRKFLLRLGLAGFATMQVMMFALALYADFFTDLDIEYRDYFRWVSMIFAAPVVFYSAQPFYFSAIRSM
    FSGRLNMDVSVSIAILGAYVASCIATVNGTGEVYFESVSMFTFFLLLGRYFEQNARQKASVSSSNLHKLIPITAQLVTEA
    GPEEVPAKRLKIGDVILVKPGEVIAADGVILEGETCVNEAMLTGEQMPVLKALNQEVFAGTINVDHPVKVEVTAIGQDQL
    VAEIIRLQEAASNNKPKVALYVDTISNYFTWTILAIALMTYIVWRIYWPEDAFWVTLAVLVATCPCALALATPTAVTCAT
    GIFTRIGVIARKPGVFEKLTNIEQVVFDKTGTLTCGTLTVEDVTLYNQAIKREVLSIAAALESASLHPIARAFEPFRRSE
    IQATEQQSTVGGGLSGVIGGVKYQIGSAEFVGVDNDLSQSVYLTQEGLLLAKFTLVDAIREDAVDTVKTLKSNGYKLTIA
    SGDSSIHVDEIARRVGIDEVYKGLKPSDKLSLVQKLQTKRSVVMFGDGINDAPVLAGANLSVAMGSGSAITKNSADLILL
    GDQLSRFNDAVDVAKLTNRVIKQNLYWALGYNLFIIPLAVTGHVLPYIAALGMSASSLIVVANSLRLLRVRL

    >gi|170726788|ref|YP_001760814.1| methionine-R-sulfoxide reductase [Shewanella woodyi ATCC 51908]
    MKSYEKSAAAVAALTEEQYRVTQENGTERPGTGELLNNKEPGIYVDLVSGEPLFASSDKYESGCGWPSFTKPIENNHVSE
    LRDNTHGMTRTEVRSTHGDSHLGHVFPDGPADRGGLRY
    CINSASLRFVHRDDMTAEGYGDYLDQVEER

    >gi|170726790|ref|YP_001760816.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella woodyi ATCC 51908]
    MSKHFDLIWIGTGQATMSIVPRLLAAGKKVAVIESGNFGGTCVNTGCTPTKTLVAAARAIFQAGRGDNFGFSVDNLQIDF
    EKIMAPQKRNRGNATSGIEQFLTNHQHCTVFKGRAEFVDDKSVKVNEDTISAEHIVIHVGARPVEPELPGIDIIEWLDNE
    KLLNLSELPHHLAIVGGGYIGLEFSQIFRRFGSKVTIFERGTALLAREDDDIGEIAEDILVSEGVEIIYNSQIESVSKGE
    GVDKINIHYTQAGEPKTLAASHTLFAIGRVPNSDSLNLAAAGIDTDNRGFIKVNQTVQTNHPHIYGVGDVNGKGAFTHTS
    VNDGEIFWDHYSRLMGLNDEAPELDRTLSMRDTTYSMFIDPPLARVGISEKEARQSSRSVLMATLPMSRISRAKEKQETK
    GVVKIFVDAESEEILGATVFGTGGDEIIGVFAPFMQSKASYKTFRRAVFPHPTVGELLPWALDDLTQLK

    >gi|170726832|ref|YP_001760858.1| thioredoxin reductase [Shewanella woodyi ATCC 51908]
    MSQARHCELLILGSGPAGYTAAVYAARANLKPVLITGIQQGGQLTTTTEVENWPGDAEDLTGPALMERMQKHAEKFETEI
    IFDHINEVDLQVRPFKLKGDNGEFTCDALIISTGASAMYLGLDSEEEFKGKGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILTKRLMDKVANGNITLHLDNTLDEVVGDQMGVTGLKMKSTKDGAIKDLEVMGVF
    VAIGHKPNTQMFEGQLEMNNGYIKVQSGLDGNATQASIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDAKNS

