Shewanella piezotolerans WP3 uid58745

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212632986|ref|YP_002309511.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MQEYMEFFKANPMLSLAWVGLFVGLIVMVFKSSVSKVKNVNHQEATLLMNKQSAKVVDVRGKEEFKKGHIVDAVNLPLAD
    IKNNQLGTLENAKGSPIIMV
    CNAGMTSSQAAQLMVKHGFENVNNLKGGMGEWQSNNLPVSKSKR

    >gi|212633070|ref|YP_002309595.1| molybdopterin biosynthesis protein MoeB [Shewanella piezotolerans WP3]
    MSSELTDTDEILTDAEILRYSRQISIKAMDFEGQEKLKQAKVLIIGAGGLGCAASQYLAVAGAGAITLVDFDTVEVSNLQ
    RQVLHQDANVGQAKVDSAKETLTGLNPHIKIDTINAVLDDHEIESLVAQHSIVMDCTDNVMVREQLNQSCFKHKVPLISA
    AAIRMEGMVTVFDYQAQTPCYHCFSQLFGEQQLS
    CVESGILAPVVGMIGCLQAVEAVKVIANMGRTLAGRILMIDAMTME
    FREMKLPKQVSCKICSCSPTT

    >gi|212633108|ref|YP_002309633.1| selenophosphate synthetase [Shewanella piezotolerans WP3]
    MSDQQIKLTEYSHGAGCGCKISPKVLGTILATQLPVFDDPKLLVGNQTRDDAAVYKLNDTTGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPMMAIAILGWPVDKLPAEVAQQVVDGGRQACADAGIMLAGGHSIDSPEPIFGLAVTGQIPLN
    ELKQNNTAKVGDKLYLTKPLGIGILTTAQKQKKLADADLNTAADAMCQLNILGPNIAKIPQVNALTDVTGFGLAGHLLEM
    CHGAELGAKIDISLLPLLPNAQQYLEMGCIPGGTHRNFDSYGEHLPILTEQQKAIICDPQTSGGLLISVSTEGEAELQQL
    LSDNGVEPICIGELVNKSATTVELI

    >gi|212633187|ref|YP_002309712.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MPEATLSKLSHCEPGDKCWRLIKQGATVIDVRSPQEFASGHLPQAINVPLDTLATWVAQVGNSQQIFLLYCGAGIRAQKG
    CDILSGGGLQRVVNAGALKDLLACEPKR

    >gi|212633328|ref|YP_002309853.1| thioredoxin [Shewanella piezotolerans WP3]
    MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYAGKITVAKLNVDQNNVSPAKYGVRGIPTLL
    LFKAGELAATKVGALSKTQLKEFIDGQL

    >gi|212633508|ref|YP_002310033.1| Redox-active disulfide protein 2 [Shewanella piezotolerans WP3]
    MKIEVLGSGCKKCTNLAAEIERIAKELSVDFELQKVTDMAAILDYGVMSTPAIVIDGTVVTAGNVPSASEISQLIQPSN

    >gi|212633731|ref|YP_002310256.1| AhpC/Tsa family antioxidant [Shewanella piezotolerans WP3]
    MIKQLSKILLAAALVLPLAATATDLKVGDTAPNFKLQATDGHFYQLSDYKGKQTLVLAWYPMANTHGCTLECKSLVQKGH
    LIREYNAVYMMASVDELEDNQAFAKEQKADFPMLSDPTKETAKAYDVLNFVRVASRVTFYIGEDGKILKIDEDINAETAA
    EDIAANLEALNIDKAEAELENNGETAQVE

    >gi|212633826|ref|YP_002310351.1| hypothetical protein swp_0960 [Shewanella piezotolerans WP3]
    MLSATMNSKVKGLIKAIVVYSLLIIVGTSAGYGIVLGYNKLNEPKIVLVGDYGEHFKNTDKKVVMYGTDWCPVCKRTRDF
    FAKEGIEYKSLIQKKTALHFRCIVN

    >gi|212634028|ref|YP_002310553.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella piezotolerans WP3]
    MADAKELKSVLIGPIVSNNPIALQILGVCSALAVTSKMETALVMTIALTAVCALSNLFISLIRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAFAMKTPPMMSFMDGLGNGLGYGAILLSVGFVRELFGNGSL
    FGIEILSKISDGGWYQPNGLLLLPPSAFFLIGALIWIIRVMKPEQVEAKG

    >gi|212634029|ref|YP_002310554.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella piezotolerans WP3]
    MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVKTAMGLGVAVIVVLAISVPVNQIIYQGILAPGALAWAGVPDADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLGESLVFGIGSGIGWALALVL
    LAGIREKMKYADVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|212634126|ref|YP_002310651.1| glutathione peroxidase [Shewanella piezotolerans WP3]
    MPSSIYDFSVANIQGQSTPLKDYQGKVILIVNTASECGFTPQYKELEALYKKYQSRGFVVLGFPCNQFGAQEKGDSAAIS
    SFCELNFGVTFPLFEKIEVNGAATTPLYQYLKTEAKGLLGSERIKWNFTKFLVNKQGKVEKRFAPTTKPMAIEKNILELL


    >gi|212634501|ref|YP_002311026.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Shewanella piezotolerans WP3]
    MGKLLNLSVVEFIMIKLAPLAKLNFKTTVGVISLCANASGISHLSFVPQTGDGWQTREVLLDASNEKESISLAEAHLKQA
    KKELLEYLAGERQLFTVALAPQGTEFQQQVWHSLSQLGYGSTCSYAHIADKIGRPKAVRAVGTANGANPIAIIVP
    CHRVI
    GKNGKLTGYAYGLSLKQKLLQLEGISVV

    >gi|212634519|ref|YP_002311044.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MKHNPAFLALVESILPQINEVTIEELLANQKYTLIDVREDHEWNKGHLPNAQHLGKGIIERDIETRFPDKDMPLALYCGG
    GYRSAMAALNLQVMGYSQVVSVAGGYKAWLERQLPLETD

