Shewanella violacea DSS12 uid47085

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294138862|ref|YP_003554840.1| thiosulfate sulfurtransferase glpE [Shewanella violacea DSS12]
    MSNFQHFSVNQLIQLAQTNSDIQIVDIRDATSFASGHVQGAVNLNNENLANYVAEADMDKPIIVICYHGISSQGAAQYLV
    EQGFDDVYSLDGGYQAWHEANA

    >gi|294138907|ref|YP_003554885.1| glutathione reductase [Shewanella violacea DSS12]
    MEIKMAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNVGCVPKKVMWYGAQVAEALHLYAKDYGFDVTV
    NKFDWSTLVDSREAYIDRIHGAYDRGLENNKVTLVRGYGRFVDQGTIEVDGEHYTADNILIATGGSPTIPNIPGAEHGID
    SDGFFALREQPKRVAVIGAGYIAVELAGVLHSLGSETHLFVRKHAPLRSFDPMLSEALMESMATDGPSLHINSTPQAVEK
    NADGSLTLKLENGESYEVDTLIWAIGRKPSTGNIGLENTQVKLNDKGYVIVDEQQNTTNPGIYCVGDIIQGGVELTPVAV
    KAGRLLSERLFNGMTDAKMDYKLIPTVVFSHPAIGTMGLSEPDAIAEYGKDNVTVYVSGFTSMYTAITAHRQACKMKLVC
    AGPEETVVGIHGLGYGMDEILQGFGVAMKMGATKKDFDSVVAIHPTGAEEFVTMR

    >gi|294138929|ref|YP_003554907.1| AhpC/TSA family antioxidant [Shewanella violacea DSS12]
    MTHNVAELFAGKKVVLFAVPGAFTPTCSESHLPGYVVLADQFQAKGIDIIACVSVNDAFVMKAWGQAQNASELMMLADGD
    ASFTKALGLEMDTAGFGGVRSQRYAMVIDNGVVTQLNVEAPKSFEVSKAEAVLAAL

    >gi|294139037|ref|YP_003555015.1| pyruvate dehydrogenase complex, E3 component, lipoamide dehydrogenase [Shewanella violacea DSS12]
    MSNEIKTQVVVLGSGPAGYSAAFRAADLGLETVIIERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKAVADHGVVFGEPK
    IDLDKLRGFKNSVISQLTSGLGGMSKMRKVDVVNGFGKFTGPNTIEVVGEDGVKVVHFEQAIIAAGSRPIELPFIPHSDP
    RVWNSTDALELKEVPGKLLIMGGGIIGLEMGTVYASLGSQIDVVEMLDQLIPAADKDIVRVYTKKVKNKFNLMMQTKVTA
    VEAKDDGIYVTMEGKKAPAEAVRYDAVLVAIGRAPNGKSIDAEKAGINVDERGFINVDKQMRTNVANIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETASFPWAASGRAIASDCSDGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKKK

    >gi|294139152|ref|YP_003555130.1| DSBA-like thioredoxin domain-containing protein [Shewanella violacea DSS12]
    MKKILIPILIALGVSGCDAGKLDITDLNQDQKDQLGQIASDYLIQHPEFLIKASEKLNQQKKAEMAQHSTETAKAMVKQL
    TQDEKTPFIGPKDAKVSVIEFFDYQ
    CVFCAKITPIVNQLIQDNSDVKFVFKETPIFAQRWESSLYAAKMGQWIFEQKGSE
    AYASYHDNLFATGKNEGKLTKEDIDKQAQSAGVQVADFKMSELKADGINENFQLFSELGFQGTPALIVMPTSNPSIENIK
    IIGGFDPEGLKAAIAAIKKNIS

    >gi|294139354|ref|YP_003555332.1| bacterioferritin comigratory protein [Shewanella violacea DSS12]
    MATDLKVGDTAPNFRLQSTDGNFYQLSDYLGKQTLVLAWYPMANTRGCTLECRSLVQKGHLIREYNAVYMMASVDDLEDN
    QDFAKKQKADFPMLSDPTKEIAKAYDVLNFVRVASRVTFYIGKDGKIIKIDEDINAPTAAEDIAANLEQLGIEKSD

    >gi|294139383|ref|YP_003555361.1| hypothetical protein SVI_0612 [Shewanella violacea DSS12]
    MSSVKIDLGLSFDNSYAKKLEGFYADCQGAKAPQPELVKLNTSLAHSIGLSNTNPGQLAEVLSGSQSPIGASPLAQVYAG
    HQFGGFSPQLGDGRALLLGEVLDKDGNRVDVQLKGSGRTPFSRGGDGKAALGAVLREYVVSEAMFALKIPTTRALAVVTT
    GEQIMRTQELPGAVLTRVAASHIRVGTFQYFSSRGEQDKVKQLADYAIERHYPQLKISQQPYLDFLCAVCDKQAELVARW
    LLVGFVHGVMNTDNMTICGETIDYGPCAFMDDYDPQAVFSSIDRDGRYAYNNQPVLAQWNLARLAETLLPLISDDEAVAV
    AKATQAVTEFMDVYQGYWLTGMRAKLGISNEEEGDLALCEQLLESMVGQEVDFTQMFRQLARDLEGQSHGSDQLFNDADR
    FIQWRESWMARLSRASLPMSECVAMMDGVNPMYIPRNHQLEYAIEAAEQRADYQPFEQLIGILANPYTPQDGAEEYAKPA
    PASFGRFTSY
    CGT

    >gi|294139434|ref|YP_003555412.1| hypothetical protein SVI_0663 [Shewanella violacea DSS12]
    MDTSLVAALLGGMLIGLSAIALMIFNGRIAGISGILSRALFRTDAESGSGKAAAWQWYFLFGIIFSGVIYAQFSISMGAP
    QFEFNQVSTPLLCFAGLLVGLGNQLGSG
    CTSGHGICGIGRFSLRSIIATCVFMLTGVISAVLLH