    >gi|170726902|ref|YP_001760928.1| electron transport complex, RnfABCDGE type, A subunit [Shewanella woodyi ATCC 51908]
    MSEYLLLLVSTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFELGYLRTMSFILV
    IAVVVQFTEMVVQKTSASLYRALGIYLPLITTN
    CAVLGVALLNINEKHGFVESAIYGFGAAVGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVN

    >gi|170726907|ref|YP_001760933.1| electron transport complex, RnfABCDGE type, E subunit [Shewanella woodyi ATCC 51908]
    MNEYKQIALQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNVLVSLVKSLVPKEIRIPIFVMIIAALV
    TCVQLLVNAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVVKSAFDGFMMGLGFLLVLSVLGASREILSQGTLFAG
    ADLLLGDWAADLTIHFWQLDTSFLLAMLPPGAFIAMGFLIAFKNIIDKKLADRAPTPDTVEVVTRARVTKVS

    >gi|170726936|ref|YP_001760962.1| UBA/THIF-type NAD/FAD binding protein [Shewanella woodyi ATCC 51908]
    MPLCDSDFMRYSRQVLLPEVGEHGQLALKSAKVLLVGVGGLGQLAAQYLAACGVGKLILADDDRVEVSNLPRQLLFDDDD
    IGEYKSKCASLKLMQRKPTCEVQSITQRLSTKNINRYIEGVNLVLDCSDNLPTRHTVNQACIETHTPLVTASVSHFSGFL
    FAVDMQRASEAGCYHCLFPHDTQVTQN
    CSTAGVLGPMVGTLASMQSLMAMNILLGVGKPFGKLLRFDGLKFSWYEAQLSQ
    DPACPVCRNHIQTRQYNARCLEEN

    >gi|170726990|ref|YP_001761016.1| hypothetical protein Swoo_2644 [Shewanella woodyi ATCC 51908]
    MTSKMNSKPKLYYIYDPMCSWCWGYAPTWHKLKNALEESGITVKYKLGGLAPDSDEPMPEEMQVFLEQTWHKISAQLGTV
    FNYDFWQQCQPRRSTYPACRAALIAREHNLEQAMLQGIQTAYYLEAKNPSDLETLTDIAISIGLGSTEFIKQMHNEKLNQ
    KLMSEIASTRQLPIQGFPSLVLVHDNQVRPIQVDYQNWQASYQDIINDV

    >gi|170727036|ref|YP_001761062.1| disulphide bond formation protein DsbB [Shewanella woodyi ATCC 51908]
    MNPVTQFAQSRLAWLILAGTALGLELCALFFQYVMKLDPCVMCIYQRLAIFGILAAGLIGIIGHKNRFMRLIAILGWSVS
    AAWGLKLALELVDMQTNPSPFST
    CSFLPEFPTWMPLHEWIPSLFMPTGMCNDIPWEMFGITMGQWMIGAFTAYLIALAVF
    AIPALSKTR

    >gi|170727072|ref|YP_001761098.1| GrxA family glutaredoxin [Shewanella woodyi ATCC 51908]
    MFVVIFGRPGCPYCVRAVQLSEQLTEARSDFKFKYVDIHAEGISKADLEKTVGKPVETVPQIFVDKEHVGGCTEFEQYVR
    DNQLLATAV

    >gi|170727086|ref|YP_001761112.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MSVLVGRPAPDFTAAAVLGNGEIVDSFNLAEAIKGKPTVVFFYPLDFTFVCPSELIAFDHRIEEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVAEGGIGPVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMDASPEGVASYLNDNADTL

    >gi|170727103|ref|YP_001761129.1| glutaredoxin [Shewanella woodyi ATCC 51908]
    MFIVRWFLGRIILLLNFIFTPKKRKRPQDEQTMIDAATEQLALYQYKACPFCVKVRRAMRRQSLNIATLDAKQDPHKSTL
    VSEGGQAKVPCLRIEENGEIRWMYESSDIINYLDKRFA

