Shewanella pealeana ATCC 700345 uid58705

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157959935|ref|YP_001499969.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MSAFQHLSVNQLIQMQSESDELQIVDIRDAASYEAGHILGSVNLTNENLARFIGDADMDLPLIVVCYHGISSQSAATYLN
    EQGFDDVFSLDGGYSAWHQANL

    >gi|157959957|ref|YP_001499991.1| molybdopterin biosynthesis protein MoeB [Shewanella pealeana ATCC 700345]
    MSTEQIATDEILSDAEILRYSRQISIKSMDFEGQEKLKQAKVLIIGAGGLGCAASQYLAVAGAGSMTLVDFDTVEISNLQ
    RQVLHQDANVGQAKVDSAKQSLTALNPHIQIETINAVLDDHEIDALVEQHSIVMDCTDNVAVREQLNQSCFKHKKPLISA
    AAIRMEGMVTVFDYQDDTPCYHCFSKLFGEQQLS
    CVESGILAPVVGMIGCLQAVEAIKVIANMGQTLAGRILMIDAMTME
    FREMKLPKLPQCKVCS

    >gi|157959991|ref|YP_001500025.1| selenide, water dikinase [Shewanella pealeana ATCC 700345]
    MSDSEIKLTEYSHGAGCGCKISPKVLGTILATQLPVFDDPNLLVGNQTRDDAAVYKLNETTGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPMMAIAILGWPVNKLPAEVAQQVVDGGRKACADAGIMLAGGHSIDSPEPIFGLAVTGQIPLD
    ELKQNDTAKAGDKLYLTKPLGIGILTTAQKQKKLADADLNTAAEAMCQLNVLGPKIAKISQVNALTDVTGFGLAGHLLEM
    CHGADLSAKLDISLLPLLPNARHYLQLGCIPGGTHRNFDSYGEHLPELTEEQKAIICDPQTSGGLLIAVATDSEAALQTL
    LADNGIEPICIGQLVEKNAAMTVELI

    >gi|157960048|ref|YP_001500082.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella pealeana ATCC 700345]
    MKKLVLFIPLVVFLGMGVFLYKGLFLNPQQLDSALEGKPIPAFQLEVLEKSGETVTNETLKGKVGLLNVWATWCPSCKYE
    HPFLMTLARQKILPIYGINYRDDRPLAIRELSREGNPYAINIYDHDGRLGLDLGVYGAPESFLIDHKGIIRYRYAGPIDR
    NVWKDTLYPMVQQLQAEAAKDGAS

    >gi|157960050|ref|YP_001500084.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MRSTIVGLAAATMLFAAGAQAYPGMEKQAEKQVQSSVDLISVLPKPFPIEAVAFKNSEGASVDFSQYKGKVIMVNMWATW
    CPPCVRELPAISRFSAKIGSDDFEVLPVSIDLEGNKQVEPFLKSLGMEDFNTYYDKEQKLGNVFPLDTIPATFILNREGE
    LIAFVRTFVDWDDDKAVTLIKGFLAEPQLSSSLTKNAD

    >gi|157960137|ref|YP_001500171.1| hypothetical protein Spea_0308 [Shewanella pealeana ATCC 700345]
    MRLKQDFFEQLPEFYSQVFPLGISNPHWLAWSQDAADLIEIKQPSDELLQGLSGNAHVDGASYYAQVYSGHQFGGYSPQL
    GDGRSIILGEALGPQGAWDVALKGAGPTPYSRHGDGRAVMRSAVREFLISEALHHLHIPTTRALAVIGSDLPVWRESQET
    AAITVRLAKSHIRFGHFEYFCHSERGAPAKLKQLLDFTIKQHYPDLSCDAVGYKAWFTRVVADTAKMIANWQAIGFAHGV
    MNTDNMSILGDTFDFGPFAFLDTFKEGFICNHSDPEGRYAFGQQPGIGLWNLQRLAQALSPIIASDDLIESLNQYQVELV
    KHYLLLMRGKLGLKTSAAEAEQDDHDLALIGAFTGLMERNQLDHTNTWRRFGQLDPNASHSSLRDDFVDLHGFDTWYQAY
    QVRLGSVDEVGLWQKERNQVNPKYILRNYLAQEAIIAVELGDLKPLHNLQRLLQNPFDEQLEFEDMAKRPPDWGQGLIMS
    CSS