    >gi|294139501|ref|YP_003555479.1| thiol:disulfide interchange protein DsbC [Shewanella violacea DSS12]
    MVLAPFAMATSNTTSDTIANSAKLKQKLSDALNVEVHSLSQSPIPGLYEALTDRGVLYISKDGTKLLHGSLYDLDNGMKN
    LTEAAMAGPRIEMMKPLEDHMLVYKAKNEKHVVTIFTDIS
    CGYCRKLHNQMAEYNDLGITIRYLAFPRRGVPSANADEME
    AVWCAADPLKAMTEAKAGKSVKHKQCDAKIAEQYNLGQSFGINGTPAIILEDGSMIPGYQPPKELLRALEAIN

    >gi|294139507|ref|YP_003555485.1| hypothetical protein SVI_0736 [Shewanella violacea DSS12]
    MMIMKNLSMNKSAARTKAYLALALILLAVFFRAEAGESPVLLLENIKTFDGQSLVLQDSKLTHLIFQDIWSSYEGQGEEA
    RIAALPKAFVKNSQQVWVQPEINVTESQLAEFQRYYPQVKPLVLDRGYRLMRSQGGWSLPLHVILKDGKKVFSGSGEEFD
    ALASKHFSTQVALNQWLQLRTDDLPSMLVTGAEKSKSVSFTINEAAKPGYHKPEKGDRAPVFIAKTMAGNTVSLLGLSNN
    KPLSLVFLDSL
    CPMPHFPGCEAQIEQLSHLVTKDDSREWLGVVSSFYVDEKIVQQFRDKFQLKLPLIFDTDNQIYQSYGV
    HASPYQIDISRDGNIRSRGSEVH

    >gi|294139508|ref|YP_003555486.1| thioredoxin family protein [Shewanella violacea DSS12]
    MMRILNKTPIGSGRRLRLAVSFLLLGAAMQVGAASLTVGDKAPNFEVTTLAGETFKLSDYKGKKPVYLKFWATWCSYCKV
    EMPHLQSIYNKYGDDVEVLAVNVGINDSVANIQQFFNRGGFNLPTVIDRQGDLTSRYGIVGTPHHVLIDKEGEIAYRTFL
    ATDTLDEMVEEWAEEKQILNRRPWKR

    >gi|294139671|ref|YP_003555649.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
    MTEADDALPIRFTDAAALKVKTLMDEEENDALKLRVYVTGGGCSGFQYGFTFDEKINEGDFTVEKQGVQLVVDPMSLQYL
    VGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|294139855|ref|YP_003555833.1| glutathione peroxidase [Shewanella violacea DSS12]
    MTSIYDFSVNDIQGKPLSLSEYKDKVILIVNTASACGFTPQYKGLQALYEKYGPDNFVILGFPCNQFGAQETGNESEISS
    FCELNFGVSFPLFEKIEVNGPEAHPLYEYLKSEAKGILGSQGIKWNFTKFLVDSQGKVLTRFGSTTKPEAIDKEINSLLD


    >gi|294139880|ref|YP_003555858.1| hypothetical protein SVI_1109 [Shewanella violacea DSS12]
    MFKKWAVIVSLVFTTLSPSAFGYQQGELLSSKAQQELGLNPNELTIIDFFAQWCVSCREELPEVETLSRQLAGRGVSIVG
    VDVDEEVEVGLAFQRELGLTFRVVADPQQVLVTDFQPTGMPALYYVYQGKVLKVRFGAINNIRQVIIDDIRSLDLAE

    >gi|294139896|ref|YP_003555874.1| thiamine biosynthesis protein ThiI [Shewanella violacea DSS12]
    MKFIVKLFPEIMMKSKPVRMRFTKMLETNIRNVLKKVDETAKVKREWDKIMVMVPSDRPDLIDAFGERLSCIPGIAHILQ
    VNESTFESMDDIYQQTLALYKDDLAGKTFCVRAKRVGNHDFKSIEVERYVGGGLNQFTEAKGVKLKNPDMTINLEIDREN
    LYLVVKRIPGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKRGSRTHYCFFNLGGDQHEIGVKQVAYHLWQKYGESHKVK
    FISVPFDPVVTEILEKIDNGQMGVILKRMMMRAATKIANKMGIQALVTGEAMGQVSSQTLTNLNVIDRCTEQLILRPLIA
    MDKQDIINLSRVIGTEDLSKSIPEYCGVISQKPTVKAVLAKIEAEELKFSEDLIERVIDAAVIIDIREIAKSVDEQIAQT
    KTVNSVDSSEVIIDVRSPEEEERAPLKVDGVEIKTIPFFRLSTQFADLAKDKTYLLY
    CDRGVMSKLQALYLQEQGYENVK
    VYRP

    >gi|294139952|ref|YP_003555930.1| carboxymuconolactone decarboxylase family protein [Shewanella violacea DSS12]
    MTKRIDIAKTQPAALTAMMSVENYLAETKLSSTLKELIKIRASMINQCAYCIQMHTQEALKAGISPQKLFAVSAWKESPL
    FDATERAVLALTDELTHVSQAGLTDSTYQAGLELLGEDQIAQVIMQVIMINAWNRFAIATKMKH

    >gi|294140044|ref|YP_003556022.1| thioredoxin family protein [Shewanella violacea DSS12]
    MKFGIKAFGLATVLLTILGLITFVFINPEVNSLEFSEDVKLAPKFALVDPQGKVHQWSEYKGKPIIIHFWATWCPYCKKL
    QPGLDKLRVDYSDSDLQILGISFNEDEGADPALTLMERGIQFPTLVQGESAAKAYGVAGTPTTVFINRRGEIVWLTNISD
    PNSQKLKDATEFILQD