    >gi|170727186|ref|YP_001761212.1| DSBA oxidoreductase [Shewanella woodyi ATCC 51908]
    MRLITNPLMALLLLFTALLSMNVDANPYVEGVDYTQVSGIPESSTPVVREFFSYNCPHCYRQDPLFEETEALLKGKVEFA
    RTPIGAGRTSWILSQEAYYLAEKFKMASQLHGNIFKRIHEKEGAFTRKEQLVEYFVKQGVKREDVDKAMSSADASLAISN
    YDAQAQLAGIRGVPSLLVNGKYLISSKHRTAEELAELVTYLSGLEDKP

    >gi|170727335|ref|YP_001761361.1| hypothetical protein Swoo_2995 [Shewanella woodyi ATCC 51908]
    MKRLQQRVLLLFFCAIFSTHYAHATSLALNKSQLASIKQQNMGKRWLMLLWSVDCPPCFKELTTVQQLKQKYPQINVVLV
    NTDANDEAIVEHLEIIQEYQLTDLTNFHFAVDQGDQSRFLIDPHWYGELPRSYFVTNNGEFHGKSGVISQSILARWLIE

    >gi|170727341|ref|YP_001761367.1| redoxin domain-containing protein [Shewanella woodyi ATCC 51908]
    MLKRVQQLHIQGLILIGMMTISGLLTVNAEPLTVETLAPDFSLSRIDGSQFNLSDFRGEKSVYLIFWNTWCGHCMKKVPK
    LVEIQSELGEQVELLAINTSWSDTLGEIEQFKARFNPNYAIAFDFDADITRRYGVIGTPTGFLIDINGVIKQIDGIAHTL
    AANLDLWNTIKPARDHRTFGVTCQEHTQGSHKETAC

    >gi|170727343|ref|YP_001761369.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MKLEKLNTAGVGLLSKLWGWGKQLALFILFAIVITAVMDIWRGRDIPRDNLPDIKGVSLTGSDIDIKAMSQDQAVLVYFW
    GTW
    CPVCNFVSPAVDTMANIYPVVSIAMNSGSDDKMSQYLSHKGYEFETINDNNNEIARDWSVQLTPTLMVFKDGELIHY
    TTGFTSLPGMWWRMLLN

    >gi|170727344|ref|YP_001761370.1| DSBA oxidoreductase [Shewanella woodyi ATCC 51908]
    MLFSNKTVSKYKIKMISAIATALLISLVQISWVNLAHAELESLTAQQQADVKAIIKDALINDPELLKEAIIALQTREQQG
    ADAARQSALNSHKQALFETKTDPWKGASDPEITMVYFTDFN
    CPYCKKLEPSLDKLVKEFPQLKIIIKMVPLQGEASEEAV
    ALAQTVWLNEPSKYLKLKEVLMSSPRKLDSESIAKVAKLTGTEIWLNNTDKTVNQQVKDNVNLMMALGLRGTPAMIFGDK
    VIPGLVTYEVLKEQLEEAIEAQE

    >gi|170727345|ref|YP_001761371.1| cytochrome c biogenesis protein transmembrane region [Shewanella woodyi ATCC 51908]
    MIFGFWLLLLSSSVFAQSTGWIENPNHPPVKIRFMLTGEFDPVSKTLPAVLEVKLEDDWKTYWRSPGEGGIAPSIKWDDS
    SNLNHVDWSWPVPEQFSLLGLQTLGYKGDVVFPLFLTLDDVNADTHLNGKVRLSSCTTICVLTDYQIELDFNFDTLKSDP
    EAMFAYNKAVSKVPVKLDEDESASFIDLGWDSAKSQLQIVLKDSQWQRPEIMIDGEPDTVFKLGSLNRVEGDNGSQQWVA
    TFNGESWLGEPELLGKALNITVVDAQRALEYSAPVVETLIVGSSSSIWTMMLFALLGGLILNVMPCVLPVLGMKLSAIVA
    TPNLERRQIRQQFLASALGILVSFWLLAGFILVLKFTGQAIGWGVQFQNPWFIGFMALVTSIFALNMLGAFEINLPSSFQ
    TKLATTGGNDNRGHFLQGMFATLLATPCSAPFLGTAVAFAFGAPVAGLVVIFTALALGMALPWLLVAAFPQVARYFPKPG
    RWMNIVKLLFSGMLLITSLWLISLLTSFISATYLWGLGAALIFIFMFIMAKKYGLPALIATFSIGLILVVVAAFMTSENW
    ARPLPTDLHWTALNEELIAKQVAEGKTVFVDVTADW
    CITCKANKVGVVLQDPVYSLLKQDNIVTMKGDWTTPSAEITDYL
    QSHNRFGVPFNVVYGPKAPKGIELPVILSAKEVVAAIERASGT