    >gi|157960140|ref|YP_001500174.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MKKALLVAFALLMAPMAAMAAQYEEGVHYTVINEGPGTAKPEIAEFFSFYCPHCYTFAKEQVPKIKATLPDGVTFKQNHV
    EFIGREMGVEMSRAFAIAHQLKIEEKMEHALFSAIQDKKQRFTNLDDIKALFVVNGVDPKAFDAAAKSFMVNAQMSKMKR
    DTENAKIAGVPALVVNGKYRVETGAIKSYQELLDIAYYLATQK

    >gi|157960169|ref|YP_001500203.1| flavocytochrome c [Shewanella pealeana ATCC 700345]
    MKRRDFLTKSMGVTAAMALPFSATAVSSENSWDREYDLIIVGSGFAGLAAAYSANKAGLKNILILEKMETWGGNSAICGG
    IACMPNTSLQKKHGIEDSAELMIKDMVKAGRGFNHPELCKTLATEAHTVYDMLIGCGVEFMDKIIRLGGHSAPRAHIPAN
    ASGGGIVVPMHKYLVNKGVQFQNRTQVTSLLRDKNNAITGVAVQEKFDFETEEFKAEQTYKSRHGVVVATGGWGQDKKFV
    KTTMPIYAHLEATAHPGATAGMIKSLLAVGSLPIMLDMYQLGPWASPDEKGAGPASFFADYSFSEGIAIDPMTGKRFMNE
    LADRRTRAEAQLVVLEKGSEEKPNYPFTFCSEATTKRAEGFKGAYRDGAVNKSNSVAELAKHHGVDEAVLSQSIADWNEI
    VEGKPDPFNKPLDRRTELKPPFYSLRLSPKLHYCMGGVAITPNAEVIDATTCEPIKGLFAAGEVAGGTHGMDRLGGCSSV
    DGLVFGQIAGRTAANYKANA

    >gi|157960227|ref|YP_001500261.1| thioredoxin [Shewanella pealeana ATCC 700345]
    MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYEGKIKIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKAGELAATKVGALSKTQLKEFIDAQL

    >gi|157960250|ref|YP_001500284.1| dihydrolipoamide dehydrogenase [Shewanella pealeana ATCC 700345]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKAVSNHGVVFGEPQ
    IDLDKLREYKQSVIGQLTNGLGGMSKMRKVNVVNGLGKFTGPNTLEVQGEDGVKVVHFEQAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVYTKKIKKKFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPVRYDAVLVAIGRVPNGKGLDAEKAGVNVDERGFINVDKQMRTNVPNIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGVAYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKK

    >gi|157960264|ref|YP_001500298.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MIKILVTLFLVLAMSACSEPSHLGSDGNYVAGVHYRELATPIPASGDDISVTEFFWYGCPHCELFEKPLHKWQQTMADGV
    VLVQSPAVWNEAMKLHAKVFFIVQQMPDKQKIHAALFNEIVGLREITDLDEQQAKLSDFLAGYGLSEQAFNDKLNSADII
    SKLKQAMLLMSSAGIQGTPTILVNGRYIILNESANSAEQVMDIASYLVELERQNLLAM

    >gi|157960274|ref|YP_001500308.1| putative inner membrane protein [Shewanella pealeana ATCC 700345]
    MWLTFKNQFFIKFWSPFAAVIAAGILSTYFFGLTGSLWAVTGEFTRWGGHVLQWFGAEPESWQYFKIIGLNGTPLDRVGG
    VMIIGMFGGCMAAVLWANNLKLRMPSSKKRIAQALIGGMIAGFGARLAMG
    CNLAAFFTGIPQFTLHAWIFAFAAAAGTYI
    GAKITLMPFFRSSATLKAGGLKKIVKPNPNQVQNRFRLGWLVFAAMIGLSLYIMQSSTKLGIAMLMGMMFGLLIERAQIC
    FTSAFRDMWITGRTHMAKAIILGMAVSVIGIYSYVQLGMTPKTLWAGPNAVIGGLLFGIGIVIAGG
    CETGWMYRALEGQV
    HFWWVGLGNIIGATILAYYWDVVAEPLATSWDKINLLDVFGPLGGLGVTYLLLGLSFVLILMWEHHFFKKQKSQQQAAAA
    KLAELKAELKLAPAAIATSATQA