    >gi|294140105|ref|YP_003556083.1| organic hydroperoxide resistance protein [Shewanella violacea DSS12]
    MKAIYQTKATASAGRNGKVATDDGKLNLSLSYPKEMGGSGESTNPEQLFAAGYSACFSNAILHVARETKLTLSQAPVTAT
    VAIGVREEGGFGLSVALSVTLELAQEQAEQLVKSAHQV
    CPYSNAVRGNIDVALTVNDHKL

    >gi|294140316|ref|YP_003556294.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella violacea DSS12]
    MAKTVTTQLGEIYIKANQFGLSHLSLVAAKLEMSESTELNQQASTYLIQAERELKEYFAGQRQHFSVPLAPKGTEFQKAV
    WQALLALDYGTTCCYADIANQINRPKAVRAVGAANGANSIAIIIP
    CHRVIGKDGSLTGYAYGLEMKKSLLKLERCTDFKL
    V

    >gi|294140364|ref|YP_003556342.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
    MAISMTPAAADRVKSFLSNRGKGIGLRLGLKTSGCSGMVYVIEFVDDLNDDDEVYEVADVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|294140438|ref|YP_003556416.1| thiol:disulfide interchange protein DsbA [Shewanella violacea DSS12]
    MASLVISDESVAKDFVEGVDYVQVKGIPEAKSPVVREFFSYNCSHCYRQDPIFEEAVELLGDKIDFVRTPVGGGRSSWVL
    SQQAYYLAQKFKMTRQVHGNIFKRIHEKEGPFTRSAQLKEFFVQQGADASAVEQAMNSVDAKLAISHYDTQAQLAGIRGV
    PSLLVNGKYLIVSKSRTPEELADLVNYLSALKAAKKAS

    >gi|294140536|ref|YP_003556514.1| hypothetical protein SVI_1765 [Shewanella violacea DSS12]
    MFVVRWLLGRIILTLNFIFTPKKRKRPSDEQAKIDGETDLLTLYQYKACPFCVKVRRAMRRQGLNIATLDAKQDDHQQTL
    VEQGGKAKVPCLRIEENGETRWMYESSDIISYLDTRFA

    >gi|294140553|ref|YP_003556531.1| AhpC/TSA family antioxidant [Shewanella violacea DSS12]
    MRKNTAYNAIRFKTKSVFSIHRWRYKMSVLVGRQAPDFTAAAVLGNGEIVDSFNLAEAIKGKPTVVFFYPLDFTFVCPSE
    LIAFDHRIEEFKKRGVEVIGVSIDSQFTHNAWRNTPVAEGGIGPVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDK
    EGMVRHQVVNDLPLGRNVDEMLRMIDALQFHEEHGDVCPAGWEKGDKGMDASPEGVASYLSDNADSL

    >gi|294140566|ref|YP_003556544.1| glutaredoxin [Shewanella violacea DSS12]
    MFVVIFGRPGCPYCVRAVQLSEQLVEARDDFKFKYIDIHAEGISKADLEKTVGKPVETVPQIFIDKEHVGGCTEFEQYVR
    DNQLLSAPA

    >gi|294140656|ref|YP_003556634.1| glutaredoxin domain-containing protein [Shewanella violacea DSS12]
    MNLKYNRVKLLVYLCVELGIIMETNETVEKIKAQLAENPIIVYMKGSPKLPSCGFSSQVAQIMINCNAQFAFVDILQHPD
    IRTELPKYANWPTFPQLWIEGELIGGCDILTEMFQKGELQTLITETAAKYASEDEEKA

    >gi|294140663|ref|YP_003556641.1| arsenate reductase [Shewanella violacea DSS12]
    MTMVSIIHNPRCSKSRQTLALLEERDCEIQIVEYLKSPLKTNEIEALLAKLGLTARELMRTKETEYKEQDLANPNLSEQQ
    LIQAIVDTPKLLERPIVLANNKAAIGRPPENVLAIL

    >gi|294140686|ref|YP_003556664.1| bacterioferritin comigratory protein [Shewanella violacea DSS12]
    MNTLTAGDNAPLFELKNQNDKLISLKECLNIGPVLVYFYPKASTPGCTVQACGLRDSMQELNGLKVTVLGISPDPVPKLA
    RFAQKQELNFSLLSDEDHAIADAFGVWGEKKFMGKVYDGIHRLSFLVGQDGKISHLFNKFKTKDHHEVVLEHLKQD

    >gi|294140694|ref|YP_003556672.1| molybdenum cofactor biosynthesis protein [Shewanella violacea DSS12]
    MKMIIKIPSPLRRFTDNNKQIELDALTVKDALIELFKRYPDIKPQILDDTGNLRNFVNLYHNKVDIRQQEGLDTKLQSGS
    EIRIVPAIAGGSSLDTHMSANELSRYSRHILLPEIGVPGQQALKNASILIIGAGGLGCPLALYLAAAGVGHLGLVDDDVV
    EESNLQRQVLFSVDDIGQSKVDAAKRRLERLNPHINITSYPERLTADNALKIMDNYDIIIDGTDNFPTRYLVNDACVLLN
    KPNIYGSIFRFDGQTSVFNYQAGPCYRCLYPEPPPPGLVPS
    CAEGGVLGVLPSIIASIQATEAIKMITNIGDSLSGRLVL
    YDALALDFEFLLIKRDPACPICGENPTITQLMDYQAFCGLSQNTDEKSYKEIEAKELKAWMDREQSVILIDVREPFEREI
    CMLAGSQFIPMQDIDAHIPELDPNKELVFY
    CKMGGRSAKVCAKLTKLGFNKVTNLKGGILAWIDKVDQSLTRY

