Shewanella sediminis HAW EB3 uid58835

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157373240|ref|YP_001471840.1| rhodanese domain-containing protein [Shewanella sediminis HAW-EB3]
    MSSFQHFSVNQLIQLSESNPDIQIADIRDAASFESGHVEGAINLSNENLANFIAEADMDLPLIVICYHGISSQSAAQYLV
    EQGFDHVYSLDGGYQAWREAHT

    >gi|157373283|ref|YP_001471883.1| glutathione reductase [Shewanella sediminis HAW-EB3]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNVGCVPKKVMWYGAQVAEALHLYAKDYGFDVTVNKFD
    WNTLVASRDAYIERIHGSYDRGLENNKVTLVRGYGRFVNERTIEVDGQEYTADHILIATGGSPSIPNIPGAEHGIDSDGF
    FELRAQPKRVAVIGAGYIAVELAGVLHSLGSETHLFVRKHAPLRSFDPMLSEALMESMATDGPTLHTHSTPESVIKNSDG
    SLTLKLENGESFEVDTLIWAIGRKPSTGNIGLENTQVKLNDKGYVVVDEQQNTTNPGIYCVGDIIEGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYTLIPTVVFSHPAIGTMGLSEPEAIAQYGTDQVKCYNSGFTSMYTAVTAHRQACKMKLVCAGPD
    EKVVGIHGIGFGMDEILQGFGVAMKMGATKKQFDSVVAIHPTGAEEFVTMR

    >gi|157373295|ref|YP_001471895.1| glutathione S-transferase domain-containing protein [Shewanella sediminis HAW-EB3]
    MNKPSALPVLYSLRNCPYAIRARMAIYVSGQAVQLRDIVLSDKPAHMLQVSPKGTVPVLVLQNDKVLEQSLEIMMWAFGQ
    SDPNNYLMSDSPNTRAEMLSLVDLFDTEFKLRLEKYRSAKRYHDESVLEHRLACEQYLKMLELKLSQHTYLMSDSPSLAD
    LAILPFIRQLARVERQWYLQSPYPNIRKWLNDYLQSRMFSKVMSKYPMWLTEKSLIVFSADKPLS

    >gi|157373330|ref|YP_001471930.1| electron transport protein SCO1/SenC [Shewanella sediminis HAW-EB3]
    MNKRLTRVVAALLAVVIVGLGSFTALQFQSMSEEVSQIELSNSFVYPTPKRLPQFKLMEQHGTSFTNADLKGKWSLFFIG
    YTSCPDV
    CPTTMAKLTAAYPELLESADIQVIFLSVDPQRDTQDKLLNYMDFFNPKFIALTGDHTQLFPLTRSLGFVYAMV
    GDGENYQIDHSASMALISPEGENIAIIKPKSSTPGTLPQITSQALISDIHQIIQRKNG

    >gi|157373375|ref|YP_001471975.1| DsbA family thiol:disulfide interchange protein [Shewanella sediminis HAW-EB3]
    MIKLLSTAAILLSFGASAASFTQGEHYVDLGEAAFNAPNQVTKVYSVNCPFCYKYEKAVIPGFVKNLPDGVSFDSYHITT
    KPPFGKEKATVIAVAKVLGDKQYKTAKMAYYKHIHDDKKKFSSAEDAISFGLKAAKIDSVTFSAHKDTSEVKALLTQWDQ
    GVAVAKVRGIPAIVVNGKYLINTKTITSMTMLDELTAELLEK

    >gi|157373376|ref|YP_001471976.1| disulfide bond formation protein [Shewanella sediminis HAW-EB3]
    MNAISQGWQDLKTAPVSTLQQWQEQRWIWLLMSGAAAFLIGSAMGYFQWFLEMDPCEICVYIRFSQFCILFAGLVIAINP
    NQVLLKVLGLTLAWYGVVQGMMWSIDLSMLHDASHAMDDVMAGGGDLFAAGGGGGA
    CSTEPTFPLGLPLHEWFPYEFQPS
    GICGEDDWSLLGLNMAQYCIIAYSVFGIALSAVTFGWISRLTQGHSSVKAH

    >gi|157373449|ref|YP_001472049.1| rhodanese domain-containing protein [Shewanella sediminis HAW-EB3]
    MLQSLLSKLAGAGPDKRSWELIKQGARVIDVRTPEEFGSGHLPQAINVPLSQISTWLIDQDPKQSFVLYCAAGIRAQKAC
    DQLKCSGFPNVINAGSLKDLLSYQAT

    >gi|157373574|ref|YP_001472174.1| dihydrolipoamide dehydrogenase [Shewanella sediminis HAW-EB3]
    MSNEIKTQVLVVGAGPAGYSAAFRAADLGLEVIIVERFNTLGGVCLNVGCIPSKALLHVSKVIEEAKAVASHGVVFGEPQ
    IDLDKLRSFKETVISQLTTGLGGMSKMRKVDVVNGFGKFTSPNTIEVTGEDGVKVIRFEQAIIAAGSRPIQLPFIPHEDP
    RIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDIVRVYTKKIKKKFNLILQTKVTA
    VEAKEDGIYVSMEGKKAPAEPVRYDAVLVAIGRTPNGKLIDAEKAGVNIDERGFINVDKQMRTNVPNIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGVAYETATFPWAASGRAIASDCSDGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKK

    >gi|157373620|ref|YP_001472220.1| thioredoxin, putative [Shewanella sediminis HAW-EB3]
    MVTPMNKTLILTCLLALSSVFIPADAKSNKVYNTGEAINKPMIMSRFIEMQSAREVPDVTFTDTEGGEINLKQYKGKVVM
    VNLWATW
    CAPCIKEIPQMENIRQTNIDKDLVVLPISIDEESEKVKPFLARHGLSHYKTWLDPNKDIDQVMPADVVPATYV
    FDGSGNLIGFLRGYLDWGDKEVQPYLEKLIAKYAKR

    >gi|157373624|ref|YP_001472224.1| rhodanese domain-containing protein [Shewanella sediminis HAW-EB3]
    MVEANKRIIMNKVLGIIILTFFLAALSPNSFAGGGSDMAPAKHHEFQLNHITMVEAETLVGKEGVYFFDVNTLELWAEGY
    IPGAIYFNVRDWKKILPENKDAVMVFYCANRL
    CNASEIAARAVMKLGYTGVRQMPDGIYGWRLSNRQTERP

    >gi|157373635|ref|YP_001472235.1| hypothetical protein Ssed_0494 [Shewanella sediminis HAW-EB3]
    MKKALGQIVVSLTLLLSAATCFAGGGSDMAPAPHQDVQLNPISMTEAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNV
    KDWKKLLPENKDTVMVFY
    CANRLCNASEIAARAVMKLGYTGVRHMYDGIYGWRLANRVTEKP