    >gi|212634626|ref|YP_002311151.1| glutaredoxin-like protein [Shewanella piezotolerans WP3]
    MFVIRWVLGRIILFLNFIFAPKKLKRPIAEQQKIDDVTKNMTIYEYKACPFCVKVRRSLRRQGLNIVTLDAKQEPHKNTL
    LTEGGKLQVPCLKIEDEGKATWMYESSEIIGFLDKKFA

    >gi|212634647|ref|YP_002311172.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella piezotolerans WP3]
    MSVLVGRPAPDFTAAAVLGNGEIVDTFNLSEAIKGKPTVVFFYPLDFTFVCPSELIAFDHRMDEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGQVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMDASTEGVASYLSDNADQL

    >gi|212634662|ref|YP_002311187.1| glutaredoxin 1 [Shewanella piezotolerans WP3]
    MFVVIFGRPGCPYCVRAVQVAEQLTEKREDFKFKYVDIYAEGISKADLEKTVGKPVETVPQIFVDKEHVGGCTEFEQYVR
    DNDLMPAA

    >gi|212634705|ref|YP_002311230.1| glutathione S-transferase [Shewanella piezotolerans WP3]
    MTLPTLYSFRRCPYAMRARLGIYLANRAVSLREIVLKHKPEAMLALSPKGTVPVLILQNGTVIEESFEIMCWALSQSDPN
    NLLLANSNKKQEAAKALIEYNDQVFKSWLDKYKYADRFPEHSQQYYRQQGELFVQQLESLLDKHPQLLDQAPCIADYAIY
    PFIRQFAHVDKAWFEQTDYKNVQQWLANHLQSEAFTTIMQKFPTWLESEQEFVFGGEK

    >gi|212634707|ref|YP_002311232.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MSKVVVCAMYKFVSLPDFERIQKPLLIVMEKSGIKGTLLLAKEGINGTVAGSQSAIDALLAWLATQPGLDNIVHKLSFDD
    DMPFYRTKVKLKKEIVTMGVEGIDPNEVVGTYVKPKDWNALISDPEVLLVDTRNDYEVKIGTFENALDPQTATFREFPEY
    VKQNLDPTKHKKVAMF
    CTGGIRCEKSTAYLKEQGFEDVYHLEGGILKYLEEVKQEESMWQGECFVFDNRVAVNHDLEKGQ
    YDQCNACRMPITEAEKASSQFEQGVSCPHCIDKVTDKQRERFLERERQVQLSKQRGEAHIGSDVSAVIESRRAKKEQLKK
    SQNEKSV

    >gi|212634791|ref|YP_002311316.1| DsbA oxidoreductase [Shewanella piezotolerans WP3]
    MKSLQVLFTGGLLAIVSFLLPLQSGHAAPYVEGIDYVKIAGIPEAQKPVIREFFSYNCGHCYRQDPLFEQTAHLLESDVQ
    FERTPVGAGRTSWILSQEAYYLAQKFSVTKQVHGNIFTRIHEKNGAFKRPADLQAYFVSQGVDDKAVTDAMNSADAKLAL
    MNYDTQAQLAEIKGVPSLLVNGKYLIKKQPQSPEALADMIRYLSQLEN

    >gi|212634865|ref|YP_002311390.1| thiol:disulfide interchange protein DsbE [Shewanella piezotolerans WP3]
    MKKLVLFLPLVVFLGLGVFLYKGLFLNPQKLDSALEGKPIPTFELEILEKSGETLTNETLKGKVSLLNVWATWCPSCKYE
    HPFLMTLARKDVLPIYGINYRDERALAIRELSREGNPYAINIYDHNGRLGLDLGVYGAPESFLVDHKGIIRYRYAGPIDS
    RVWKETLYPMVQELQAEAAKDGAS

    >gi|212634867|ref|YP_002311392.1| thioredoxin [Shewanella piezotolerans WP3]
    MKNIVFGLFAVTLMFAGQAQAYPGMQKQGEKEIQSSVDQISVLPKPFPIEAVPFKDSQGKPVDFSQYKGKVIMVNMWATW
    CPPCVRELPAISRFSDKIGSEEFEVLPVSIDLDGNKQVEPFLKTLGMENFTTYYDKEQSLSDVFPLDTIPATFILNREGE
    LIAFVRTFVDWDDDKAVTLIKGFLEQTQ

    >gi|212634988|ref|YP_002311513.1| thiol:disulfide interchange protein DsbA [Shewanella piezotolerans WP3]
    MKKALLVALAFIVAPMAAMAADYKEGVHYTVVNQGPATAKPEITEFFSFYCPHCYNFAKSEVPKIKAGLPEGVTFKQNHV
    DFINGNMGVEMSRAFAVAHQLKIDEKMETAIFSAIHDKKQHFTNRDDVKAIFVANGVDGKAFDAAANSFMVNAQMSQMKR
    ATQNAKISGVPALVVNGKYRVETGAIKSYDELLDIAYYLTTMK

    >gi|212635139|ref|YP_002311664.1| ThiF protein [Shewanella piezotolerans WP3]
    MAVTDKEFLHYSRQILLPEVGEQGQNRFKQSHILIIGVGGLGTLTAQYLAAAGIGKITLVDGDVVELSNLPRQLLFSKED
    LGANKAQVAAIKLMRAYEGSEIYCYQNYLNAANTQELFCSQISKFDLLLDCSDNFEVRQLVNQQAIEQGITLVSASAAHF
    QGQLLSINQQISPESGCYHCLYPSDMSVSQT
    CQTIGVLGPMVGTLASMQALMSLNLLLDVDVLKPSLDETTAKTKINGNQ
    LLGKLFRFDGGKFTWRQASLLRDPNCSVCSA

    >gi|212635172|ref|YP_002311697.1| electron transport complex Rsxe subunit [Shewanella piezotolerans WP3]
    MSDYKELAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TSVQLFINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVVKSTFDGLMMGLGFTLVLCVLGASREILGQGTLFYG
    ADQLLGEWAKGLTIQIWQVDTTFLLAMLPPGAFIGMGLLIALKNVIDNYIEARQPKVELEAPARVRITKVN