    >gi|294140705|ref|YP_003556683.1| arsenate reductase family protein [Shewanella violacea DSS12]
    MILYGIKNCDTVRKARKWLQANQAQVTFHDFREDGLDKDQLTSWVAMAGWETLFNKRSTSFRNLSDADKSDIDQDKAIEL
    MLAHPTLIKRPVLVAADKVQVGFKEAEYQAWFNL

    >gi|294140760|ref|YP_003556738.1| thioredoxin family protein [Shewanella violacea DSS12]
    MLLTSVQGIAQPSLDYEVQTREGESYSLSQYSGQVIYVDFWASWCGPCRKSFPWMNQMHHKYAAQGLKIIAINLDNDLSH
    ARQFLSQISADFTIAYDPNTQVAGEFDILGMPTSYLFDRKGQLVATHVGFFSEHKADYESEIVHYLKQAQPLQRKYK

    >gi|294140810|ref|YP_003556788.1| peptide methionine sulfoxide reductase [Shewanella violacea DSS12]
    MAVATFGAGCFWGVEFFFNQLAGVKQTTCGYMGGDNAANSYTQVKSGKTGHAEVVQVEYDDALVSFQDLLQVFWQNHNPT
    TLNRQGADIGSQYRSAIFFHDNLQKTLAEQSKQALALSGKWGKKQIVTEIAPVLEFNRAEEYHQHYLEKNNLPSCHISF

    >gi|294140884|ref|YP_003556862.1| hypothetical protein SVI_2113 [Shewanella violacea DSS12]
    MLLLTSIFLIASLGYLAQTTGLCLVRGVNEALTGKPIFLLSILTSGSLAWVSILIGDYAGIAIPFISYEYSFLALVGGLL
    FGIGAAFNSG
    CGVSTISKLARGQLVMFFTICGWLVGWLLLTTFVPQYQIAQYQLNSSWHIAILITVSFTIVLCTTRMSKE
    SRRLWLSMLGIGLTAGIVFLTEPKWTPSGLLKDISLSLWHQDSGLWPSDSRFLLIAALIIGMIVAAVHRKTFKFIPLNGK
    DCIRHLLAGCLMGIGAAIASGGNDSQLLLGLPSLSPAGITTIFSMLVGIALGRLITRV

    >gi|294140937|ref|YP_003556915.1| cation transport ATPase, E1-E2 family [Shewanella violacea DSS12]
    MKPLDCFHCGEPVLTDTQFTTCINDQQQAMCCPGCQAVSKAIIDAGLSKYYQFRTEPGNKQNAIVPEELNAFCAFDLVEV
    QEDFVHKVSDTSTVSLSIDGIT
    CAACAWLIEHKLKHVNGIIKIQVNSTTERALITWLPEQIKLSDILNKISAIGYQAAPY
    QVDEQELLSKKNSRQFLLKLGLAGFATMQVMMFALALYAGYFTDLELEFRDYFRWVSLIFAAPVVFYSALPFYFSAIRSI
    FSGRLNMDVSVSIAILGAYIASCIATINGNGEVYFESVSMFTFFLLLGRYFEQNARQKASVSSSNLHKLVPLTAHLITQI
    GSKDIPAKGLKVGDIILVKPGETVAADGVIIDGRSSLNEAMLTGEQMPVSKSLSCEVYAGTINIEQPIRVEVTAVGQDQL
    VAEIIRLQESASNNKPRVALYVDSISNYFTWTILVVAALTYLVWKIYWPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    GIFTRIGVIARTPGVFEKLTQVRHVVFDKTGTLTCGDLNIESTELIKATDETQVLAIAACLEASSLHPIAKAFESYRDPN
    FSVNQSLNHIGQGLSGEVNGHQYRIGSAAFVGASDIRNSKAQSIYLADESQILAKFILVDAIRCDAAATVKILKESGCRV
    SIASGDTSDHVEEVASKVGIKDVNKGLSPQGKLQLVRQYQTQSHVAMFGDGINDAPVLAGANLSIAMGSGAAVTKSSADL
    ILLGDKLSRYTDAVNVAKLTEKIIKQNLFWALGYNLFIIPLAVTGHVLPYVAALGMSASSLIVVGNSLRLLKVRL

    >gi|294141059|ref|YP_003557037.1| dsrE-related protein [Shewanella violacea DSS12]
    MKKLTIIFRRAPHGTAHGREALDLALLSASFEQEVSLIFVDEGVLHLITEQQPELAGAKDYIATFGALDLYDIETVLVCQ
    SSLERFGLADSELTFSVDRVTSASITAQLQAADEVLVF

    >gi|294141070|ref|YP_003557048.1| thioredoxin reductase [Shewanella violacea DSS12]
    MSQVRHCELLILGSGPAGYTAAVYAARANLKPVLITGIQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    IFDHINEVNLDVRPFRLKGDNGEFTCDALIISTGASAMYLGLDSEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILTKRLMDKVENGNIILHLDNTLDEVVGDQMGVTGLKMKSTKDGAISELELMGVF
    IAIGHSPNTGMFEGQLDMNHGYIKVQSGLNGNATQTSIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDALK

    >gi|294141106|ref|YP_003557084.1| electron transport complex protein rnfA [Shewanella violacea DSS12]
    MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASVLSYLVNQYLLLPFDLNYLRTMSFILV
    IAVVVQFTEMLVQKTSASLYRALGIYLPLITTN
    CAVLGVALLNINEKHNFLQSAVYGFGAAVGFSLVLILFSAMRERLAA
    ADVPLPFRGGAIAMITAGLMSLAFMGFTGLVK