    >gi|157373651|ref|YP_001472251.1| putative lipoprotein [Shewanella sediminis HAW-EB3]
    MKQLATIFMITMALTISGCASSVSETAKVEYLTYVSTGQAVPVKHFTDSHGNSIDLTESHNAKLLILFATWCPDSQRAMK
    ALQASDLILDPNLDIIGIGREENKEVLDKFANEYQINFPLVADSDRSIYAKFANAGIPRLILLDGENHIVKAIIAEGDNP
    LAEVRW

    >gi|157373968|ref|YP_001472568.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella sediminis HAW-EB3]
    MNQSIINTEIKPFSATAFHKGEFVPVTEQDMLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQAMGVEVYSVSTDTHFT
    HKAWHDASDTINKIQYPMIGDPTGAITRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIGRSAAELVRKIQAAQYV
    ATHDGEVCPAAWQPGAETLAPSLDLVGKI

    >gi|157373969|ref|YP_001472569.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella sediminis HAW-EB3]
    MLDANLKNQLNTYLQNLKRPVELVVSADDSPKAQELRLLARDIESLSPLVSISEAQGKRMPSMKVTNAESMTDITFAGLP
    MGHEFTSLVLALLHTGGHPLKLDDAIIAQIKALSGEYHFETYVSLS
    CQNCPDVVQALNMMAAINPNITNVMIDGSLFQTE
    VFERDILAVPSVYLNGELFAQGRISLTEILNKIDTGAVARQAEALAEKEPFEVLVVGGGPAGASAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELELENGAVLRSKTVLLATGARW
    REMNVPGEQEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDTKLRADEVLQRKAASMGNI
    EIITQAMTTEVNGDGKRVNGLNYTDRATGESHHVALAGIFVQIGLIPNSEWLKDTIDLTVRGEIIVDGKGETSVPGIFAA
    GDVTNSAFKQIIIAMGSGATASLGAFDYLIRHSEPEQEQVAA

    >gi|157373972|ref|YP_001472572.1| hypothetical protein Ssed_0833 [Shewanella sediminis HAW-EB3]
    MARTILLLIFFCLSSFSTASYAVPTTSEATPPQTWHYVNADGELKVKLYFFWSKTCPHCAEAHPFIDSLPQRYPWIELES
    YMVSEPGSMNKWKEISALTETEARSVPYMASCEKAVIGYSSEAVTGQYLLQNLKTCYQSLGGTLDPNETYQPVASTATKD
    APLFGTCSDSSGDEAGAGTCDLGLAEPQAHTSSVQPVELPLIGVVNPEQLSLPLLTVVLAGVDAFNPCAFFVLLFLLSIM
    VNAKSRTRMLIVGGIFVFFSGFIYFLFMIAWLNIFELLGAGSDGGMIILGAGILALIAGMINLKDYFYTKGEVSLSMSAE
    NRTGLIKRMGKLTNASSMAAMIAGTVVLSILANAYELLCTAGFPMIYTSVLAMHELPDMERYLYLAFYNIVYVIPLAAIV
    IAFSATLGKRKLTEKEGQTLKLMSGIMMVGLGGTLAADPTALQNVALAIGLILSSILLTFVITMTRKTLAKSKG

    >gi|157374033|ref|YP_001472633.1| thiol:disulfide interchange protein DsbC [Shewanella sediminis HAW-EB3]
    MKFTRAFSLILAVVLAPFAAAAPNTQSNTIANSAELKQKLTETLSVEVHSLQQSPIPGLYEALTDRGVLYISKDGSKLFH
    GSLYDLDKGMKNLTEAAMAGPRMKMIKPLEDNMLVYKAKNEKHVVTVFTDIS
    CGYCRKLHNQMDEYNDLGITVRYLAFPR
    RGVPSANADEMEAVWCAADPLTAMTEAKAGKSIKTAKCDAKIAEQYHLGQSLGINGTPAIILEDGSMIPGYQPPKDLLRV
    LESTN

    >gi|157374234|ref|YP_001472834.1| iron-sulfur cluster insertion protein ErpA [Shewanella sediminis HAW-EB3]
    MTEQTTEQAEDAMPIQFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVDPM
    SLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|157374525|ref|YP_001473125.1| OsmC family protein [Shewanella sediminis HAW-EB3]
    MKALYSTQATASAGRNGNVATDDGKLSLALSYPKEMGGSGEATNPEQLFAAGYSACFSNALLHVAREGKLVLTQAPVTAT
    VGIGVREEGGFGLSVALAVELELPQAQAVALVRNAHLV
    CPYSNAVRNNIDVMLTVNGESI

    >gi|157374624|ref|YP_001473224.1| copper-translocating P-type ATPase [Shewanella sediminis HAW-EB3]
    MTSMTLYVPKMNCASCVAKIEGAFAKLAREASGEKVDARVNLGEKQVLINGDITSELAIATVASAGYDSELVLDAKLASE
    TKVKEENVEYRTRIIQSALGLGLGIPMMLWGLLGGEMMVNSPGQQLMWGAMGLVTLVLLVTTGGHFYQGMWRALKAGAAN
    MDTLIVLGTTSAWLYSMIVVLMPGGFPAEARHVYFEASVMILGLINLGHALELRAKGKTGEAVQRLIGLQSTTAIRVTDS
    GDEEVEIASIKIGDRLRLKPGDRVALDGEVLSGHSQLNESMLTGEPVPVNKSVGDALSAGTVNGNGSLIFGVTAGLNDTR
    LAKIIELVQQAQTSKLPIGRLTDKISAYFVPVVVLIALAASFIWFMAGPAPQLSHALIVLTSVLIIACPCALGLATPMSI
    MVSVGRAAQMGVLIKNGEALQTASKVSCVVLDKTGTITLGRPLVTDILLASGNISIDEPGGIETLLTSVASLEQHSEHPL
    ADAMLSEAKSRKLSLVEPEAFTNYQGKGIVGVVDGQQLAVGNMELMKMQSVRNMDALEDEVIEFAEMGKTPVFVALEGAL
    TAVIAITDPLKPDAFDAISALKQSGKRVILLSGDNLKTANAVAKQVGIEEVIAGVLPEQKQQHIIDLKSSGEIVAMVGDG
    INDAPALVSADVGIAMGDGTQVAIESADLTFLSGRLSVLADTFSLASASMRNIKQNLFGAFIYNSLGIPIAAGVLFPFTG
    MLLSPVIAGGAMALSSLTVVTNANRLRHQKLN

    >gi|157374751|ref|YP_001473351.1| rhodanese domain-containing protein [Shewanella sediminis HAW-EB3]
    MFKQILISKQRLQLKYFMIFAAFLSLTVSQLSWAADKDAQVAWDMIDAGAMVVDVRTAEEFEAGHLPNAINIPFERIAAA
    FKERKIAKDKSVLLY
    CRSGRRSGIAFEALVSEGYTNSYNGGGLETLKSARAK