    >gi|212635177|ref|YP_002311702.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella piezotolerans WP3]
    MSEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLGYLRTMSFILV
    IAVVVQFTEMLVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNINEDHNFFESAIFGFGAAVGFSLVLILFSAMRERLAA
    ADVPAPFKGGAIAMVTAGLMSLAFMGFTGLVK

    >gi|212635249|ref|YP_002311774.1| hypothetical protein swp_2444 [Shewanella piezotolerans WP3]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPDDISEKDKTGILRSIDRCTVKKVVQTEPEFKIETVENLDTDANAMLMGQADADASTYILGKDLPLE
    QTISNMTGMLADLGMKIEISSWRNIIPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNCNFFYNDQFFGEE
    VANSEFVHYPNEKWFELEDDDSLPAGILDQHCLGIYNPDGELAGSNLIDTNSGMIERGICSIPYVRHSDGETVYIPSNLI
    ENLFLSNGMSAGNNLAEAKVQCLSEIFERAVKRQIIEQEIVLPEVPMAVLEKYPSILAGIQGLEAQGFPVVVKDASLGGQ
    FPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFDSMAVTEPENFVDHFIDSTGVISWRF
    FSSKSDFDFCEWDFSGTNEEETESLFGILAEIGKEAYIAEFDQLGASVCRILVPDYSEVYPVEDLIWDNTNKSLHYREDI
    LNLHRLGDAELADLVERLEESQLDNQTDIPTLIGIVFDENTPWGQLTIVELKILIYLALGELEDAMELVAEFLQYNDNTV
    ERGLFYQAVSAVLEVAMDEELELEDFLSNFTRMFGKEVMENVVGSVNGDVKFYGLTETSMKLEGIEPHLRLIESYKKLHK
    ARKDQM

    >gi|212635271|ref|YP_002311796.1| thioredoxin reductase [Shewanella piezotolerans WP3]
    MTQARHCNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFETEI
    IFDHINEVNLNVRPFQLKGDNGEFTCDALIISTGASAMYLGLDSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDTFRSEKILTKRLMDKVENGNIILHLDNTLEEVVGDAMGVNGLKMKSTKDGSIKDLEVAGVF
    VAIGHSPNTGMFEGQLEMNNGYIKVESGLNGNATQASIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDAK

    >gi|212635378|ref|YP_002311903.1| cation transport ATPase [Shewanella piezotolerans WP3]
    MSQISCYHCSEPVLTGTQFTTQIQNEDQPMCCPGCQAVSQAIIDAGLTNYYKFRTEPGSKQTALVPEELNSVSAYDLPEV
    QQDFIHHRDELNEVSLTIDGIT
    CAACAWLIEHQVKKLNGVVSVQVNSTTQRALIAWQADQVKLSEILNKIGAIGYQAAPF
    QIDEQETKSKKDSRKFLVRLGLAGFATMQVMMFALALYSGYFTDLDTEFRDYFRWVSMLFTAPVVFYSAQPFYFSAIRSL
    LMGRLNMDVSVSIAICGAYIASCVETINGTGEVYFESVSMFTFFLLLGRYFEQNARQKASVSSSNLHKLVPLTALLKTDK
    GIEEVPAKRLVIGDTIVVKPGDVIAADGIIIEGNSSINEAMLTGEQMPVAKSLEAQVFAGTINIEQPITIQVTALGQEQL
    VAEIIRLQEIASNSKPKIALYADRFSNYFTAAILLIATATYIFWYFYSPEDAFWVTLSVLVATCPCALALATPTAVTCGT
    AILTKLGIITRKAGVFEKLPKLNHIVFDKTGTLTLGSLSITDVEMILAGKESLPQEKVMQYAAALEASSLHPIARAFQPY
    LNQTIKVLDKKSFVGNGLQGVIDGHLVKIGSQSFINGSNAEEKEVIVWLSIDDVVQAKITLADEIRPYTEQAVTALKALG
    CNISIASGDKSGEVASLAKRLDIKNWHNGLMPEDKLALIGKLQQTNQVAMFGDGINDAPVLAGANLSVAMGSGAAISKNS
    ADIILLGDNLSRFSDAVKVAKKTGLIIKQNLFWALAYNLFIIPLAVSGHVAPYIAAIGMSASSLIVVSNSLRLLKVRV

    >gi|212635407|ref|YP_002311932.1| peptide methionine sulfoxide reductase [Shewanella piezotolerans WP3]
    MALATFGAGCFWGVEYFFKQVDGVANCVCGYMGGDNQYSSYVDVKAGITGHAEVVQVEYDPSKVSFNTLLEIFWQNHNPT
    TVNQQGDDIGDQYRSSIFFHDTLQQEQAQLAKQAIIDSKKWGKKPIVTEIVPIEQFHEAESYHQDYLAKNNLPSCHISF

    >gi|212635491|ref|YP_002312016.1| arsenate reductase [Shewanella piezotolerans WP3]
    MTLFGIKNCDTVRKARKWLEQNNLSVSFHDFREDGLSEELVKEWSAIVGWEALFNKRSTSFRNLTDAEKDDINEKKAIAL
    MVLYPTLIKRPVLAGNGKVKVGFKEAEYKAWFEL

    >gi|212635529|ref|YP_002312054.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella piezotolerans WP3]
    MHTLTVGDKAPEFTLQNQNDEAISLSKALQSGPVLVYFYPKASTPGCTVQACGLRDSQPQLNDLSVTVFGISPDPVAKLK
    KFSDKQSLNFSLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRLSFLVGQDGNIAHVFNKFKTKDHHEVVLAYLAE

    >gi|212635535|ref|YP_002312060.1| arsenate reductase [Shewanella piezotolerans WP3]
    MTNVSIIHNPRCSKSRQTLALLEEQGCEITIIEYLKTPLSATEISSIQSKLGVTPREMMRVKEDEYKQQNLADINVTDAQ
    LIQAMVNTPKLIERPIVLANDKAAIGRPPENVLTIL