    >gi|170727380|ref|YP_001761406.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MNIINKGFKVSSYFIVTLLLLLSISQSSLAADKNPQTAWSKIDAGALVVDVRTAQEFASGHLDNAINIPFEAIAEGLNKL
    NIDKEREIVLY
    CRSGRRSGIANDTLIEKGYTNTYNGGGYKMLSNHKKQ

    >gi|170727531|ref|YP_001761557.1| copper-translocating P-type ATPase [Shewanella woodyi ATCC 51908]
    MNSITLYVPTMNCASCVAKIERAFSALEQKKSAINARVNLADKQVIVEGEICAQLAIETIASVGYASEQIQDVKRAAQVK
    AKEEACEYRTRIIQSLLGLGLGIPMMIWGLLGGEMMVNSPAQQFGWGVMGVITLLLLVTTGGHFYKGMWRSLKVGSANMD
    TLIVLGTSSAWLYSMVVVLLPDAFPPSARHVYFEASVMILGLINLGHALELSAKGKTSEAVQRLVGLQSTTATKITDTGD
    IEVEIAEIKLGDRLRLKPGGRVALDGEVIEGSSTINESMLTGEPLPVNKVTGDLLSAGTVNGNGTIIYQVTAGLGDTRLS
    KIIDLVQQAQTSKLPIGRLTDKISAYFVPAVVLIAMIASSIWYLSGPAPQLSHALIVLTSVLIIACPCALGLATPMSIMV
    SVGRAAQMGVLIKNGEALQLASKVTCVVLDKTGTITQGKPSVTDVMIISKSGATSEVDDKDLALQQLFTRVASLERYSEH
    PLASAVLEEAKVRELVLFEPESFTNVQGKGILGVVDGCSLAVGNRSLMQNEGVSGLDRFDAEISQFSAQAKTPVYIAENG
    QLSMIIAVTDPIKADAKAAMTALLQSGKRVVLLSGDNIRTAKAVATQVGIKEVIAEVLPEQKQAHIIALQAEGEVVAMVG
    DGINDAPALVSADVGIAMGDGTQVAIESADLTFLSGRLSVLADTFSLARVSMRNIKQNLFGAFIYNSLGIPIAAGVLFPF
    TGLLLSPVIAGGAMALSSLTVVTNANRLRYVKLNSSTPEV

    >gi|170727558|ref|YP_001761584.1| glutathione S-transferase domain-containing protein [Shewanella woodyi ATCC 51908]
    MPLPILYSLQHCPYAMRARMGLLLANQRVLLLAIVMKNKPQAMLEISPKGTVPVLIVEDSNTTEVIDESLDIMLWALKRD
    DPHELLYPQTPETLPQMLELIEYNDKVFKPLLEQYKSAKRYHKDSELYDRSQCEVFIKQLELKLNQHQFIMGDTLSLADY
    ALLPFVRQFARADRHKYLAAPYPKLQHWLKAHLDSPLFSKAMAKYSLWLDSGEEHLFGEK