    >gi|157374881|ref|YP_001473481.1| DsbA oxidoreductase [Shewanella sediminis HAW-EB3]
    MNFLKWPLTTLLLFVAVNTMMFNRVEAQSFVEGVDYVQIRGIPEAKSPIVREFFSYNCGHCYRQDSLFEKTVELLGDKVE
    FSRTPIGAGRPSWILSQEAYYLAQKFKLTPQVHGNIFKRIHEKEGAFTRPEQLRDYFVQQGVSADKVEKAMSSADASLAL
    SNYDTQAQLAGIRGVPSLLVNGRYLIKSKHRTAEELAELVSYLSSLEDKE

    >gi|157374969|ref|YP_001473569.1| glutaredoxin [Shewanella sediminis HAW-EB3]
    MFIVRWILGRIILILNFIFAPKKRKRPQDEQSKIDAETKLLALYEYKACPFCVKVRRAMRRQGLNIETLDAKQDDHKTRL
    VSQGGHAKVPCLRIEENGETRWMYESSDIINYLDKRFA

    >gi|157374987|ref|YP_001473587.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella sediminis HAW-EB3]
    MSVLVGRPAPDFTAAAVLGNGEIVDSFNLSEAIQGKPTVVFFYPLDFTFVCPSELIAFDHRIEEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVAEGGIGPVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMDASPEGVASYLTDNADDL

    >gi|157375000|ref|YP_001473600.1| glutaredoxin 1 [Shewanella sediminis HAW-EB3]
    MFVVIFGRPGCPYCVRAVQLSEQLVEAREDFKFKYVDIHAEGISKADLEKTVGKPVETVPQIFVDKEHVGGCTEFEQFVR
    ENQLLTQPA

    >gi|157375152|ref|YP_001473752.1| UBA/ThiF-type NAD/FAD binding protein [Shewanella sediminis HAW-EB3]
    MNDLDFIRYSRQILLDEVGESGQASLLVRHVVVIGVGGLGSLVSQQLAAAGVGRLTLVDHDCVELSNLPRQLLFNESDIG
    KNKAITARDKLALAYSQCKIESVTDKFGPDNGASLVKMADMVIDCTDNFISRQQVNRYCVEALRPLVTASVAHFHGQIFT
    VDTNSAPESGCYHCLFPDDSQVSET
    CRNVGVLGPMVGVMASMQALMAINYLLGIVQCSGKLMRFDGLNLKWREASLSRDP
    LCHVCSLEDNGSSRHQPSHEHSCHDLSRNNQPFNDQSCSKQPFNEESCHEPD

    >gi|157375176|ref|YP_001473776.1| SoxR-reducing system protein RsxE [Shewanella sediminis HAW-EB3]
    MNSVLNEYKTIAIQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMAVLIGSNVLVSLVKFYVPREIRIPVFVMII
    AALVTCVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSLLKSAFDGFMMGLGFLLVLAVLGASREILGQGT
    LFEGADLLLGDWAASLTIHLWQVDTNFLLAMLPPGAFIGMGFLIAFKNIVDKQIADRSTTPAVTETVTRARITKVS

    >gi|157375181|ref|YP_001473781.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella sediminis HAW-EB3]
    MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASVLSYLVNQYLLLPFELGYLRTMSFILV
    IAVVVQFTEMLVQKTSASLYRALGIYLPLITTN
    CAVLGVALLNISEKHNFIESAIYGFGAAVGFSLVLILFSAMRERLAA
    ADVPLPFRGGAIAMITAGLMSLAFMGFTGLVK

    >gi|157375261|ref|YP_001473861.1| thioredoxin reductase [Shewanella sediminis HAW-EB3]
    MSQARHCELLILGSGPAGYTAAVYAARANLKPVLVTGLQQGGQLTTTTEVENWPGDAEDLTGPALMERMQKHAEKFETEI
    LFDHINEVDLKVRPFKLKGDNGDFTCDALIISTGASAMYLGLESEEAFKGKGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDAFRSEKILTKRLMDKVENGNIILHLDNTLDEVVGDQMGVTGLKMKSTKDGSITDLEVMGVF
    VAIGHKPNTQMFEGQLEMNNGYIKVQSGLDGNATQASIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDSK

    >gi|157375272|ref|YP_001473872.1| DsrE family protein [Shewanella sediminis HAW-EB3]
    MSKFIIQVNGAAYASSASYNAYRFAKAALESGHEIERVFFYQDGVLNTNTLNSPASDEFDLTQAWVSLNQKYEVQLVNCV
    SAALRRGILSQNEAKENQRKHWNMEEPFEMGGLGELVTGIETADRVISF

    >gi|157375353|ref|YP_001473953.1| heavy metal translocating P-type ATPase [Shewanella sediminis HAW-EB3]
    MKYPECFHCGEPVLTGSQFTTHINNSDRLMCCPGCQAVSAAILEAGLSNYYKYRTEPGSKQTALVPEELTAYSAFDLPEV
    QQDFVHSESDISRVSLSIDGIT
    CAACAWLIEHKLRHVAGIASIQVNTTTERALVTWLPTQIKLSEILSQISLIGYQAAPY
    QVDEQEIQSKQNSRQFLLRLGLAGFATMQVMMFALALYAGYFTELEVEFRDYFRWVSMIFAAPVVFYSAQPFYFSAIRSM
    FSGRLNMDVSVSIAILGAYIASCIATVNATGEVYFESVSMFTFFLLLGRYFEQNARQKASVSSSNLHKLVPLTAHLISND
    TCEEVPAKGLKVGDIILVKPGEVVAADGTIIEGCSSFNEAMLTGEQTPVQKSDTSEVYAGTINVEQPIKLKITATGQDQL
    VAEIIRLQESASNNKPKVALYVDTISNYFTWAILSIALLTYIVWKIYWPEDAFWVTLAVLVATCPCALALATPTAVTCAT
    GIFTRIGIIARKPGVFEKLTKIDHVVFDKTGTLTCGTLTITDIELYGQLDKAQVLEVAAALEASSLHPIAKAFEPYNNPQ
    LTVSRIQSFVGLGLSGQINNIDYRIGSAEFIEVTGEHSQAVYLAQGDELLARFTLVDEIRTDAKATVQTLTQQGCKVSVA
    SGDGSIHVDEVAGRIGITDVYKGLKPQDKLSLIQNLQKSASVAMFGDGINDAPVLAGANLSVAMGSGSAITKNSADLILL
    GDHLSRFNDAVTVARLVDKIIKQNLYWALGYNLFIIPLAVTGHVAPYIAALGMSASSLIVVGNSLRLLRVRL