    >gi|212635543|ref|YP_002312068.1| glutaredoxin-like protein [Shewanella piezotolerans WP3]
    METVDKIKQQIAENPIIVYMKGSPKLPSCGFSSQVAQIMINCEEQFAFVDILQHPDIRAELPKYANWPTFPQLWIEGELI
    GGCDILTEMFQKGELKTLIKETAAKYKTEDEQASS

    >gi|212635576|ref|YP_002312101.1| disulfide bond formation protein B [Shewanella piezotolerans WP3]
    MNALINYSQSRTAWLTLTATALALELAALFFQYVMKLDPCVMCIYQRLAIFGILFAGFLGVAGYQSRIVRFVAMGLWGGS
    AAYGLKLALELVDMQTNPSPFAT
    CSFLPEFPSWMPLHEWIPSIFMPTGMCTDIPWQMMGVTMGQWMIVAFSVYLLALVIF
    FIPALVPKTKS

    >gi|212635672|ref|YP_002312197.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella piezotolerans WP3]
    MEHYINLFIQAAFIDNMALSFFMGMCTFLAVSKKVSTSFGLGIAVIVVMTLAVPLNQIIYANVLAPGALAWAGYPALDLS
    YLQLITFIGVIAALVQILEMFLDKYIPALYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYSLGESVVFAAGSGFGWAMAIVM
    LAGLRERMKFHAIPEGLQGIGIVFITTGLMALGFMAFSGISI

    >gi|212635673|ref|YP_002312198.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella piezotolerans WP3]
    MSTQTASTRDILTSPIFSNNPVAMQVLGVCSALAVSNSMQTALVMTLAVTFVLVFSNLIISTIRSLIPNSVRIIAQMTVI
    ASLVIIVDMVLQDVAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKNPPHLAVVDAVGNAMGYGVILLGVAFVRELLGSGT
    LFGHEVLKTVENGGWYLANEMFKLPPSAFFLIGLMIWSINVIQRKRG

    >gi|212635837|ref|YP_002312362.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella piezotolerans WP3]
    MRKLTDFEKQVIEQKGTERPYSGEYYQHDVKGVYCCKKCDAPLYRSESKFNAHCGWPAFDDEISGAVKRNIDADGRRVEI
    VCAECEGHLGHVFEGEFLTPKNVRH
    CVNSVSMVFKSALEVVAPVKKTELATFGGGCFWCTEAIFSTLEGVNSVVSGYAGG
    SATDANYRAVCSGMTSHAEVVHIEFDPDVISYESLLAVFWQSHDPTTLNRQGNDSGPQYRSVVFIHSDKQAESVNAMINT
    LTKACVWQDPIVTEVAAFDGFYPAEDYHNDYFELNGEQPYCKIVVKPKVDKVKALFAELLKSN

    >gi|212635928|ref|YP_002312453.1| Phage shock protein E [Shewanella piezotolerans WP3]
    MSYMHKLQYKRSNVIVFTALTFVLFMFSKFALAVDKDVEQAWQKIDAGALIVDVRTAEEFAQGHLPNAINIPFEQIAKAF
    AERKIATDKSVVLY
    CRSGRRSGIANDALISAGYSHTYNGGGYQMLMQRQPK

    >gi|212636072|ref|YP_002312597.1| glutathione S-transferase [Shewanella piezotolerans WP3]
    MALPVLYSLRNCPYAMRARMAIYASGQQVHLRDIVLSDKPAEMLQASPKGTVPVLVTADNQVIDESLAVMLWAFTQSDPQ
    NYLGADRPNALADMLLLISLFDNEFKGHLEKYRCSKRYHEPSLMDDRMQCERYLVDLESRLCRHQYLMSDKPSLVDLALV
    PFIRQFGRVERQWYLQAPYPKLRQWLNSYLQSRMFSKVMTQYPMWLDAKQDIVFSCRA

    >gi|212636140|ref|YP_002312665.1| copper-translocating P-type ATPase [Shewanella piezotolerans WP3]
    MKTINLYVPSMSCASCVSKIESAFAQANKQTEIGTDISARVNLADKQVQVFGEITIDTAIGLIEDVGYQAELLKDPRKGA
    QQKQADEAKEYKTRLFQAAVGLGLGVPLMLWGLLGGEMMVNNSTQQLSWGIVGLVTLVVMLTTGRHFYQGMWRAIKARSA
    NMDTLIALGTSAAWIYSMLVVATPQWFPADTRHVYFEASVMILGLINLGHALELRARGKTSEAVQRLLGLQVNTAIRITD
    AGDEEVEINQLNLGDKLRLRPGDRVALDGEIVSGHTLINESMLTGEPVPVHKAEGDSVNAGTINGNGCLIYRVTAGEKDT
    KLAKIIELVQQAQTSKMPIGRLTDKISAYFVPAVILIALFSAVIWYLTGPEPALSHALVVLTSVLIIACPCALGLATPMS
    IMASVGRAAQLGVLVRNGEALQTASQITTVVLDKTGTITQGSPEVTEFIVLQPKYDEQNLLSDIAALEQHSEHPLASAIV
    AKAKQASMTLIEPEQFTNLQGRGITGTVNSAEYAIGNQSLMQHIGIDDVSAYQQQIGRLAHQGKTPVFVAKNQRLIAMIA
    ISDPIKEDAIEAISAMKNSGLKVVLLTGDNQQTANAVADIVGITTVFANVLPEQKQQKVLELQQNGEVVAMVGDGINDAP
    ALMSADIGLAMGSGTEIAIESADFTLLSARLMVVAETLLLAKASMRNIKQNLFGAFIYNSLGIPLAAGVLFPFTGMLLSP
    VVAGAAMALSSLTVVTNANRLRKEKLM