    >gi|294141111|ref|YP_003557089.1| electron transport complex protein rnfE [Shewanella violacea DSS12]
    MNGSNVDTSNEPVVDITTDSKTSALSAYKEIAAQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLICSNILV
    SLVKDFVPKEIRIPVFVMIIAALVTSVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVAKSAFDGFMMSF
    GFLIVLAILGACREILGQGTLFDGADLLLGDWAAGLTVHLWHFETSFLLAMLPPGAFIGMGFLIALKNVIDKKIADKQPE
    VTVEVPVKRARITKVS

    >gi|294141140|ref|YP_003557118.1| thiF protein [Shewanella violacea DSS12]
    MSLSNSEFLRYSRQILLPDVGEIGQINLLQAHVAIVGIGGLGHLVAQYLAAAGVGHLTLIDDDKIELSNLPRQLLFSDKD
    IGEYKSKTAAHKLSNAYSACDLHAVTDKLAEHNRLDLLEHMDLVFDCTDDFSTRHLINLTCLQAKVPLITASVANFNGQL
    FMLDMESCPDSGCYACLFPEDSLVSQT
    CQSIGVLGPMVGVMASMQALLGMNILLGVPVPQGRLFRFDGRAMQWRESALSR
    DSDCHVCGGLMAQSRTESQIPDLTVISSGANQ

    >gi|294141234|ref|YP_003557212.1| disulfide bond formation protein B [Shewanella violacea DSS12]
    MNSMTRFAQSRLAWLVLAGTALGLELCALFFQHVMKLDPCVMCIYQRLAIFGILAAGLIGIVGHKNRFARLLAVLGWGIS
    AAWGLKLALELVDMQTNPSPFAT
    CSFLPEFPTWMPLHEWMPAIFMPTGMCSDIPWEMMGLTMGQYMIGAFAAYLIALVIF
    ITPALSATKQRPGFIADQPAL

    >gi|294141328|ref|YP_003557306.1| protein-methionine-S-oxide reductase, PilB family [Shewanella violacea DSS12]
    MRELTDFERHVIEEKGTERPFSGEYHLHDALGSYVCKRCDAPLYLSEHKFNAHCGWPAFDDEIKGAVKRVTDADGHRVEI
    VCAQCDAHLGHVFEGEYLTEKNTRH
    CVNSVSMVFKTNAVTDKPNKYQLATLGGGCFWCFEAIFTQLKGVTSVKSGYCGGD
    EASANYNAVCSGMTAHAEVVHIAFDPKIISFKDLLAVFWQSHDPTTLNQQGHDIGPQYRSVVFVHDEEQGDLANQVIEEL
    TRAQVWSKAIVTEISAFDTFYGAENVHNDYFEKNGEQAYCQMVVRPKVEKFRAIFADKLK

    >gi|294141351|ref|YP_003557329.1| mercaptopyruvate sulfurtransferase [Shewanella violacea DSS12]
    MKPCIKSPLVTGQWLEQYLNNDKLILLDASMEKVVGKSPLLYDTFSCIPGAKKLDLENELCDLTSSQTHAFPTAEQFVEI
    ISGLGITQASQVVIYDNQGIYSSPRAWWIFKVMGFDNVYVLDGGLPQWLAEGRATADCFSSTALADSMIAPGREFEANVQ
    DTWVCDSAYLLDKLSDKHLSILDARGAKRFSGEAAEPREGVRSGHIPKSVNLPFSQVLDGHCLKTTEALRQIFAGLTNEQ
    DTQRIFS
    CGSGITACILILASVEAGYQHNVLYDGSWAQWGRDHKLPIE

    >gi|294141360|ref|YP_003557338.1| glutathione S-transferase domain-containing protein [Shewanella violacea DSS12]
    MLIFIYFSSRSWFYSLSFFFSRLRITKIIIQKMNLTPMSLPTLYSFRRCPYAMRARLGILLSGTSVSLREIILKYKPEPM
    LAASPKGTVPVLILSDGRILEESLDIMHWALGQNDPHNLLLVGHTHLQEQAKTLIASNDTDFKPWLDKYKYADRFPENTQ
    EYYRQQGEKFIAQLECLLSQHEQILSDEPSIADYAIFPFIRQFSGVDKTWFNQAPYPNLQLWLAGHVEGASFTSIMKKYP
    TWLETSEEFIFGD

    >gi|294141690|ref|YP_003557668.1| phage shock protein E [Shewanella violacea DSS12]
    MKNLTSAAYRSMQNHSFMVMFALFSLLMSQLAFAADKDPEVAWDKINAGATVIDVRTAEEFAAGHLDNAINIPFEEIAVA
    INTLDIAKDTQIVLY
    CRSGRRSGIAFDTLVSEGYTQSYNGGGFETLSLFKQDNKQ

    >gi|294141864|ref|YP_003557842.1| copper-transporting P-type ATPase [Shewanella violacea DSS12]
    MMKNTNTNSMTLYVPQMNCATCVAKIEAAFEKLSQAGVDTKLVSQVSSRVSARVNLADKQVQIQGDISSELAIVTVASVG
    YDSELVLDAKLASEKKIQAERVEYRTRIIQSMLGLGLGVPMMLWGLFGGEMMVNNPSQQLAWGVMGIITLILLVTTGGHF
    YKGMWRALKARSANMDTLIVLGTSTAWAYSMLVVIMPYWFPAETRHVYFEASVMILGLINLGHALELRAKGKTSEAVQRL
    IGLQSTTAIRLTDTGDEEVEIAQIRVGDNLRLQPGSRVALDGEVLSGESNLNESMLTGEPIPVSKSIGDMLSAGTVNGNG
    SIIYRVTAGLTDTRLSKIIDLVQQAQTSKIPIGRLTDKISAYFVPVVVIIALVASMVWYLAGPAPQLSHALVVLTSVLII
    ACPCALGLATPMSIMVSVGRAAQMGVLIKNGEALQTASKVTCVVLDKTGTITSGKPRVTDILLLDSYYESCYESYDQSDD
    ESESCSSSEASASEQVLFLVASLEQHSEHPLAQAMLDFAKTREISLVEPEGFNNIQGKGIVGRVSGVELAIGNMSLMTME
    QISGVDALQDEVETLALLGKTPVYVAKQGRLVCVIAISDPVKPDAKQAIAALKRGGKRVILLSGDKQETVQAVANEVGID
    EVIAGVLPEQKQAKIIELKEIGEVVAMVGDGINDAPALMSADVGIAMGDGTEVAIESADLTLLSGRLSVLADTFALANAS
    MRNIKQNLFGAFIYNSLGIPVAAGVLFPLTGILLSPVIAGAAMALSSLTVVTNANRLRHVKLTR