    >gi|157375398|ref|YP_001473998.1| sulfurtransferase [Shewanella sediminis HAW-EB3]
    MKLQRYWIGLLPLIMSCLFAPVLATEPQAEQADANFPLRFVYKNIPIIDHLTLYKQLESTIVIDVRSKHEYDTLHIKGAL
    NISISNLGFITRIKKLRVQDSRQIVFY
    CNGITCEKSYKASDKAIKNGITNVATMDLGIFGWIEAFPDAAVILGEDTVPED
    RLITKEKYQLHLLSPDEFVAKIDKSVMVIDIREHYHRDPVILEGVTRVASSDKVLGLLRKAKNNQQTILFYDAVGKQTPW
    LQYLIEKIGVENYYFMDGGVKAYVEAGLPID

    >gi|157375468|ref|YP_001474068.1| peptide methionine sulfoxide reductase [Shewanella sediminis HAW-EB3]
    MAIATFGAGCFWGVEYFFNQIQGVTKTSCGYMGGHDSANSYTEVKSGETGHAEVVQVEFDENQVSYEQVLAVFWQNHNPT
    SLNRQGGDIGSQYRSAIFFHSKAQKAVAEQSKLDLARSGKWGERQIVTEIVPVLQFNRAEEYHQNYLEKNNLPSCHISY

    >gi|157375554|ref|YP_001474154.1| hypothetical protein Ssed_2417 [Shewanella sediminis HAW-EB3]
    MTLFGIKNCDTVKKARKWIEANDLTIPFHDFRVDGLTKDQVATWAAYLGWENLFNKRSTSYRNLSDEDRSNIDEAKAIEL
    MLTHPTLIKRPVLVTNDKVMVGFKESEYKAWFNL

    >gi|157375569|ref|YP_001474169.1| redoxin domain-containing protein [Shewanella sediminis HAW-EB3]
    MNTLIKGDSAPLFELKNQDDQPISLSQCLESGPVLVYFYPKASTPGCTVQACGLRDSKTALNTLNVTVLGISPDPVPKLS
    RFAEKQELNFSLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRLSFLIGQDGKVTHVFNKFKTKEHHDVVLNHLKDA

    >gi|157375575|ref|YP_001474175.1| arsenate reductase [Shewanella sediminis HAW-EB3]
    MTQVTIIHNPRCSKSRQTLALLQEQDCQIQVVEYLKSPLVRSEIEGLLAKLNISARELMRTKEVEYKEQGLADINLTEAQ
    LIQAIIQTPKLLERPIVLANDKAAIGRPPENVLSIL

    >gi|157375581|ref|YP_001474181.1| glutaredoxin-like protein [Shewanella sediminis HAW-EB3]
    METNETVAKIKQQIAENPIIVYMKGSPKLPSCGFSSQVAQIMINCNAQFAFVDILQNPDIRSELPKYANWPTFPQLWVEG
    ELIGGCDILTEMYQKGELQTLITETAAKYPSEEQA

    >gi|157375649|ref|YP_001474249.1| disulphide bond formation protein DsbB [Shewanella sediminis HAW-EB3]
    MIMEINLLNPVTRFAQSRLAWLILAGTALGLELCALFFQHVMKLDPCVMCIYQRLAIFGILGAALIGLVGYKNRFLRFIA
    VLGWGISAAWGLKLALELVDMQTNPSPFST
    CSFLPEFPSWMPLHEWLPSVFMPSGMCSDIPWQMMGVTMGQWMIVAFSTY
    LLALAIFMIPALSKTGK

    >gi|157375771|ref|YP_001474371.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella sediminis HAW-EB3]
    MSKLTEFERFVIEDRGTERPFSGEYHLHDAKGVYLCKRCDAPLYLSESKFNAHCGWPAFDDEVKGAVQRVVDSDGIRVEI
    ICAACGGHLGHVFEGEYLTDKNVRH
    CVNSVSLRFKSSDEINLKSETSLATFGGGCFWCIEAIYSELNGVKDVVSGYSGGD
    AEMANYKDVCSASTGHAEVVQIKFEPETISFDELLEVFWMSHDPTTLNQQGNDVGPQYRSVIFAHDAQQVDSANRMIERL
    TEAKVWDRPIVTEVTAFKSFNPAENYHKDYFELNGEQPYCQMVIKPKLEKFRLAFADKLKK

    >gi|157375796|ref|YP_001474396.1| glutathione S-transferase domain-containing protein [Shewanella sediminis HAW-EB3]
    MTLPTLYSFRRCPYAMRARLGVYLSGSQVSLREIVLKHKPEPMLQVSPKGTVPVLILEDNKVIDESLDIMLWALKHNDPD
    NLLLVGEPHKQEIAKALIDANDNEFKPWLDKYKYADRHPEQREENYREQGEQFIAKLETLLAKHEQLLGSKPCITDFAIF
    PFVRQFAHVNKPWFKESPYLNVQRWLSGHLTSTTYTHIMKKYPTWLESEEEFLFGKESK

    >gi|157376004|ref|YP_001474604.1| iron-sulfur cluster assembly protein IscA [Shewanella sediminis HAW-EB3]
    MAITMTPAAAERVKSFLVSRGKGIGLRLGLKTSGCSGMAYILEFVDDLNDDDEVYEIGDVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|157376022|ref|YP_001474622.1| rhodanese-like protein [Shewanella sediminis HAW-EB3]
    MQHNSAFLALVESILPQITEVTVEEYQNDDVWQLIDVREDHEWLKDHLPAAAHLGRGIIERDIEVRYPDKSTALLLYCGG
    GYRSALAAMNLQLMGYTRVASLAGGYKAWVQRQLPLVQD

    >gi|157376038|ref|YP_001474638.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Shewanella sediminis HAW-EB3]
    MTIINNTNTGLRPTQNHSSTQGAGSLLVSLPCKDKVVPLASKTFATPVGQLLIKANQYGLSHLRLAEVEEVLWVDESHPS
    HLEALGYLSQTELELGEYFSGTRETFSVSLAPQGTEFQRQVWQALLEIKHGEYCSYSDIAQQINRPKAVRAVGAANGANR
    IAIIIP
    CHRVIGKNGKLTGYAYGIEMKRQLLGLEGNVDQKTIMF

    >gi|157376258|ref|YP_001474858.1| DsrE family protein [Shewanella sediminis HAW-EB3]
    MKNLIIFNREPYDSTDVTWNGLRLANKLIEGGEELRIFLMNDAVDMARDVCRPPENYDQDLGQMLRELIVSGASVKVCGT
    CMARCGIFKNQPYFEGAEQSTMQELSDWVIDSDKVISF