    >gi|212636213|ref|YP_002312738.1| thiol-disulfide isomerase and thioredoxin [Shewanella piezotolerans WP3]
    MYLTVNNLLHRSRLIEVSHLFFAALVLAIAVFSAALQAAESKPLAADFSLKDSRGQIHALADYKGKPLIIHFWATWCPYC
    KKLQPGLEKIRLDNQASDLQVLAISFNEDEGAKPAETLLARGIHIPTLIDGDSVAAAYGVKGTPTTFYINRLGEVVWKTN
    ISDPNDRKLVDAAEYIMAK

    >gi|212636404|ref|YP_002312929.1| OsmC-like protein [Shewanella piezotolerans WP3]
    MANKTIEVNTHMSEGWKVTADIREHQLIIDQPTGGNEGANPLETFIFSLAGCISTIAKMVAREQKIDLQQFNVSMKAQLN
    TAGLLGKPSEDPVGFKLIDVIVVMDAQMNDIQLDDEQKSLFLDTVCHRCPVHENLLKPTLVNHSVGE

    >gi|212636545|ref|YP_002313070.1| glutamate synthase subunit beta [Shewanella piezotolerans WP3]
    MSNDFQFIEVGRKDPTKHAAKQRATQFIEIYQPFAQPQVKEQADRCLDCGNPYCEWKCPLHNYIPNWLQLAKQGRIMEAA
    DLVHETNTLPEICGRVCPQDRLCEGACTLNEEFGAVTIGNVEKYITDTAISQGWRPDMSKVTARKERVAIIGAGPAGLGC
    ADILARNGVQAVVYDKNVQIGGLLTYGIPSFKLDKEVMQIRRNVLEGMGIEFKLGVTVGKDVDFKELIENYDAVFLGMGT
    YTAMKANLVGEDATGVHQALPYLIGNTHNVMGTE
    CADNPYLSLEGKRVVVLGGGDTAMDCVRTAVRQGATQVTCAYRRDE
    ENMPGSRREVQNAREEGVEFLFNRQPSEIKTIDGKVVGIECIETELGDADESGRRRPQPIAGSEQVLDADAIIIAFGFQP
    SPAKWLGDYNIELNDWGLVKAPKVADNPFQTSNPKVFAGGDMVRGSDLVVTAIAEGRDAAMGILNFFED

    >gi|212636588|ref|YP_002313113.1| iron-sulfur cluster insertion protein ErpA [Shewanella piezotolerans WP3]
    MTEQAEDALPISFTDAAALKVKTLLDEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|212636622|ref|YP_002313147.1| hypothetical protein swp_3883 [Shewanella piezotolerans WP3]
    MDKKAPSKPMLARVLNGVKQLAIMLLLFTLFSAAIDLWRSKDIPTDNLPDLQAMTLNGNGVDVLAMSYQEPVLVYFWGTW
    CLVCSFVSPSVDIMASQYSVVTVAMNSGEDEKLSQYLKHKQYDFPVINDHRGRLAHDWSVNVTPTLMVIKDGELQFYTSG
    FTSLPGMWWRMLLA

    >gi|212636623|ref|YP_002313148.1| DsbA oxidoreductase [Shewanella piezotolerans WP3]
    MNFTIKIKAIIGVTFAIIATFITIQAISSTTVNAANTSLNTAQQQEVRAIVKEMLVNDPDLLKEAVIAMQIREQGSQQAS
    VKSLIKQHQQSLFNSKTDPWKGAENPELTMVYFTDFN
    CPYCKKLEPELEQLMAAFPQLKIIIKMVPLQGKGAEDAVDLAQ
    TVWLNEPEKYQALKDTLMAAPRRLDSATIAKVAKLTKTQDWLNQKDSRVDSIVDNNLQLMRQLGFRGTPSMIIGEQVIPG
    LVPFETLKKAVESALEEQKDG

    >gi|212636624|ref|YP_002313149.1| cytochrome c biogenesis transmembrane protein [Shewanella piezotolerans WP3]
    MSVTEIKLKTIKYFLLVLSLLSSSVLAQSTDWIENPNHPPVQVRFMLTGELDPVSNTLPAVLEVKLDDDWKTYWRSPGEG
    GIAPSIKWDTSGNLADVSWDWPAPEAFSLLGLQTFGYKHDVVFPMQVKVKDINQPFELKGLLTLSSCTNICVLTDYDINL
    DVDLKTITADPGAMFAYNKAKVSVPQRKTSADINLGWDNSKQQLQVILKEGEWQYPQVIIDGEPDVSFKLKHIETTEDEQ
    GSKQLKAVFDGSSWLGEADVIGKSLNITLIEAENAIEYTAVVTAAEIVNHSSPLWTMMLIALLGGLILNVMPCVLPVLGM
    KLSAVVAAPDLNKTQIRQQFLASALGILVSFWLLAGFILTLKMTGQAIGWGVQFQNPWFIGFMALVTSVFAINMLGAFEI
    NLPSSLQTKLATSGGNDNRGHFLQGMFATLLATPCSAPFLGTAVAFALGADVVSLFVIFTALAVGMALPWLLVAAAPQVA
    NYFPKPGRWMSVVKVIFAGLLLLTSLWLISLLANFISAGILWGVAAILLLLFIVLMARLHGAAAVIASVSMAILISAITA
    FATSDNWARPLPTDLSWTPLQQSDIQAQVAKGQTVFVDVTADW
    CITCKANKVGVILQDPVYSRLKQADMELVIGDWTKPS
    APITNYLQSHNRYGVPFNVVYGPNAPDGIELPVILTAKQVIDAINQASAQL