    >gi|170727570|ref|YP_001761596.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MRLLKSALLFILFAGNLQAAEVLNVAPNFNLADPQGKMHTLAEYKGKPMIIHFWATWCPYCKKLQPGLESLRKEYANTDL
    QILGISFNEDEGAMPAETLKKRGIGFPTLINGESAAKSYGVPGTPTTVFINRGGEIVWVTNISDPNDPNLNAATEFILKN


    >gi|170727738|ref|YP_001761764.1| NADH:ubiquinone oxidoreductase, subunit E [Shewanella woodyi ATCC 51908]
    MEHYINLFIQAAFIDNMALSFFMGMCTFLAVSKKVSTSFGLGIAVIVVMTIAVPINQVIYANVLAPGALAWAGYPELNLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYSLGESAVFAMGSGVGWAMAIVM
    LAGLRERMKFHAIPEGLQGIGIVFITTGLMALGFMAFSGISI

    >gi|170727739|ref|YP_001761765.1| NADH:ubiquinone oxidoreductase, subunit D [Shewanella woodyi ATCC 51908]
    MSTHTLSTRDILTNPVFTNNPVAMQVLGVCSALAVSNSLQTALVMTLAVTFVLVFSNLIISSIRRLIPNSVRIIAQMTVI
    ASLVIIVDMVLQDVAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKNPPHLAVVDAFGNAIGYGVILLGVAFVRELLGSGT
    LFGHEVLQTVENGGWYLANEMFKLPPSAFFLIGLMIWSINVIQRKRG

    >gi|170727784|ref|YP_001761810.1| glutathione peroxidase [Shewanella woodyi ATCC 51908]
    MTTKIWDFTVNDIQGAESSLTDFKGKVLLIVNTASGCGFTPQYQGLQSLYEKFGPDKFAVLGFPCNQFGAQESGSNSEIQ
    SFCELNFNVSFPMFQKIEVNGEDAHPLYQYLKSSAKGILGSQRIKWNFTKFLVDSDGKVLERFAPTTKPEALTKKIEELL
    K

    >gi|170727946|ref|YP_001761972.1| NADH:ubiquinone oxidoreductase, subunit E [Shewanella woodyi ATCC 51908]
    MEHYISLLIRSIFIENMALSFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPVNQIIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMVLDKFFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLAESMVFGVGSGLGFALAIVL
    LAGIREKLKYADVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|170727947|ref|YP_001761973.1| NADH:ubiquinone oxidoreductase, subunit D [Shewanella woodyi ATCC 51908]
    MANAKELKQVLSGPIVSNNPIALQVLGVCSALAVTSKMETALVMTIALTAVCACSNLFISMLRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVGFVRELFGNGSL
    FGVEILSKISDGGWYQPNGLLLLPPSAFFLIGTLIWIIRTVKPEQVEAKG

    >gi|170728175|ref|YP_001762201.1| OsmC family protein [Shewanella woodyi ATCC 51908]
    MNNLPLNGIKLDDLAAYTQVITDNPAEAISEYGIVAQWKGGVHSEIRTLNQKVGGKEIVKDFRFQVGEPEELLGNNAYPT
    PQDYLLGGMAG
    CMMVGFVAGASARGIKLDEVSLTIKGALNLRGFLNVDPDAPVGFAEVKFHFEVKGDSTQAVYDEVIAGV
    QQFSPNYRTISDAVKVSATAV