    >gi|157960305|ref|YP_001500339.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MPAQAQVASTKVYNTGKAIEKPLIMSRFIEMQSARSVPEVMFTDTKGKQISLKQYKGKLVLVNLWATWCAPCIKEIPQME
    NIRQVNKNNDLVVVPISIDEESDKVQAFLERHELGHYQTWLDPKKTIDQIMPADVVPATYVFDGSGNLVGFLRGYLDWGD
    KEVQPYLEKLTAKYAKR

    >gi|157960309|ref|YP_001500343.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MNRVLGSVVFTVLLSMLSAGSYAGGGQEMAPAKYYDEPLNTITMIEAETLVGKEGVYFFDVNTLELWAEGFIPGAVYFNV
    KNWKDLLPKNKDAQLVLY
    CANRLCNASEIAARHVMKLGYTNVRQMPDGIYGWRLSNRVTEKP

    >gi|157960331|ref|YP_001500365.1| glutathione S-transferase domain-containing protein [Shewanella pealeana ATCC 700345]
    MLKIVSYVICPFVQRITGLLEAKGVSYQIEYISLKDKPQWFLDIAPNGQVPVLITEDNIALSESDAIAEYLDDEYPLLRP
    EVNKSACRARQRAWVYQASKLYLKQCSHMQSPTQQVFEERQEYLQNQFAKVESFLKDHTDSQYFCANVIGNIDIAWLPLF
    HRAALVQKHTGMRLFENFPLLQTWADNIMATGLAEKTVHDSFEARFVNFYLSDKTYLGSGNKRNNQSCNTSSTSCCA

    >gi|157960333|ref|YP_001500367.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MTAEAIERKMMKKALGQILVTLSLLASSASCLAGSGSDMGPAHRYEHQLNTISMMEAGTLVGKEGVYFFDVNTLELWAEG
    YIPGAIYFNVKDWKKLLPANKDALMVFYCANRL
    CNASEVAAHSVMKMGYTNVKQMPDGIYGWRLANRVTERP

    >gi|157960354|ref|YP_001500388.1| redoxin domain-containing protein [Shewanella pealeana ATCC 700345]
    MKAFSTKKAFAKIKALSGIKALSTLRALKLLFTSLLLLTINGCATAPSQVEYLTYVKTGDSVPVSRFVDTQGNTLDLSES
    KNNKLLILFATW
    CSDSQRTMKHLAGSDLHLSPNVDIIGIGREESNSALDKFATEYELNFPLVADTDRQIYAQFANAGIPR
    LILLDANNKVVKTIIGETENTITKVVW

    >gi|157960373|ref|YP_001500407.1| aminotransferase class V [Shewanella pealeana ATCC 700345]
    MHNHNELTQVYLDANATTPVLPEAAAAALAAMQTLFGNPSSSHITGLQAKHLMEQTRTRAHTLLGTGEGKLIFTSGATEG
    IQTAILSALLAAKKQIQTGQTYKLLYGATEHKAVPESLKHWLTVLDIPAQIMAIPVDEFGILDYEFIAQHVPNALMICTM
    AVNNETGVFQDLKQLEKTIRDANPDTFWMVDCVQALGKTALNLAQTSIDYAPFSGHKLYAPKGIGFVYIRDGAPFTPFIA
    GGGQESGLRSGTENLPGMAALNVIFKMLQCPQDSAFSDQQTLQGYRQQIADTLTECFPRIVFNNSFEHSVPTTINFAVPS
    FSSKEIMDLFDAANIRVSSGSACSSKVTRSFVLDAMGLPAWQSESAIRMSFGPAMTQADVDIACERIKTASQALTQSCMV
    LDRSRDIDDKTPLDGLLQLGAGASCTWIYVDNNSKQAVIIDPLPELQHRLDTLLQCQQLEVKAIIDTHGHADHVSGRDVL
    ANRYLANQDSDILGWPYQTQTVEHLGIQYESIEIGSLQLVKVPTPGHTADSISLILCPLNLGDKTLHQQAKFAFCGDTIL
    MGSLGRTNFDSSSSQALFHSLKLLNCTINPATLICASHDYNHEFTTTLPAEMSRNTLLNAVLMDQVSVDDFIARKAKLDS
    HLNDEVGTEIMCGAYVGSCDKSAIKEYDAKSLAAAIDSKDEVRIIDIREPHEYALSHPQESSQNVPLTRLVQFIHEQQHQ
    KDKPWVLV
    CRSGSRSMVAAQAMHRLGFSQISHLKGGYALSH