    >gi|212636745|ref|YP_002313270.1| hypothetical protein swp_4013 [Shewanella piezotolerans WP3]
    MSNQVIDLGFDFDNSYANELEGFYVSCQGEKAPSPELVKLNIALAEQLGISNRDHAQLAEVFSGSEAPQGAAPLAQVYAG
    HQFGGFSPQLGDGRALLLGEVLDSSGKRQDIQLKGSGRTQFSRGGDGKAVLGAILREYILCEAMHALGIATTRALAVVTT
    GEPIYRTRYLPGAVLTRVASSHIRVGTFEYFAAQGAEDKVKQLADYAIARHYPELKQSSQPYLDLVCAVRDKQAQLIAQW
    MLVGFVHGVMNTDNMTISGETIDYGPCAFMDDYDARALFSSIDQDGRYSYSNQPAMAQWDLARFAETLLPFIDEDTDKAI
    ELATTEIKAFWEQFRAHWLQGMRAKIGMMTELDGDYELCEQLLAAMQGQAVDYTQLFRLLADDLLTDSNDAESLFTDSSL
    FMQWKPLWLVRLAQESLSAKESVELMNSVNPIYIPRNHLVEAAIEAAEERNDYQPFETLVNVLAQPFTRQQGREDYAQPA
    PASFGKFTTY
    CGT

    >gi|212636773|ref|YP_002313298.1| DsbA oxidoreductase [Shewanella piezotolerans WP3]
    MIKHIALALTLVVAPMSSFAAQFIEGKHFTVVTNKAPSSEPKLTEFYSFFCGNCFNMEKMYLPDIKANLNKQVAFDSKHV
    DFANTEINTEVMRSLAVIQTLDNPKPLTDAMFKVIQGDNGEKHDHGAAGHKHAEPLKSRDDIKAVFAKFGVDSAQYDATA
    DSKETNAKLALWRAQQQEFRVQSVPAFVVNDKYAVNMSSVRTLGELIDLINYLAVEYK

    >gi|212636874|ref|YP_002313399.1| disulfide bond formation protein DsbB [Shewanella piezotolerans WP3]
    MITNFKQWLSQLRQQPLLTLEATQELRTVWTVMVFACVFLLGSAMGYFQWFLEMAPCENCVYIRFSQFCILIAGVIIIIN
    PKHTLLKIIGLVLAWYGIIYGLDKAIILSGQHVASHAADTGLDLFQSGQGANA
    CSLEPKFPLGLPLHEWLPYEFAPSGIC
    GEDDWSLFGLNMAQYCIISYCVFIACALPLTIAFITKMLKRGK

    >gi|212636875|ref|YP_002313400.1| disulfide isomerase [Shewanella piezotolerans WP3]
    MTFTASAANVIDIDTPALDNTVQKVYSVYCPFCYKYEKSVTPNLIKNLPSGTDFQGVCLENKGELGTEACEVLAAADTIS
    HEKYKAAKLAMYSAVHDKKLKNVKGAGAIKGDLAAIGLAAAEISQQDFETALSSAAAQDKLAYDRTIALTIAKVKGIPAI
    VISGNKLVDTSTVSSLSDLDKTIKNNL

    >gi|212636924|ref|YP_002313449.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella piezotolerans WP3]
    MLKKTLVVLSLTLSTLLFSLPIFAKPIALDELNVMPLMNGQTIPSASLKDLNGNSVDIAKLTAGKPSIIFFYRGGWCPFC
    NSQMGQLQAIEPQLLEMGYQLIGISPDTPEKLTASMTKQELSYTLLSDANLAASKAFGLAYFTSAKTTARYTSKMKLENK
    LWQTPTGESRLVLPVPAVYISDASGLVHFQYVNPNFRVRPAPELIITAAKLALK

    >gi|212636944|ref|YP_002313469.1| thiol:disulfide interchange protein DsbC [Shewanella piezotolerans WP3]
    MKFTRAFSLIIAMVIAPAALAGSNTQSDDTAAIKQKLSDTLSVDVMSLKESPIPGLYEALTNRGVLYISKDGTKLLHGNL
    YDLDKGMKNLTEAAMSGPRIDMMKPLEKNMLVYKAKNEKHVVTVFTDVD
    CGYCRKLHNQMDEYNDLGITVRYLAFPRAGI
    PSANADEMEAVWCAADPLQAMTDAKSGKSVKVAKCDAKIAEQYNLGQTFGINGTPAIVLEDGSLIPGYQPPKDLLRVLDA
    AAAE

    >gi|212637031|ref|YP_002313556.1| Redox protein, regulator of disulfide bond formation [Shewanella piezotolerans WP3]
    MKTLYQTTANATAGRNGIAKTEDGLLEVNLSYPKEMGGAGNATNPEQLFAAGYAACFSNAILHVAREQKIAINAAPVSAT
    IGIGANQSGGFALSAALAIELELEQTVAVELVRIAHQV
    CPYSNAIRNNIEVELTVNKQVLA

    >gi|212637033|ref|YP_002313558.1| hypothetical protein swp_4323 [Shewanella piezotolerans WP3]
    MAKYILLLVTLLFSSFSLPSFAASPAEPATVWHYTNDAGELKVKLYFFWSQTCPHCKEAHPFIDSLPERYPWIEVEDHLI
    SDPGTMDIWQSIAKQTGTQARSVPFFASGEKAVVGYSSQAVTGEFLLSRLKSYYVSLGGKLKPGDNSGYTAPMASASGAF
    FETCSESADEGTCDLGLETTSPITTSDVQPVEIPLVGVVHPEQMSLPLLTVVLAGVDAFNPCAFFVLLFLLSIMVNAKSR
    TRMLIVGGIFVFFSGFIYFIFMSAWLNIFQLLGAGSDGGLIILGAGILALIAGAVNIKDYFFTKGEVTLSMSAENRTGLI
    KRMGKLTSASSMTAMIAGTVVLSILANAYELLCTAGFPMIYTSVLSMHDLEAAERYMYLVFYNIVYVIPLAIIVIAFSIS
    LGKRKLTEKEGQTLKLMSGIMMVGLGGMLAMDPTALQNVVLAIGLILSSIVLTFVITLTRKMVEKRKKKLG