    >gi|170728255|ref|YP_001762281.1| hypothetical protein Swoo_3928 [Shewanella woodyi ATCC 51908]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDIPTENIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISEKDRQGILRSIERCTVKKVVQTGPEFKIETVENLDADANAMLMGQGDSDANTYILGKDLPLE
    QTISNMTGILADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNCNFFYNDQFFGEE
    IANSEFVHYPNEKWFELTDDDSLPAGMLDEYCLEIYNPDGELAGSNLIDTNSGNIDRGICTIPYTRHSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAQVQCLSEIFERAVKRQIIEQEIVLPDVPQTVLEKYPSILAGIKGLEEQGFPIVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVISWRF
    FSSNAEFEFCEWDFSGTNQEEADSLFGILADLGKEVYTAEFNDLGASACRMLVPDFSEVYPVDDLIWDNTNKSLEYREDI
    LNLHSLSDDELVDLVNRLEESQQDNYTDIRTMIGIVFDENTVWGQLTIIELKILIYLALGAHEEAIELVGDFLQFNDNTV
    ERGLFYQAVNAVLEVTLDETLELEHFINNFNRMFGIDVMQNVVGSVNGDVRFYGLTKTSMALEGIEPHLRLIESYKKLHS
    ARAKSAAE

    >gi|170728402|ref|YP_001762428.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella woodyi ATCC 51908]
    MKKLLIIGGVAGGASAAARARRLNEEAEIIMFERGEFVSFANCGLPYHISGEIPERSALILQTPASFKSRFNVDVRVQQE
    VIAIDKVAKTLLVKNLITGEQYSESYDALLLSPGAAPITPPIPGLNTPLTFSLRNIPDMDRILASVKQSRPRHVTVVGGG
    FIGLEMMESFHALNIEVTLLELSNQVMAPVDIEMANMLHSEILAKGIDLRLNTGLASVEQTSSGLSLFLSNGESLDTELL
    ICAIGVKPETRLAVDAGLVIGELGGIIVDEMMRTSDADIYAVGDAVEEFDLLTGEKCLVPLAGPANRQGRIAANNIFGGS
    ASYKKTQGTAICRVFDLAIASTGLSEKRLAKTEIPFDKVYLHGASHASYFPGAHPISLKLLFNTDNGKILGAQALGRDGV
    DKRIDVLAVAIRAGLTVYDLQEMELTYAPPYGSAKDLLNQAGFVATNSLKGETCLCHSADIDARDDSQVLLDVRNPGELL
    KAGSIAGAINIPLDQLRERLNELPRDREVLVF
    CQVGLRGHVAYRMLVNHGFKVRNLSGGFKTYQAVTA

    >gi|170728424|ref|YP_001762450.1| glutaredoxin [Shewanella woodyi ATCC 51908]
    MKSLIKTLLVYTFLFLMGTSAGYGVVLAYNKLSEPEVVLIGNYNHHFEGTDKKVIMYGTDWCPVCERAREFFNNEGISYK
    EVNPEKDESVFKLYSQLGASGYPIIVIGNKRVFGLDTKEIKVALTEI

    >gi|170728428|ref|YP_001762454.1| OsmC family protein [Shewanella woodyi ATCC 51908]
    MKEKIEFPSNGITLAGLLERPEGEVGAYALFAHCFTCGKDIAAASRISRALVQKGIAVLRFDFTGLGNSDGDFANTNFSS
    NLDDLKAAADFLREQYDAPQLLIGHSLGGSAVLAIANDIPECKAVVTIAAPANAEHVVHNFSSAIDEINSQGLAAVNLGP
    RQFTIKKHFLEDLDHHAKQAFSLDKKALLVMHSPVDDAVSIAQAEKIYTQAKHPKSFVSLDTADHLLTSKADADYVASVV
    ASWSGRYLDFSIAAKRAHKVTEGHLRVEEKDHKFTQTIISDSHVWLADEPLKVGGKNLGPDPYEHLLAALGA
    CTSMTMRM
    YADRKKWPLEDIKIDLSHSRTYIKDCEDCETGNTQLDTLSREIELVGALTEEQRQSLLTISEKCPVHKTLHSKLKVTTEL
    KE