    >gi|157960412|ref|YP_001500446.1| thiol:disulfide interchange protein precursor [Shewanella pealeana ATCC 700345]
    MKRIINLFLASLLLLTPLAHAEGIFSSNKFDFLKGEPELMPVDQAFVFDFKQQGDQVKISWVIADGYYMYRDKLKFEASD
    GAVLGEIALPQGKPHTDEYFGEQEVYYTYVEMPVAIKESSAGGKLNVTFMGCAEGKLCFPPTKKTAELTQIAANDGLLSD
    SDKSLGSVDATATPADATSAPITQQDTLSAMLSGDSLIWTLVIFFGLGVGLALTPCVFPMYPILSGIIVGQGKKLSTAKA
    FTLSMVYVQGMAITYSLVGLVVASAGMKYQAALQHPAVLIVLAILFFVLSLSMFGLYDLKLPSKWQEKMNSFSNNQKGGN
    VIGVFIMGIISGLVASPCTTAPLSGALIYVAQTGDLMQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGSWMDVIKTIFG
    FLLIAVSIVMLGRIWPGFISDLLWSIWGIALVGYLMHQNKITEFNWKQTVRSVLLMLALLASFSYGMQAVMAKLGFSSNT
    AAINSSEAQGHAFKRIKSLEDLHTEVAAATAQGKTVMVDFYADW
    CVACKEFEAITFKDAMVLERMNKMVLLQADVTKNDD
    IDIELLEHYNILGLPTLLMFDENGAIRDDLRVTGFMRPKAFAEHLDHLVK

    >gi|157960486|ref|YP_001500520.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MIKQLSKLGFIALLLLPLSALATDLKVGDMAPDFKLQATDGHFYQLSDYRGKQTLVLAWYPMANTHGCTLECKSLVEKGH
    LIRKFNAVYMMASVDDLEDNQAFAREQKADFPMLSDPSKETAKAYDVLNFVRVASRVTFYIGQDGKILKIDEDINAKTAA
    EDIAATLEELNIDKVNQEPVIQE

    >gi|157960574|ref|YP_001500608.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MHQSIINSTIKPFSATAFHNGDFHPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQSMGVEVYSVSTDTHFT
    HKAWHSSSDTIGKIQYPMIGDPTGTITRNFGVMIEEDGLALRGTFVINPEGEIKVAEVHDLGIGRSAAELVRKIQAAQYV
    ATHDGEVCPAAWQPGEATLAPSIDLVGKI

    >gi|157960575|ref|YP_001500609.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella pealeana ATCC 700345]
    MLDANVKNQLNTYLQNLKHPVELVVSIDDSKKAQELKSLATDIDSLSSLISVTDQVGERTPSMSVINPQLNSKITFAGLP
    MGHEFTSLVLALLHSGGHPIKLEADVIEQIRQLPGEYRFETYVSLS
    CQTCPEVVQALNMMAAINPNITNVMIDGSLFQDE
    VNERNIMAVPSVYLNGEQFSMGAISTVEILNKLDVNAAGRKAEQLNEKEPFEVLVIGGGPAGASAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMNNQRALSLKSGELFELELENGAVLRSKTVLLATGARW
    REMNVPGEQEYRGSGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSSLRADEVLQRKAKSMGNI
    DIITQAMTTEVTGDGKRVNGLNYTDRATGESHHVELAGIFVQIGLVPNSEWLKDTIDMTARGEIIVDGKGETSVPGIFAA
    GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHDIDESAGGNIAA

    >gi|157960578|ref|YP_001500612.1| hypothetical protein Spea_0750 [Shewanella pealeana ATCC 700345]
    MHKSIILFIALLLSSLSLPSFATTESTATNNLWHYTNAQGELKVKLYFFWSKTCPHCAEAHPFIDSLPERYPWLEIEDHM
    ITAPDTMEVWQQVAKQTGTEARSVPYFASGEKAVVGYSSQAVTGEFLVQRLKSYYVSLGGKLAPEAEGQYPVVAPASVGL
    FTTCSETDSKAGSDGTCDLGLDTNNEIASSDVQPVELPLVGVVHPEQMSLPLLTVVLAGVDAFNPCAFFVLLFLLSIMVN
    AKSRTRMLIVGGIFVFFSGFIYFIFMSAWLNIFQLLGAGSDGGWIILGAGMLALVAGAVNIKDYFFTKGEVTLSMSAENR
    TGLIKRMGKLTSASSMTAMIAGTVVLSILANAYELLCTAGFPMIYTSVLSMHDLDTFERYMYLVMYNVVYVIPLAAIVIA
    FSVSLGKRKLTEKEGQTLKLMSGIMMMGLGGMLAADPTALQNVALAIGLILSSIVLTIIITLIRKSIEKAQTAKS

    >gi|157960634|ref|YP_001500668.1| thiol:disulfide interchange protein DsbC [Shewanella pealeana ATCC 700345]
    MKFTRTFSLIAAMMIAPAALAASNSSDDTAALKQKLSDALSVEVISIKPSPVAELYEAYTDRGVLYISRDGSKLFHGSLY
    DLDKGMKNLTEAAMAGPRLDMLKPLEDNMLVYKAKNEKHVVTIFTDVS
    CGYCRKLHNEMDGYNDLGITVRYLAFPRAGVP
    SANADEMESVWCAADPLKAMGQAKNGKAIKQAKCDAKIAEQYNVGQAIGINGTPAIILEDGTLIPGYQPPKALLRTLESV
    Q

    >gi|157960813|ref|YP_001500847.1| iron-sulfur cluster insertion protein ErpA [Shewanella pealeana ATCC 700345]
    MTEQAEDALPIRFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|157960976|ref|YP_001501010.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella pealeana ATCC 700345]
    MHEMPNIVIVGGGAGGMEIATKLGHQLGRKGKARVTLIDCAESHVWKPLLHEVATGALDIGIDAISYRGHAANHGYHFQQ
    GAMTDLDREAKQVILAPINDDKGRELLPARRIDYDYLVIAIGSIANDFNITGVRDHCVFLDSTEQAMEIRTMLLNKFMRY
    ASHHQLDDKIKIAVVGAGATGVEMSAEMHHAVEQLRGFGYKIDSSLLEITLIEADERILPKVEKEEISASVAKELTSIGV
    KVMTNTRINQVTEEGLHTSEGEFIQSDMVIWSTGVKAPDFLKEIGGLESNHINQVMVQQNMQTTRDPSIFAIGDCAACPQ
    EDGSWVPPRGQSARQMALMTADNIKLLLAGKAASNNYVYKDLGALVNLSKFHTVGNLMSFIGGGVMVEGKIARFVYTSLY
    RRHLIELHGPIKGTLLMFAKGISRIVHPHLKLH

    >gi|157961078|ref|YP_001501112.1| alkylhydroperoxidase [Shewanella pealeana ATCC 700345]
    MSRILPVSNPPGDVATTLAAIKSKLGMVPNLYATIGHSSTVLNAYLAFSDALSKGRLSAKQRELIALAIAQVNQCQYCLS
    AHTLIAGNTGLAKHHIKEARQAKADNALDQALITLAVDLVEQRGELTTEQLDIANENGVDSELIFEVLGLVTANIFTNYA
    NHLAQTDIDFPEVSLTV