    >gi|212637036|ref|YP_002313561.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella piezotolerans WP3]
    MLDANVKNQLNTYLQNLKHPVELVVSADDSKKAQELKSLASDIDSLSSFISVTEKVGKRTPSMAVINPQLASQITFAGLP
    MGHEFTSLVLALLHSGGHPIKLDADVIAQIRDLPGEYQFETYVSLS
    CQTCPEVVQALNMMAAINPNITNVMIDGSLFQDE
    VNERNVMAVPAVFLNGEQFSMGAISTVEILNKLDVNAAGRKAEQLNEKEPFEVLVVGGGPAGASAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDSQRALSLKSGELFELTLESGAVLRSKTILLATGARW
    REMNVPGEQEYRGSGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSTLRADDVLQRKARSMGNI
    EIITQAMTTEVTGDGKRVNGLNYTNRATGESHHVELAGIFVQIGLVPNSEWLQETIDMTARGEIIVDAKGETSLPGVFAA
    GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHSVDEAVTA

    >gi|212637037|ref|YP_002313562.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella piezotolerans WP3]
    MHQSIINSTIKPFSATAFHNGDFHPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQSMGVEVYSVSTDTHFT
    HKAWHASSDTINKIQYPMIGDPTGAITRNFGVMIEEDGLALRGTFVINPEGEIKVAEVHDLGIGRSASELVRKIQAAQYV
    ATHDGEVCPAAWQPGEATLAPSIDLVGKI

    >gi|212637082|ref|YP_002313607.1| glutathione S-transferase [Shewanella piezotolerans WP3]
    MSRFLSLAVELVVHGLLIICVFSNSIASQEVTKHFIYSELTMIKLISFKNCPFVQRVMGALVSKNIPFEIEYIELSNKPQ
    WFLDISPNGQVPVLITEDETVLFESDAIVEYLDDKYAPIEQVSAEQKALDRAWSYQASKHYMAQCGTMGSKDQETFEARL
    AKLSKSFAKAENKLGDSAFFKGSTISNVDIAWLPILHRADVIKRCSGFDMLDGFPKVQKWQAALIESGLADKTVPDDFVN
    SFSNFYLKNTYLASLVAGAVINGKASCCATDSCCA

    >gi|212637225|ref|YP_002313750.1| thiol:disulfide interchange protein [Shewanella piezotolerans WP3]
    MDKRNHTAMKKIITLFLASLLMLSPLVQAESIFNSSKFSFLKGEPELMPVDEAFVFDFKQEGDKVKISWVIADGYYMYRD
    KLKFEANGAVLVEIALPEGKSHTDEYFGEQEVYYSFVEIPVAIKQAAAGDTLNVTFMGCAEGKLCFPPTKKVAELTEVST
    NDGVLDLQQNNEIATATNEPNAPITQQDNLTQMLASDSLIWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGKKLSTA
    KAFSLSMVYVQGMAITYSLVGLVVASAGMKYQAYLQHPAVLIALAIMFFVLSLSMFGLYDLKLPSKWQEKMNTVSNNQKG
    GNVIGVFLMGVISGLVASPCTTAPLSGALIYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKILPRAGSWMDIIKTI
    FGFLLIAVSIVMLGRIWPGLISDILWSVWGISIVGYLMHQNKLTEFNWKQTTRAVLLLLALLGSFSYGLQAVMSHFGFVS
    NSSVTLATGEQNHSFKRVKSLEDLDREIAAASAQGKTVMLDLYADW
    CVACKEFEAITFKDAAVLERMNKMVLLQADVTKN
    DAVDIELLEHYDVLGLPTLLMFDENGAVRDDLRVTGFMRPKAFAEHLDHLVK

    >gi|212637307|ref|YP_002313832.1| aminotransferase, class V [Shewanella piezotolerans WP3]
    MKNTTELTQIYLDANATTPVLPEAAAAALSAMENLFGNPSSSHITGLKAKNLMEQTRLRAQTLLGSGEGKIIFTSGATEG
    IQTSILSALIAAKSRMSADKNYSVLYGATEHKAVPESLKHWLTVLDIKAEVTAIPVDQFGLLDHDFIRQHAPSALMICTM
    AVNNETGVFQNLKSLEATIRSANSDIFWMVDCVQALGKTELDLKTTTIDYAPFSGHKLYAPKGIGFVYIRDSAPFTPFIA
    GGGQESGLRSGTENLPGLAALNVIFEMLLSQEGSPFSSSAQLTQYRQQIADTLTECFSDIVFNNSFEHSVATTINFAVPS
    FSSKEIMDLFDAANIRVSSGSACSSKVTRSFVLDAMGLPAWQSEAAIRMSFGPAITQAEVDTACARIKTASQALTQSCMI
    LDDSSDISDRTDLDGLLQLRSGASCTWVFVDSLSKQALIIDPLPELKQRLETLLECQQLTLVAAIDTHGHADHVSGREAL
    ASRYLAEQESDHLGWPVTENRVQHLAQQLQVISIGTKQLLRLPTPGHTSDSISLLLCSAPSASNHTAEHTQYAFCGDTIL
    MGSLGRTNFESSSSVALFNSLKLIRDSISSTALICASHDYNNEFTTSLKAEINRNDLLKGVLSNQLSMDDFQQRKAHLDT
    HLNDEVGTEIMCGALIGNCDKFKIKEYDAFSLAAAMKQDENVCIIDIREPHEYALNHSTQSSLNVPLTRLVQFIQEHQNQ
    KNRQWVLV
    CRSGSRSMIAAQAMHRLGFEQVSHLKGGYALSS

    >gi|212637331|ref|YP_002313856.1| lipoprotein [Shewanella piezotolerans WP3]
    MRALTLIFSSLLLFITSGCATNAGHSADQEKPEYLTYVKAGDKVPVTQFIDTQGNTIDLSKSSNNKLLILFATWCHDSQR
    TMKHLTASDLYLSPNVDIIGVGREEDKQTLDKFAKEYELNFALVADSDRSIYNQFANIGIPRLILLDANNEVVKTLVGET
    ENVITEVIW

    >gi|212637354|ref|YP_002313879.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MKKALGQILVTLTLVASSASCLAGGGSEMAPAPRYEHQLNTITMREAEMLLEQGGVTFFDVNTLELWAEGYIPGAIYFNI
    QDWRTLLPEKKDTPMVFY
    CANRICNASEIAARAVMKMGYTNVKQMPDGIYGWRLSNRVIEKP