    >gi|170728483|ref|YP_001762509.1| protein-disulfide reductase [Shewanella woodyi ATCC 51908]
    MKKIITLALSLVLTSSLLLLTPLAHSEGVFSNSKFSFLKDEPKLMPVDEAFVFDFKQEGEQLKISWVIADGYYMYRDKLK
    FEAEGALLGEIALPKGKEHNDEYFGEQEVYYSFVEFPIAIKEASDQSNVTITFMGCAEGKLCFPPTKKQALLSAVPLNDG
    LLKDKVQELSTPEASSKTVTEPITQQDSLSQMLSGDSLLWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGKKLSTAK
    AFSLSMVYVQGMAITYSLLGLVVASAGMKYQAALQHPAVLIVLAILFFVLSLSMFGLYELKLPSSWQEKMNSFSNNQKGG
    NVIGVFLMGIISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGSWMDIIKTIF
    GFLLIAVSVVMIGRIWPGLISDILWSIWGVALIGYLMHQNKLTEFNWKQSTRSVLLTLGLLASFSYGFQAVMSELGLQNH
    SQGEQTQLHGHKPIKSIADLEAEVSAAAAQGKPVMLDLYADW
    CVACKEFEAITFKDPEVQKRLSQIVFLQADVTKNDMTD
    IELLEHYDVLGLPTLLMFDSSGELSDELRVTGFMKPEAFAKHLDLLLAK

    >gi|170728756|ref|YP_001762782.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MKWISALNILLITLLMVGCTSSPTKLTQHNSSEYQTFVKVGEQVPVTQFIDTQGEKIDLTQSHNAKLLILFATWCSDSQR
    AMKALKSSDLNLDPNIDIIGIGREESNETLDKFADEYELNFPLIADNDRSIYAKFANAGIPRFILLDKENQIVKTIIAED
    DNPLTQLQW

    >gi|170728776|ref|YP_001762802.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MMKKALGQILVTLTLIASSASCLAGGGSEMAPAHRYEHQLNTISMMEAQTLVGKEGVYFFDVNTLELWAEGFIPGAVYFN
    VKDWKKLLPANKDAVMVFYCANRL
    CNASEIAAHAVMKLGYTGVRQMPDGIYGWRLANRPTEKP

    >gi|170728796|ref|YP_001762822.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MNRVLGSVVFTILLSMLSAVSYAGGGQEMGPAKYYDEPLNTITMMEAQTLVGKEGVYFFDVNTLELWAEGFIPGAVYFNV
    KNWKDLLPKNKDAQMIFY
    CANRLCNASEIAARHVMKLGYTGVRQMPDGIYGWRLANRVTEKP

    >gi|170728800|ref|YP_001762826.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MNKTHLLSWLFVVSSLLMPAQAQVASNKVYNTGKAIEKPLIMSRFIEMSSAREVPDVNFKDTQGGSIQLKEFKGKLVMVN
    LWATW
    CAPCIKEIPQMENIRQVNKDNKLVVVPISIDEESDKVQAFLERHNFGHYKTWLDPNKDIDRVMPADVVPATYFFD
    GSGNLVGFLRGYLDWGDKEVQPYLEKLIAKYAHR

    >gi|170728972|ref|YP_001762998.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella woodyi ATCC 51908]
    MKLIADLLKVSLLVASCFSISTVSAYPGMQKQAEGESQTNVGLISILPQPFPITAVPFKDEQGKAVDFSQYKGKVLMVNM
    WATW
    CPPCVRELPAISRLSEKFDKQDFEILPISIDLEGKGKVEPFLKELGMESFNSFYDETQNLREVFPLDTIPATFILN
    SKGELIAFVRTFVDWDDKQAADLIQGFIDKQ

    >gi|170728974|ref|YP_001763000.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella woodyi ATCC 51908]
    MKKRLVLFIPLVLFLVMGVFLYKGLFLNPQKLDSALEGKPVPAFQLERLEDRNEIITNESLKGEVALLNVWATWCPSCKY
    EHPYLMRFARQGILPIYGINYRDERPLAIRELNREGDPYTKNIFDHDGRLGLDLGVYGAPESYLIDHNGIIRYRYAGPID
    QRIWSETLLPMIKELQAAAKLDGAS