    >gi|157376260|ref|YP_001474860.1| ArsR family transcriptional regulator [Shewanella sediminis HAW-EB3]
    MTKEINKMSQFKKSLNEQFSVIAKAMSNPNRLEMLEFLAQCEYSVDDLAKVMGLSVANTSHHLQQLRLAGLVASRKEAQR
    VFYRLKGDGVVELMASMKRVAESHVTEVKELVNTYLYSKDEMEPIPREELLKRASEGSVTVIDVRPSVEYASGHLPGAIN
    LTVEELKKQFSVIEPNQEVIAY
    CRGAHCILAFEAVEFLRSKGFQTRRLEDGFPEWKSAGFPIN

    >gi|157376323|ref|YP_001474923.1| thiol-disulfide isomerase/thioredoxin [Shewanella sediminis HAW-EB3]
    MKNIKVLGSGCTNCKTTAQIIKEIAEANGVEINLEKVEDLSQIMAYGVMSTPAVIIDEQLIHKGSVPTRELVESWFVD

    >gi|157376343|ref|YP_001474943.1| hypothetical protein Ssed_3211 [Shewanella sediminis HAW-EB3]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDIPTENIRLSQNNIVDPE
    DRYNQIFQIQVELPDDISEKDRVGILRSIERCTVKKVVQTGPEFKIETVENLESDANAMLMGQPDGDVSTYILGKDLPLE
    QTISNMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPSCFTNGKGATKESALCSALGEFIERLNCNFFYNDQFFGEE
    IANSEFVHYPNEKWFELEDDDALPAGILDEHCLDIYNPDGELAGSNLIDTNSGMVERGICTIPYVRHSDGETVHFPSNLI
    ENLFLSNGMSAGNNLQEAKVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGIQGLEAQGFPVVVKDASLGGQ
    FPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFDSMTVTEPENFVEHFIDSTGVISWRF
    FSSNHDYDFCEWDFSGTNAEESESLFGILADIGKEAYIAEFDQLGASVCRILVPDYSEVYPVEDLIWDNTNKSLDYREDI
    LNLHSLNDDELAGLVERLEESQLDNQTDIPTLIGIVFDENTPWGQLTIIELKILIYLASGELENAIELVGEFLQYNDNTV
    ERGLFYQAVNAVLEVTLDEELELEHFIHNFERMFGKETMDNVVGSVTGEVKFFGLTQTSMKLEGIEPHLRLIESYKKLHQ
    ARKAKAVS

    >gi|157376373|ref|YP_001474973.1| hypothetical protein Ssed_3241 [Shewanella sediminis HAW-EB3]
    MTKRIDLAKTQPAALTAMLSVENYLSQTALPAKLKELIKIRASMINQCAYCIEMHTAEALKAGIEQQKLFAISAWRESPL
    FDDKERAVLALTDEMTLIADSGVSDTAYQATLEKLGEEQLAEAMMQIIMINAWNRFALATQMKH

    >gi|157376430|ref|YP_001475030.1| glutathione peroxidase [Shewanella sediminis HAW-EB3]
    MTTSIYDFSVKDIQGEAVSLSQFKGKVLLIVNTASACGFTPQYKSLQALYEKYGPDNFVILGFPCNQFGEQESGSEDQIQ
    SFCELNFGVSFPLFEKIEVNGEGAHPLYQYMKSSAKGILGSEGIKWNFTKFLIDADGKVLERYASTTKPESIEKRIISLL
    E

    >gi|157376559|ref|YP_001475159.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella sediminis HAW-EB3]
    MEHYISLLIRSIFIENMALSFFLGMCTFLAVSKKVTTAMGLGIAVVVVLAISVPVNQIIYQGLLAPGALTWAGLPEADLS
    FLKFITFIGVIAALVQILEMVLDKFFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLVESMVFGVGSGLGFALAIVL
    LAGIREKLKYADVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|157376560|ref|YP_001475160.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella sediminis HAW-EB3]
    MANAKELKEVLSGPIVSNNPIALQVLGVCSALAVTSKLETALVMTIALTAVCAFSNLFISMLRNHIPSSVRIIVQMTVIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGIGYGAILLSVGFVRELFGNGSL
    FGVEILSKISDGGWYQPNGLLLLPPSAFFLIGTLIWIIRTIKPEQVEAKG

    >gi|157376596|ref|YP_001475196.1| thioredoxin [Shewanella sediminis HAW-EB3]
    MTQFPSAIIHLEDADALATLKLNHAYILLCFSADWCAPCRAMEGTLINTAFELEGKAAVVKAEPKLCQTLAAELGIRTVP
    AYVAINCDVISKPVYGIQTITNLLDMIEAY

    >gi|157376676|ref|YP_001475276.1| hypothetical protein Ssed_3544 [Shewanella sediminis HAW-EB3]
    MRRDVSLFSGLNFLVIRALALVVASAFALSVGGSVSAEPLKVGEIAPNFTINQIDNTPFKLSEFKGKQSVYLIFWNTWCG
    H
    CMKKVPQLMTIEREFGEQVKLLAINTSWSDSLAEISQFQARFEANYAIAFDDNAEITHRYGVMGTPTGFLVDINGVIRQ
    VDGITHTLAANIEQWNRVSGTEGKPVVLAGAVCDKDSLC

    >gi|157376680|ref|YP_001475280.1| redoxin domain-containing protein [Shewanella sediminis HAW-EB3]
    MSDNNSADNTDTELKPTFFRRVLGWGRQLALLILFSMVFSAGLDMWRGKDIPRDDLPNISGISLKGESLDIAALSRDQAV
    LVYFWGTW
    CPVCNLVSPAVDVLSTSYSVVTVAMNSGADDKMVKYLKHKEYDFEVINDSSNDIARDWSVQLTPTIMVFKDG
    ELKHYTTGFTSLPGMWWRMLFT

    >gi|157376681|ref|YP_001475281.1| DsbA oxidoreductase [Shewanella sediminis HAW-EB3]
    MKVLSRFNRVTDMLFQSRKAKFAMLATVAGSVFFLSSQLMTSQLAHADHSSFTDEQKLEIRAIVEDALVNDPELLKEAII
    ALQMREEDQMSQARGSLVEQHHAGLFETQTDPWKGAENPAITMVYFTDFN
    CPYCKKLEPSLDKLIEDYPQLRVITKMVPL
    QGEGSQKAVVLAQKVWLNEPEKYHALKDMLMSSPRRLDADAIAKVAKLTDTEQWLSKDDDRVVNVVRDNVSLMRDLGLSG
    TPSMIFGDTVIPGLVTYEVLKEQLEEVIQAKG