    >gi|294141894|ref|YP_003557872.1| glutathione S-transferase family protein [Shewanella violacea DSS12]
    MSQLPLPTLYSLQHCPYAMRARLGLLLAKQKVMLKAVVTKNKPEEMLAFSPKGTVPVLVLEDVIENNDEIVKGSEVEVEL
    KAESSDKTKPPRIIDESVDIMLWALNINDPDDLLLSQRPEALPAMLELIRYNDKVFKPLLEQYKDAKRYHIDTEADLRTQ
    CESFIQALELRLSQHQYLMGDSLSLLDFALLPFVRQFARVDRHWYLQSPYPLLRQWLKDHLNRPLFSRMMKKFPLYLETG
    EAYPFG

    >gi|294142004|ref|YP_003557982.1| hypothetical protein SVI_3233 [Shewanella violacea DSS12]
    MTMFLKLVFVSFLSGLLVINAAAQVSAESDQISRLTIKVRGIVCSFCAFGVEKNLSRLPFLDKTQFGQNGVLININTQEI
    TLALLADKPVAYADIATAITKGGYDPISYHGVIEGVIHSRDGKLYLVDQGKQQVYHLPQTAELTHISGKRVQLDISLTST
    QAKASNAEETSVSEYRVSHVYDSSEPKVHHSQSSISKLKPGRDL

    >gi|294142107|ref|YP_003558085.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, hydrophobic membrane protein NqrE [Shewanella violacea DSS12]
    MEHYISLLIRSIFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPANQIIYQGLLAPGALDWAGAPDADLS
    FLKFITFIGVIAALVQILEMVLDKFFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYDLTESFVFGVGSGIGWALAIVL
    LAGIREKMKYSDVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|294142108|ref|YP_003558086.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, hydrophobic membrane protein NqrD [Shewanella violacea DSS12]
    MANAKELKQVLSGPIVANNPIALQILGVCSALAVTSKLETALVMTIALTAVTAFSNLFISMLRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVSKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGVILLGVGFVRELFGNGSL
    FGIEILAKVSDGGWYQPNGLLLLPPSAFFLIAAMIWIIRIYKPDQVEAKG

    >gi|294142233|ref|YP_003558211.1| thioredoxin [Shewanella violacea DSS12]
    MLFAIVITGVMDIWRGKDIPRDKLPDIKGMTLAGSDIDIDALSQDQAVLVYFWGTWCPVCNFVSPAVDTMASMYPVVTVA
    MNSGPDDKMVKYLQHKGYEFETINDSNNDIARDWSVQLTPTLMVFKDGELKHYTTGFTSLPGMWWRMILS

    >gi|294142234|ref|YP_003558212.1| DSBA-like thioredoxin domain-containing protein [Shewanella violacea DSS12]
    MAMSGITASILLIASQLSFISPVHAEVTSLTALQEQDVRAIIKDALINDPELLKQAIIALQTREQLGANSAKQTALDENY
    SAMYETKSDPWKGAENPEVTMVYFTDFN
    CPYCKKIEPSLNKLIEEFPQLKIIIKMVPLQGEGSKLAVELAQTVWLNEPEK
    YIKLKDILMSSPRRLDIASIAKVAKLTDTEKWLGNTDSRVDEMVHDNIKLMRNLGIGGTPSMIFGDKVIPGLVSYDVLKE
    QLEEVLESKD

    >gi|294142235|ref|YP_003558213.1| suppressor for copper-sensitivity B precursor [Shewanella violacea DSS12]
    MENDLKYFKTMVAFGLILLSSSVFAASTGWITNPNHPPVKVRLMLTGELDSVTKVMPAALEVKLDGDWKTYWRSPGEGGI
    APSIKWDKSTNLKEVEWSWPAPQQFSLLGMQTFGYQGEVTFPLLLTLDDIEANTQLHGKFTLSSCTSICVLTDYEINLAI
    NPSELKADTYAMFAYNRAVSSVPVKVTAQDANSAIKLGWDSGKSQLEVVLDSTNWRQPKLIIDGEPDTVFKLVSVNKREA
    SDAGQAESIVAIFDASSWLGEPELLGKSLHVTVIDSRGALEYSSEVKPTQIIAQDSSLLKMMLIALIGGLILNVMPCVLP
    VLGMKLSSVVAAPDLERNQIRQQFIASALGILVSFWLLAGFILMLKFTGQAIGWGVQFQNPWFIGFMALVTSIFAINMLG
    AFEINLPSSLQTKLATTGGNNNRGHFLQGMFATLLATPCSAPFLGTAVAFALGADTMSLLVIFTALALGMALPWLLVAAF
    PQIANYFPKPGRWMIVVKVIFSVLLLITSLWLISLLSNFLPTSYLFVAAVVLLVTFFIFMAKKLGGAAVVATFSITLIFS
    AIGAFMTSAQWAKPLPTDLVWTQLNEELIAEQVAEGKTIFVDVTADW
    CISCKANKVGVILQDPVYSQLKQDNLLLMKGDW
    TKPSQYITNYLQSHNRFGVPFNLVYGPGAPSGIELPVILSTQGVLAAIERASTAPTAASEQKIKQ