    >gi|170729032|ref|YP_001763058.1| selenide, water dikinase [Shewanella woodyi ATCC 51908]
    MDFVPMLQSEIKLTEYSHGAGCGCKISPKVLSTILASQLPLFEDPNILVGNQTRDDAAVYKLNDETGIISTTDFFMPIVD
    DPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPINTLPAEVAQQVVDGGRQACADAGIMLAGGHSIDSPEPIFGLAVSG
    QIPLSELKQNDTAKSGDKLYLTKPLGIGILTTAQKQKKIAPEDTQIAVDAMCQLNKVGALAAKISGVNAMTDVTGFGLAG
    HLIEMCQGAKLNAQISVPTLPLLPKAEKYLELGCIPGGTHRNFESYCEHLPQLTDIEKAIICDPQTSGGLLLSVSSDAEA
    ELTALLKTHGITANCIGTLTHSEQPTLVELI

    >gi|170729088|ref|YP_001763114.1| molybdopterin synthase sulfurylase MoeB [Shewanella woodyi ATCC 51908]
    MSSTTDIDEILSDSEILRYSRHISIKAMDFEGQEKLKLAKVLVIGAGGLGCASTQYLAVAGIGSMTLVDFDTVELSNLQR
    QVLHQDKNIGQPKVESAKETLSELNPHLQIETINAVLDDHEFDALITQHTLVMDCTDNVAVREQLNKSCFAHKVPLISAA
    AIRMEGTVTVFDYQGETPCYHCFSKLFGEQHLT
    CVESGILAPVVGMIGCLQAVEAIKVISGIGKPLIGRILMIDAMTMEF
    REMKLSKQASCKVCGS

    >gi|170729194|ref|YP_001763220.1| rhodanese domain-containing protein [Shewanella woodyi ATCC 51908]
    MQEYIEFLKANPMLSLAWIGLFIGLIVSVFKSSVSKVTTVDHQQATLLINKQDAKVIDVREKAEFKKGHIIDAINVPLSE
    IKNNQISALEKFKASPIIMV
    CNAGMVSSQAAQLMVKAGFESVNNLKGGMGDWQSNNLPVTKSKK

    >gi|170725294|ref|YP_001759320.1| hypothetical protein Swoo_0932 [Shewanella woodyi ATCC 51908]
    MARIILLLIAFCLGAFSAPMTLASTAATSTVENAQSWHYIDEKGELKVKLYFFWSKTCPHCAEAHPFIDSLPERYPWIEL
    SSHMISAPGSMEKWQDIASQTGTKASSVPYMAMCENAVIGYSSEAVTGQYLVNQLKQCYQSLGGTLDPNDTFVASSAQGG
    DKPLFGTCSDGTAEDGNAGTCDLNTESQQTNTSSVQPVELPFLGVVAPEQLSLPLLTVVLAGVDAFNPCAFFVLLFLLSI
    MVNAKSRTRMLIVGGIFVFFSGFIYFLFMIAWLNIFELLGAGSDGGMIILGAGILALIAGVINIKDYFFTKGEVTLSMSA
    ENRTGLIKRMGKLTSASSMAAMIAGTVVLSILANAYELLCTAGFPMIYTSVLAMHELPDLERYMYLAFYNIVYVIPLAII
    VIAFSATLGKRKLTEKEGQTLKLMSGIMMIGLGGTLAMDPTALQNVALAIGLILSSILLTIVITITRKVLAKRS

    >gi|170727650|ref|YP_001761676.1| OsmC family protein [Shewanella woodyi ATCC 51908]
    MSFSVITQWNTQASIEGEFNRDHSVTFGSGQTVQASSAPEYKGNQERVNPEEQLLAALSSCHMLTFLTIAHLKRLPVQTY
    TDNASAILGKNAAGKIAIVKLVLKPEIVFQSGVDVSAEVLEKIHEKAHAN
    CFIANSLSSEIEVIYS