    >gi|157376682|ref|YP_001475282.1| putative suppressor for copper-sensitivity B precursor [Shewanella sediminis HAW-EB3]
    MEMNLKYLKNLFALCLILLSSSAFAQSTPWIENPNHPPVKLRLMLTGEFDSVNKTLPAVLEVKLEDDWKTYWRSPGEGGI
    APGIKWDKSTNLKSVDWSWPVPEHFSLMGLQTWGYKHHVSFPLLLTVNDSDDVAQLRGKVTLSSCTTICVLTDYEVSLDV
    IPSELRADSEAMFTYNKAVSKVPQKVENGVDSPILIGWDSGKSKLVVELDAGQWRQPQLLIDGEPDTVFTLTSLKKKESD
    SGPGKLIATFDGKSWLGAPEVLGKTLNVTVVDSEQALEYSDEVIPTQVIEDDISLIKVLLIALLGGLILNVMPCVLPVLG
    MKLSTVIAAPELKRNEIRQQFIASALGILVSFWLLAGFILVLKLTGQAIGWGVQFQNPWFIGFMAIVTSIFALNMLGTFE
    INLPSSLQTKLATTGGNNNRGHFLQGMFATLLATPCSAPFLGTAVAFALGADTLSLFVIFTALAVGMALPWLLVALFPQV
    ANYFPKPGRWMNIVKVFFSVMLLITSLWLISLLSNFVASSILWLFAGLLVLMFFVFMAKKHGSAAVIASISLGILFSAVT
    AFMTSEQWARPLPTDLAWTPLSEVEISQQVANGKTVFVDVTADW
    CITCKANKAGVILQDPVYSALKQADMVIMKGDWTKP
    SAPITKYLQSHNRFGVPFNVVYGPNAPQGIALPEILSTNEVLSAIERASSRAMAATPAVGDTDSEQFRYD

    >gi|157376694|ref|YP_001475294.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Shewanella sediminis HAW-EB3]
    MDISKRHFLTGCGTLIAGFSIYSVAKELAESEAGVSVDQTQTIKYAMVHDENLCIGCNACEQACRQVNHVPDGVSRVVIN
    RTGPFGEYPDQSYRFSRKSCQHCEDAPCVKVCPTGAAYIDSETGIVGVNPDKCVGCQYCIAACPYQVRFINPVTQTADKC
    DFCRETQLKLGKQPACVEACPTHALVFGNIRDPESELVKTLKSKPTYRAKTDLGTRPKLFHVSTIDGEIVL

    >gi|157376710|ref|YP_001475310.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella sediminis HAW-EB3]
    MEHYINLFIQAAFIDNMALSFFMGMCTFLAVSKKVSTSFGLGVAVIVVMTLAVPLNQLIYANVLAPGALAWAGMPELDLS
    YLQLITFIGVIAALVQILEMVLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNLAESAVFAMGSGVGWAMAIVM
    LAGLRERMKFHAIPEGLQGIGIIFITTGLMALGFMAFSGISI

    >gi|157376711|ref|YP_001475311.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella sediminis HAW-EB3]
    MSTNSAATREILVSPIFTNNPVAMQVLGVCSALAVSNSLQTALVMTLAVTFVLVFSNLIISMIRRLIPNSVRIIAQMTVI
    ASLVIIVDMVLQDIAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKNPPHLAVVDAVGNAMGYGVILLGVAFVRELLGSGT
    LFGHEILKTVENGGWYLANEMFKLPPSAFFLIGLMIWTINVIQRKRG

    >gi|157376859|ref|YP_001475459.1| NADH dehydrogenase [Shewanella sediminis HAW-EB3]
    MNKLLIIGGVAGGASAAARARRLNEEAEIIMFERGEFVSFANCGLPYHISGEIADRKSLILQTPQSFKSRFNVDVRVRQE
    VTAIDRAAKTVTVKNHVTGEQYLESYDALVLSPGAAPVVPPIPGLDTPLTFSLRNIPDMDRILTLLKERKPVHATVVGGG
    FIGLEMMEALNELNIDVTLLEMSPQVMAPVDIEMANMLHKEIVDKGIDLRLNCGLSSVEQVGSGLELFLSNGESLNTGIL
    ISAVGVKPETTLAVNAGLAIGELGGIVVDEQMRTSDASIYAVGDAVEEFDFLTGEKALIPLAGPANRQGRIVANNIFGAN
    DSYNRTQGTAICRVFDLAVASTGLNEKRLERSGIPYEKIYVHGASHASYFPGAHPVSLKLLFSTDDGTILGAQAIGRDGI
    DKRIDVMAVAIRAELTVYDMQDMELTYAPPFGSAKDVLNQAGFVASNSLKGETRLCHTADIDALSDQQILLDVRNPGELM
    KSGAVEGAVNIPVDQLRQRLEELPRDKEILII
    CQVGLRGHVAYRMLANHGFMAKNLTGGYKTYQAVHAKF

    >gi|157376885|ref|YP_001475485.1| putative glutathione S-transferase [Shewanella sediminis HAW-EB3]
    MSPPILYSLRRCPYTMRARLAILLSKQTVILREIVLKNIPPQMLAVSKHARVPLLVFDDGTVIEESLDIMLWALAQNDPS
    DLLLSSQVDALPAMLALIDRNDNVFVPALEQYKAAARYHDTAQEHYLDQCQPFISHLEQRLDEHLFLMGMTPSLVDYALL
    PFVRQFSRVNHRGYLQSPHKNVRRWMNSHYEQPIFSKAMTPCPLWLDNQDIVLFGGQ

    >gi|157376904|ref|YP_001475504.1| hypothetical protein Ssed_3772 [Shewanella sediminis HAW-EB3]
    MSSMEIDLGLTFDNSYAQELEGFYDACLGDRAPSPELVKLNASLAESVGLTNTDTGELAQVFSGSDAPIGASPLAQVYAG
    HQFGGFTPQLGDGRALLLGEVLDKEGKRLDLQLKGSGPTKFSRRGDGKAVLGAVLREYILSEAMHALNIPTTRALAVVTT
    GEPVMRTQFLPGAVLTRIASSHLRVGTFQFFSARGEQDKVKQLADYAIARHYPELKESQQPYLDLLCAVRDKQAELVARW
    LLVGFVHGVMNTDNMTISGETIDYGPCAFMDNYDTNAVFSSIDEQGRYSYNNQPVIAQWNLARLAETLLPLIDVDRDEAI
    AQATEAVTGFWETFHRCWLAGMRAKLGLSTAQETDLALCEQLLETMSGQEVDFTQLFRQLASDLTSGNSESQTLFKDADK
    FLLWRASWLARLAQESLSTPERVEMMNGANPLYIPRNHLVEDAIDAAEQEGDYQPFEKLIAVLATPYMQQESADDYTKPA
    PESFGCYTTY
    CGT