    >gi|212637358|ref|YP_002313883.1| thioredoxin [Shewanella piezotolerans WP3]
    MTKSLMHKGFKAKQRLLSSVVFISLSLGLAFSTLASVPTNKVYDTGEPIEKPMIMSRFVEMSAARQVPDVSFSDTKGDAV
    NLKQFDGKVVLVSLWATW
    CSPCIKEIPQMEAIRQANINNDLVVLPISIDEESDKVAAFLERHDLSYYQTWLDPEMNIGQV
    MPADIVPATYVFDGSGNLIGFLRGYLDWGDKNIQPYLEKLIDKYAKR

    >gi|212637415|ref|YP_002313940.1| thiol:disulfide interchange protein DsbA [Shewanella piezotolerans WP3]
    MKKLLTLLLLTFVVIGCGDKNATDANYVEGVNYRALATPIATDGEQIEVMEFFWYGCPHCESFEKPLHQWQKTMAADVHL
    VQSPAIWNDLMKLHAKVFFIVQNMADADKAHAALFQEVMGLREIRDIKLQTQKLAEFLQRFGLSQTDFERQLASAEINQQ
    LAQAIKLMSQSEVDGTPSIVVNGRYLVLNQSAKSFEQVLDITRFLVEKEKGRLAEN

    >gi|212637442|ref|YP_002313967.1| dihydrolipoamide dehydrogenase [Shewanella piezotolerans WP3]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIVERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKAVADHGVVFGEPK
    IDLDKLRGFKEKVIGQLTGGLGGMSKMRKVDVVNGLGKFTGPNTLEVQGEDGVKVVHFEHAIIAAGSRPIQLPFIPHEDP
    RIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRTFTKQIKKKFNLILQTKVTA
    VEAKEDGIYVTMEGKKAPSEPVRYDAVLVAIGRTPNGKGLDAEKAGVNVDERGFINVDKQMRTNVPNIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGVSYETATFPWAASGRAIASDASEGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKKKK

    >gi|212637553|ref|YP_002314078.1| AhpC/Tsa family antioxidant [Shewanella piezotolerans WP3]
    MIEQGQALPAGVLSELTDDGMLNHQVDALFADKKVVLFAVPGAFTPTCSEAHLPGFVVMADEFKARGVDIIACVSVNDAF
    VMKAWGVAQNASELMMLADGDASFTKALGLEMETAGFGGTRSQRYAMVVDNGVVTTLNVEAPKSFEVSTAEAVLAAI

    >gi|212637609|ref|YP_002314134.1| glutathione reductase [Shewanella piezotolerans WP3]
    MAQHFDYICLGAGSGGIASGNRAAMRGAKVLVIEAKHVGGTCVNVGCVPKKVMWYGAHVAESMHLFAKDYGFDVTVNNFN
    WNTLVDNREAYISRIHDAYGRGFASNNVTLLNGYGKFINANTIEVDGEHYTADHILIATGGAPTIPNIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVELAGVLHALGSETHLLVRKHAPLRNFDPILTDTLVEAMKINGPTLHTHSIPKAVVKNADD
    SLTLELENGDSITVDSLIWAIGRSPSTSNIGLENTDVKLNEKGYVVTDEQQNTTAKGIYCVGDIMEGGVELTPVAVKAGR
    LLSERLFGNMPDAKMDYSVIPTVVFSHPPIGTMGLTEPEAEEQFGKDNIKVYTSGFTSMYTAITAHREACKMKLICAGED
    EVVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|212637745|ref|YP_002314270.1| rhodanese-like protein [Shewanella piezotolerans WP3]
    MSAFQHLSVNQLIHMQEATADLQIVDIRDAASFEAGHIDSSFNLSNENISHFIAQADMDQPLIVVCYHGISSQSAATYLN
    EQGFDNVYSLDGGYSAWHQANT

    >gi|212637776|ref|YP_002314301.1| glutathione S-transferase [Shewanella piezotolerans WP3]
    MLKIVSYVICPFVQRITGLLEAKGVPYEIEYISLKDKPQWFLDIAPNGQVPLLITEDNIALFESDAIAEYLDDEFPLLRP
    EINKSACRARQRAWVFQGTKLYLKQCSHMQSGNQQIFEERQESMHNQFAKVESFLSGHTGTKYFCADIIGNIDIAWLPLF
    HRAALVQKHSGTKLFEGFPLLQIWADNVMATGIAAKTVHDSFEDSFVNFYLSDKTYLGGGNKTSNGGCGGSSISCCG

    >gi|212637829|ref|YP_002314354.1| hypothetical protein swp_5152 [Shewanella piezotolerans WP3]
    MLEIIIARGNLVKFCGCCMYSRDLAELKVIKGCDVATMDDLALRVIIAIKLLLFNHYSI

    >gi|212634995|ref|YP_002311520.1| iron-sulfur binding 4Fe-4S ferredoxin [Shewanella piezotolerans WP3]
    MVIDLQKCVGCGGCDLACKTENNTPDGIQWSSHLNVTEGRFPDVKYSYVPTMCNHCSDAACVKVCPTGAMYKDKRGLTLQ
    DNDKCIGCRKCMRACPYGVISYNKQKPHRKWQDDQALLEGATASPYMLLKKVDNKVVPYLNPERGDTYPVTRSRRTTEKC
    TFCDHRLDQGLNPACVSACPSNARVFGDLDDPQSEAARLIAMHKTQQLNLDANTNPNVYYIRSFNVKTLY

    >gi|212633333|ref|YP_002309858.1| thioredoxin family protein [Shewanella piezotolerans WP3]
    MANSGCAFEEGEQEGFMATCSEEKQEVILTGLVSNEQLNVLDWFSQEYSEYKADQATIAQLKTITVPTEITVIIGTWCPD
    CHRETPRFIRIMEQVNNPNITVQFIGVDRAKEDPQGLAKHYEFSRIPTIIVEQKGAEIGRIVERPEVTLEKDLANILKL