    >gi|294142323|ref|YP_003558301.1| glutaredoxin family protein [Shewanella violacea DSS12]
    MKNTLLHKAKTLLSYILIISAGLGIGIGAKYGLDLYNQQPNLISQNTNPHYKGVDSKVIIYTTQWCPYCKKAKQYLTDNS
    IDYIERDIESGSEEINRLYKSIGYPGVPKIVIGNKIINGFNESLLSNVLSSQDLL

    >gi|294142352|ref|YP_003558330.1| alkyl hydroperoxide reductase subunit F [Shewanella violacea DSS12]
    MLDTNLKNQLKTYLQNLKRPVELVVSADDSPKALELKSLAQDIDSLSELISVSEVQGERMPSMKVTSAETDTSITFAGLP
    MGHEFTSLILALLHTGGHPLKLDDSVIAQIKALPGEYHFETYVSLS
    CQNCPDVVQALNMMAAVNPKITNVMIDGALFQTE
    VFDRDILAVPSVYLNGKLFSQGRISLAEVLNKLDTGAAGRQAEQLAQKDVFDMLVVGGGPAGASAAIYSARKGLNTGVVA
    DKFGGQVAETVAIENFISVKATEGPKLVANLESHVREYDVDVMDNQLGVKLTPSQGPNPYHELLLENGATLKSQTLLLAT
    GARWREMNVPGEQEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDIQLRADDVLQRKAAS
    MNNITIITQAMTTQVLGDGSRVNGLNYTDRATGEQHSVELAGIFVQIGLVPNTEWLKGVVDLTPRGEIIVDERGQTSVPG
    IFAAGDVTNTPYKQIIIAMGSGATASLGAFDYLIRHSVPEQANAA

    >gi|294142353|ref|YP_003558331.1| alkyl hydroperoxide reductase subunit C [Shewanella violacea DSS12]
    MNVRTKILLPFTEHSMNQSIINTEIKPFSATAFHKGEFVPVTEKDLLGKWSVVFFYPADFTFVCPTELGDMADHYAKLQE
    MGVEVYSVSTDTHFTHKAWHDTSDTIKKIQYPMIGDPTGTITRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIGR
    SAAELVRKIQAAQYVATHDGEVCPAAWQPGADTLAPSLDLVGKI

    >gi|294142478|ref|YP_003558456.1| thiol:disulfide interchange protein DsbD [Shewanella violacea DSS12]
    MKKLVTLAITLMFTSLLLTPLAHSEGIFSSNKFDFLKDEPKLMPVDEAFVFDFSQEGNQLKVSWVIADGYYMYRDKLKFE
    ARGATLGEISIPKGRSHTDDYFGEQEVYYSYLEIPIAIKEAANDGSLDVTFMGCAEDKLCFPPTKRTAILQAVTANDDQQ
    ANNESVSLDANSETLVNTSTTETSSPQTPTQQDSLSQMLSGDSLLWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGK
    KLSTAKAFSLSMVYVQGMAITYSLLGLVVASAGMKYQAALQHPAVLIALAVLFFVLSLSMFGLYELKLPSKWQEKMNSFS
    NNQKGGNVIGVFMMGVISGLVASPCTTAPLSGALMYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGSWMD
    VIKTIFGFLLIAVSIVMIGRIWPGLVSDIFWSIWGVTLIGYLMHQNKLTEFNWKQTTRSILLTLMLLASFSYGFQAVMTH
    LGHKGSSVSAISEQHISHKRIKSLDDLNAELAKAAAQGKPVLLDLYADW
    CVACKEFEAITFKDPQVQARLANLVFLQADV
    TKNDDIDIELLEHYDVLGLPTLLMFDPSGENRDELRVTGFMKPAQFSEHLDTLLSQ

    >gi|294142535|ref|YP_003558513.1| class V aminotransferase [Shewanella violacea DSS12]
    MSQTASLSQIYLDANATTPVLPQAAQAAMTAMKEIFGNPSSSHITGLQAKNLMEQTRQRAKVLLGTGKGKLIFTSGATEG
    IQTGILSGLIKARENIEPGKQYSILYGATEHKAVPNSLEHWSNILGIDAEIKAIPVDNLGNLDLEFIAREVPNALMICTM
    AVNNETGVYQDLKQLELTIRNHNADVFWLVDCVQALGKRPLKLSETSIDYAPFSGHKLYAPKGIGFIYIRDSAPFTPFIA
    GGGQEGGLRSGTENLPGFAALNVIFEMLLDQKNSCFSTAETLEQYRQQLASSLTAAFPEIVFNHSFKNSVATTLNFAVPG
    FSSKELMDLFDAANIRVSSGSACSSKVTRSFVLDAMGLPAWQSESAIRLSFGPAMTQTEVDAACDRIQLAASALTHSCLM
    LDDTQLNDDKTPLDGLVQLRGGASCTWIYADQQTKQALIIDPLPELEQRINTLLECQQLAPIAIIDTHGHADHISGRVAL
    AQKHLKHQQCDHLGWPKSSEQIQLDGAQLHMIKLGELSLVKVTSPGHTDDSISLLLTTDITKLKSTTRFAFCGDTVLMGS
    LGRTNFDSSSSSKMFHSLKRLEQLIGRNTLLCASHDYNNEFTTTLMAEMMRNSLLHDVLKGQITESQFVSRKANLDANLN
    DEVGTEIMCGAYTSDCHKLAIKEYDATSLKQELGQSNKVKLVDIREPHEYALQHSLGMETAETSSSINVPMTRLVQFIQE
    HQADKTSEWVLV
    CRSGSRSLVVAQAMQRLGFSNIAHLKGGYALSS