    >gi|157376905|ref|YP_001475505.1| beta-lactamase-like protein [Shewanella sediminis HAW-EB3]
    MSMIFHRIRTERGCQSYLIGCSETNSAIIIDPEISQMEHYLGLASHDGLAIHYLLDTHTHADHFSASKQLASQLKVPVIM
    HCNSPAPFVDMYVDDGEIIIVGKLRLTIMHTPGHTADSICIVMKDRVFTGDTLLLGGTGRTDLPSGDPERLYDSLFNGLL
    KLSADLKVYPAHAYSERTHSSIGEELSNNPRLQKKDRDEFVAQMRAIDLKMPTQLTESLRTNLSGGKTVEQFISDAERKI
    SFVSLEQVLRYSQSIAPKFVIVDVRERDAFDKGHIAGAIHIPRGQLELRVNELLPDPTRRIAVY
    CEFGIISVLATSTLRE
    MGFLRAVALDHGLNLWRELGYPLIESKNEEGNEQ

    >gi|157376919|ref|YP_001475519.1| DsbA oxidoreductase [Shewanella sediminis HAW-EB3]
    MLNLAEFFRHLCRLLRYLIEPRVTFEDKRLIKHIALALTLAVAPLSSFAAQFVEGKHFTQVSDKAPSAQPKLTEFYSFYC
    HNCFNMETQYLGDIKANLNKNVKFDSKHVDFMNSEIGTEVMRSLAVIQELDAGDKMTHAMFAAIQGDEGANGHSHDHDHS
    AHEKPELNNRDDIKKVFADKGFDVSKYDAIADSKAVNDKIDLWRVQQREFRIQSVPAFIVNDKYAVNMGQVRTLGELIDL
    INYLAVEHK

    >gi|157376933|ref|YP_001475533.1| redoxin domain-containing protein [Shewanella sediminis HAW-EB3]
    MIKLTKILIVSLILTCSAYVQASDLKVGDKAPDFKLQSTNGEFYQLKDYLGKQTLVLAWYPMANTRGCTLECRSLVQKGH
    LIREYNAAYMMASVDDLEDNQDFAKKQKADFPMLSDPTKETAKAYDVLNFVRVASRVTFYIGEDGTILKIDEDINAETAA
    EDIAATLKQLGIEKQ

    >gi|157376951|ref|YP_001475551.1| redoxin domain-containing protein [Shewanella sediminis HAW-EB3]
    MRKLLLLLSLMTWSLSAAPSLNYQVQNFQGELVSLSEFKGKVVYLDFWASWCGPCRKSFPWMNAMHQKYQQQGLAIVAIN
    LDADRALAEKFLSKLPADFHIRFDPQADVASQFDLQGMPSSYLFNRQGELVQKHLGFFEEKSAGYENEIVELLKE

    >gi|157377083|ref|YP_001475683.1| Thiol-disulfide isomerase and thioredoxins-like protein [Shewanella sediminis HAW-EB3]
    MRRRIKKFIKNRPFIASAAFLMMSLGHANPAVASAKKIKLYEPKSRQVAPKLHLNDLQGETYSLNSHEGEVRIINFWSSW
    CGPCIKEMPSLSGLHKEFKGDGLQVVAVAVGESLHDVRAFKQTSGINLPMLVDEDKAASDDWGVFAVPISYIIDQKGYIA
    ARVVGEYDWESDEMKQLLNKVSQEPGSG

    >gi|157377115|ref|YP_001475715.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Shewanella sediminis HAW-EB3]
    MLDRRRALKLLAGGAIATTGVMFIPAGSAIAAIRQQGKKRLAMVIDLSRCNGCKACVVSCGMENGTKPDEHRTQVIQTSA
    EIGNKQYAFNLPIMCNNCETPSCVSVCPTGATFKREEDGIVVVDSTLCIGCNYCIQACPYGGVRFTNSTTGTVDKCNFCI
    QRTSRGLLPACVETCTGGARVFGDINDVNSEISKLLSQSNPMVLQASKQTSPNVFYIGLTQEESNTAFSIHSPQLWQR

    >gi|157377131|ref|YP_001475731.1| putative disulfide isomerase [Shewanella sediminis HAW-EB3]
    MKTSLTTLTAALFMTFTASAAEVIKIDTPALDNTVQKIYSVYCPFCYKYEKAVTPNLIKNLPAGTKFQAICLENKGQLGI
    EACEVLAAAQTISHKKYKQAKLAMYSAVHDQKLKNVKGSTAVKGDLAAIGLKAAGMSQTEFKNALNSSEAQDKLAYDRTI
    ALTIAKKKGIPAIVISGNKMIDTSTITSLSNLDETIKKYL

    >gi|157377132|ref|YP_001475732.1| disulfide bond formation protein [Shewanella sediminis HAW-EB3]
    MINKLKQWFADLKAYPLLTLEATQEGRAVWVVMAGACVFLLGSAMGFFQVFLEMDPCENCVYIRFSQFCILIAGVMMIVN
    PKNKVIKVIGLALAWYGIVYGMDKSIILSGQHVASHASDSGLDLFQSGQGANA
    CSLEPTFPLGLPLHEWLPFEFAPSGIC
    GEDDWALFGLNMAQYCIISYTVFIACALPLTVAFITKSLRGGSFFTKTLRES

    >gi|157377147|ref|YP_001475747.1| thiol:disulfide interchange protein precursor [Shewanella sediminis HAW-EB3]
    MKKTLTLALTLIFSTLLLLSPLAHSEGVFSSSKFSFLKDEPKLMPVDEAFVFDFKQQGEQLKVSWVIADGYYMYRDKLKF
    EADGATLGEIALPSGKAHSDEYFGEQEVYYSYVEIPIAIREAVEGGTVTVTFMGCAEGTLCYPPTKKTALLSKIEANDGL
    LSNELPTGEKLAKAQVNSEAGQTPITQQDSLSNMLSGDSLLWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGEKLST
    AKAFSLSMVYVQGMAITYSLLGLVVASAGMKYQAALQHPAVLIVLAVLFFVLSLSMFGLYELKLPSSWQEKMNRFSNNQK
    GGNVIGVFIMGIISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGSWMDVIKT
    VFGFLLIAVSIVMIGRIWPDFLSDLLWSIWGVALVGYLMHQNKLTDFNWKQTVRSVLLTLMLLGSFSYGLQAVMTKLGVQ
    AQTQVATEQAHGHKRIKSVADLKAEVEAASAQGKPVMLDLYADW
    CVACKEFEAVTFKDPAVQTRLAQIVFLQADVTKNDS
    LDIELLESYDVLGLPTLLMFDADGELRNDLRVTGFMKPDAFAAHLDILLKK