    >gi|294142599|ref|YP_003558577.1| thioredoxin 1 [Shewanella violacea DSS12]
    MSDKIVHLSDDSFENDVIKSELPVVVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLNVDQNSVSPAKYGVRGIPTLL
    IFKNGELAGTKVGALSKTQLKEFIDAQL

    >gi|294142688|ref|YP_003558666.1| hypothetical protein SVI_3917 [Shewanella violacea DSS12]
    MKQLISAIFFSMTLLLSGCATTPGDEQVEYLTYVKAGQMVPVTQFTDTQGNKIDLEESSNAKLLVLFATWCPDSQRAMKA
    LEASDLNLDPNVDIIAIGREDNKQALDKFASEYEINFPLIADAKRAIYAKFANAGIPRLILLDANNTIVKTIIAEGEDPL
    AEVQW

    >gi|294142708|ref|YP_003558686.1| hypothetical protein SVI_3937 [Shewanella violacea DSS12]
    MQNIQHQNNQNGEDKSFRLFSRETYQNWFANLWQMRTTALVIAVIFGIMMASTGSGWGASTPFGIWFAKGLMFFGVELST
    ITEISQRPESMFTTPFFEHGVSVQNLAILLGTLIAVLFMGKFKFSFTLNHSAKQLAIFALGGLLMGFGTRFANG
    CNVGAL
    FTPIANFSLSGWVYLLVMIGGAIAGNRFQQAVMK

    >gi|294142734|ref|YP_003558712.1| thiol:disulfide interchange protein DsbA [Shewanella violacea DSS12]
    MAVDYKEGVHYTVINQGPATAKPEIAEFFSFYCGHCYNFAKTEVPKIKANLPEGVVFKQNHVDFIGREMGVEMSRAFAVA
    HQLKVEDKIEKAIFAAIHEKKQHFTSRDDVRKLFIENGVEGKTFDAAADSFMVSAQMSQMKHATTNAKISGVPALVVNGK
    YRVETGAIKSYDELLDIAYYLTSMK

    >gi|294142897|ref|YP_003558875.1| thiol:disulfide interchange protein DsbE [Shewanella violacea DSS12]
    MKKLILFIPLILVMGMGGFLYKGLFLNPKLLDSALEGKPIPVFQLERLEDSSEIITNETLKGKVSLLNVWATWCPSCKYE
    HPYLMRFARQNTLPIYGINYRDERDSALRELNILGDPYTKNIYDHNGRLGLDLGVYGAPESFLVDHNGIIRFRYAGPIDQ
    RVWDETLLPMIKQLQAVAKEEGAS

    >gi|294142956|ref|YP_003558934.1| selenide, water dikinase [Shewanella violacea DSS12]
    MSESTIKLTEYSHGAGCGCKISPKVLGTILASQLPVFEDPKLLVGNQTRDDAAVYKLNEETGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPMMAIAILGWPVNILPAEVAQQVVDGGRQACADAGIMLAGGHSIDSPEPIFGLAVTGQIPLN
    ELKKNNTAQSGDKLYLTKPLGIGILTTAQKQKKIAPEDINIAADAMCELNVLGPVIAKIAGVNAMTDVTGFGLAGHLIEM
    CQGAKLNAKIKVSALPLLAKAKTYLEMGCIPGGTHRNYDSYSEHLPTLTDEQKGIICDPQTSGGLLISVGADAEQELISL
    LTKNNVPTECIGIMTNESQAQFVELI

    >gi|294142993|ref|YP_003558971.1| molybdopterin biosynthesis MoeB protein [Shewanella violacea DSS12]
    MSSTADNHDILSDSEILRYSRQISIRAMDFEGQEKLKLAKVLIIGAGGLGCAASQYLAVAGVGHITLVDFDTVELSNLQR
    QVLHQDKNIGQAKVESARESLSELNPHIQIDVIDAQLNDAEINKLVAQHGLVLDCTDNLAVREQLNSSCFSHKVPLVSAA
    AIRMEGTVTVFDYQDEHPCYHCFSKLFGEQHLT
    CVESGILAPVVGMIGCLQAVEAIKVITNMGKPLLGRILMIDAMTMEF
    REMKLTKQINCEVCG

    >gi|294143076|ref|YP_003559054.1| rhodanese domain-containing protein [Shewanella violacea DSS12]
    MQEYIEFLKAHPMLSLAWIGLLIGLIVSVFKASISKVTTVDNQQATLLMNKQDAKVIDVREKSEFKKGHIVDALNVPLSE
    IKNNQLSALEKFKASPIIMV
    CNAGMVSSQASQLMVKAGFESVHNLKGGMGEWQSSNLPVTKSKR

    >gi|294143104|ref|YP_003559082.1| dsrE-related protein [Shewanella violacea DSS12]
    MQQVLIIVNDAPYGSERLFNALRLAIQLNEQEESLAKVSLFLLSDAITAVLPKQLPAEGYNIQQMLEILIAQKSEVKFCG
    SCMHARGLTDLSVIEGCEVATMDDLAVWVLAADKTLTF

    >gi|294139776|ref|YP_003555754.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Shewanella violacea DSS12]
    MNKPNSLQIKLANPRGFCAGVDRAISIVERALELFSPPIYVRHEVVHNRYVVENLKDRGAVFVEELDQVPDDSIVIFSAH
    GVSQAVRAEAKRRGLKVFDAT
    CPLVTKVHLQVTRASRKGIECILIGHAGHPEVEGTMGQYDNPKGGVLLVESPEDVESME
    VKNPENLCFVTQTTLSMDDTADIIAALQKRFPAIEGPRKDDICYATQNRQDAVRNVADDVDLFIVVGSKNSSNSNRLREL
    AAKCGSEAYLVDNADDIDSSWFTNVTKVAVTAGASAPEVLVKQVIDAIAELAPSVITEVEGRKEDTVFAVPAELR