    >gi|157377182|ref|YP_001475782.1| methylase involved in ubiquinone/menaquinone biosynthesis-like protein [Shewanella sediminis HAW-EB3]
    MNCCTDLYQHPLTHHLLGDSFHPGGLETTRSLAAQCLVNRTSKVLDIATGRATSAAFLVKQYGAQVLGLDLGMDNLQTAK
    QTHHSLTKLNLITGDAMQLPFQNNSLDVVFCECALCTFDNRDAAMQEIYRVLKPGGFIAISDIFLNQALPIALETTLNRW
    L
    CVAGALSRETSIQKAEQAGFNQIHFEDRSAGILASIDSIKLRFEVLESLTPLNLEVVDSLSLKAEGSIYIRNSLKQLAN
    FVEAGGAGYYTISARKLPRRG

    >gi|157377211|ref|YP_001475811.1| hypothetical protein Ssed_4079 [Shewanella sediminis HAW-EB3]
    MKPYLSITLLCAFMGMSTQAMAYDTQLAQSYQQQFSQAKGASAGKAIGLISAEAFVKQLQSNKAMLAVDIRTPQERQIFG
    LAMENKLNIGIDELFTPENLAQLPKDKPVVLV
    CKSGARAMAAGTALRHLGYDNVKILKGGYGKLTKYVGPKIAK

    >gi|157377238|ref|YP_001475838.1| hypothetical protein Ssed_4106 [Shewanella sediminis HAW-EB3]
    MNTNVKALLATTALFFSCQTLAESGCAFEDKQDGFIATCSEEKQEVILTGAVEAQTLVTELSDFSEGYKEYKVDTAAISP
    LKNLKEPTEIVVIIGTW
    CPDCHRETPRFIRIMEELNNPNIKVTYIGVDREKADPKGLAAQYEFTRIPTFIVMQKGEEVGR
    IIEKPEQSLEKDLAAMFKS

    >gi|157377242|ref|YP_001475842.1| thioredoxin [Shewanella sediminis HAW-EB3]
    MSDKIVYLSDDSFENDVINSELPVIVDFWAEWCGPCKMIAPILDDVAEEYAGKVTIAKLNVDQNNVSPAKYGVRGIPTLL
    IFKNGELAGTKVGALSKTQLKEFIDAQL

    >gi|157377325|ref|YP_001475925.1| DsbA oxidoreductase [Shewanella sediminis HAW-EB3]
    MKKALLIAVAMLIAPIAAIAADYKEGVHYTVINQGPATAKPEIAEFFSFYCGHCYNFSKTEVPKIKANKPEGVTFKQNHV
    EFIGKEMGIEMSRAFAVAHQLKVDAKIEHALFTAIHDKKQHFTNRDDIRKLFIANGVDGKDFDAAANSFMVSAQMSQMKR
    ATSNAQISGVPALVVNGKYRVETGAIKSYDELLDIAYYLTSMK

    >gi|157377330|ref|YP_001475930.1| DsrE family protein [Shewanella sediminis HAW-EB3]
    MQNILIVAHESPYGSEKLFNALRIAIALKEQETEVINLKIFLMSDAVYGAVKNQVTPDLSYNIQQMLDILIAQSVPVSLC
    KTCTNGRGVSQEMLIEGANIGTLGKLTQWTLDATKIMHI

    >gi|157377413|ref|YP_001476013.1| redoxin domain-containing protein [Shewanella sediminis HAW-EB3]
    MKKRLASVLTVSLLALGSLSVSTAFAYPGMQKKAEAASQSSIDLINVLPKTYPIDVVPFKDSKGDAVDFSQYKGKVIMVN
    MWATW
    CPPCVRELPAIERLSTKFDSKDFEILPISIDLEGKDKVEPFLKELGMEAFNSYYDEKQKLGRVFPLDTIPATFIL
    NKEGELLAFVRTFVDWDDKKAEELIQSFIDKP

    >gi|157377415|ref|YP_001476015.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella sediminis HAW-EB3]
    MKKRLVLFIPLVLFLVMGVFLYKGLFLNPQNLDSALEGKPIPAFQLERLEDRGDLITNESLKGHVSLLNVWATWCPSCKY
    EHPYLMRLARQNILPIYGINYRDERAMAIRELNRQGDPYTANIFDHDGRLGLDLGVYGAPESYLVDHNGIIRYRYAGPID
    QRVWNETLFPMIEELQAAAKLDGAS

    >gi|157377471|ref|YP_001476071.1| selenide, water dikinase [Shewanella sediminis HAW-EB3]
    MSESEIKLTEYSHGAGCGCKISPKVLSTILASQLPVFEDPNILVGNQTRDDAAVYKLNDETGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPMMAIAILGWPVNKLSPEVAQQVVDGGRQACADAGIMLAGGHSIDSPEPIFGLAVSGQIPLS
    ELKQNNTAQPGDKLYITKPLGIGILTTAQKQKKIAPEDTNIAADAMCQLNILGPIIAKISGVNAMTDVTGFGLAGHLIEM
    CQGAGLNSQIQVSALPLLPKAEQYLEMGCIPGGTHRNFDSYSEHLPMLSDKQKAIICDPQTSGGLLISVSAEAESELVEL
    LTKHKVPSSCIGSLNSFNQLTLVELL

    >gi|157377508|ref|YP_001476108.1| molybdopterin biosynthesis protein MoeB [Shewanella sediminis HAW-EB3]
    MSSTQDTDEILSDSEMLRYSRQISIKAMDFDGQERLKLARVLVIGAGGLGCAATQYLAVAGVGQMTIVDFDTVEISNLQR
    QVLHQDRNVGQPKVESARETLSQLNPHIQIDTINAVLDDPELDELVAKHTLVLDCTDNVAVREQLNKSCFTHKIPLVSAA
    AIRMEGTVTVFDYQGEHPCYHCFSKLFGEQMLT
    CVESGILAPVVGMIGCLQATEAIKVISNMGKPLIGRILMIDAMTMEF
    REMKIAKQANCSVCAKQEAEK

    >gi|157377599|ref|YP_001476199.1| rhodanese domain-containing protein [Shewanella sediminis HAW-EB3]
    MQEYIEFLKANPMLSLAWIGLFVGLIVSVFKSSFSKVSTVDHQQATLLINKQDAKVIDVREKAEFKKGHIIDALNIPLSE
    IKNNQLSALEKSKASPIIMV
    CNAGMVSSQAAQLMVKAGFESVHNLKGGMGDWQSNNLPVSKSKK

    >gi|157376724|ref|YP_001475324.1| thioredoxin peroxidase [Shewanella sediminis HAW-EB3]
    MSVSVKLSAGSNFPSIRANTLDGNTITLGRAYHEAIWQLVVIYRGQHCPLCTKYLNQLEGYKTRLQKIGLDIVAISADSK
    AQLEAHKERLTTSFPIAYGLTQEQMQQLGLYISIPRSEQETDHDFAEPGLFVVNRVGVIQVIDISNNPFCRPELEALVSG
    LEWISDPDNDYPIRGTLAY