    >gi|157961285|ref|YP_001501319.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella pealeana ATCC 700345]
    MNKQSQPLVKLNFESDYGVISLCANETGITHLNFIPQIDSEWQSREVDNQLLENNRVQSSIGSVSEPALEQRASAHLLQA
    KQELCEYFSGTRRHFDVALAPKGTEFQQQVWHALTELDYGQSCSYADIAMKIARPKAVRAVGTANGANPIAIIVP
    CHRVI
    GKNGTLTGYAYGLELKQKLLSLEGLSV

    >gi|157961301|ref|YP_001501335.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MKHNPAFLALVESILPLVTEVNVEQYQTMNDWTLLDVREDSEWLKGRLPNALHLGRGIIERDIETLFPEKDTPLVLYCGG
    GYRSALAANNLQVMGYTKVVSLAGGYKAWLERQLPIEND

    >gi|157961316|ref|YP_001501350.1| iron-sulfur cluster assembly protein IscA [Shewanella pealeana ATCC 700345]
    MAISITPAAADRVRSFLASRGKGLGLRLGLKTSGCSGMAYVLEFVDDLNDDDELYDVDGVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|157961402|ref|YP_001501436.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella pealeana ATCC 700345]
    MSTQSISTREMLIGPIFTNNPVAMQVLGVCSALAVSNSMQTALVMTLAVTFVLVFSNLIISSIRSLIPNSVRIIAQMTVI
    ASLVIVVDMVLQDVAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKNPPHLAVVDAFGNAIGYGVILLGVAFVRELLGSGT
    LFGHEILQTVENGGWYLTNEMFKLPPSAFFLIGLMIWSINVIQRKRG

    >gi|157961403|ref|YP_001501437.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella pealeana ATCC 700345]
    MEHYINLFIQAAFIDNMALSFFMGMCTFLAVSKKVSTSFGLGIAVIVVMTLAVPLNQLIYANVLAPGALAWAGYPALDLS
    YLQLITFIGVIAALVQILEMFLDKYIPALYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNLAESTVFAMGSGFGWAMAIVM
    LAGLRERMKFHAIPQGLQGIGIVFITTGLMALGFMAFSGISI

    >gi|157961424|ref|YP_001501458.1| glutaredoxin [Shewanella pealeana ATCC 700345]
    MFIIRWVLGRIILFLNFVFAPKKLKRPQEEQQKIDSATSSMTIYEYKACPFCVKVRRSLRRQGLNIVTLDAKQEPHKTTL
    LNEGGKLQVPCMKIEENGQSTWMYESSEIISFLDKKFA

    >gi|157961518|ref|YP_001501552.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MKFFKQSLSRTFIVFALLLAPLHSAWAAQYKEGVDYVKIAGIPESHKPVVREFFSYNCGFCYRQDPFFEQTAHLLEGDIQ
    FERTPVGAGRSSWILSQEAYYLAQKFNVTKQVHGNIFTRIHEKEGAFTRSDQLKDFFVSQGLNEAEVEAAMNSTDAKLAL
    MNYDTQAQLAEIRGVPSLVVNGQYLIKEQGKTPEDLAELVRYLSSLEQPK

    >gi|157961599|ref|YP_001501633.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MLIYKRLFIALMLTPLFITGCQPQNDAQLQQEITSLKQEITQLKSDMVTIGNQVKDIHTIAMRSQKPQYKTLPTQTNFND
    DGRLPLLGDTAAQLAIIEFSDYQ
    CPYCKRFIDQTFTKLKSNYIDTGKIQYLTRDFPLGFHPKAKGAAIAANCSLQQNAYW
    PMRDSLFKNMQQLDDALYQQTASNLSLDMTMFADCLIDETVSSKVDQDVAYGSSLGIRGTPSFVIGRVENGQLISPKLVV
    GAQSYQTFALLIDELLANPQKSD

    >gi|157961787|ref|YP_001501821.1| glutaredoxin-like protein [Shewanella pealeana ATCC 700345]
    METVEKIKQQIAENPIIVYMKGSPKLPSCGFSSQVAQIMINCEAQFAFVDILQHPDIRAELPKYANWPTFPQLWVEGELI
    GGCDILTEMYQKGELQTLIKETAAKYKTEDDQG

    >gi|157961793|ref|YP_001501827.1| arsenate reductase [Shewanella pealeana ATCC 700345]
    MTSATIYHNPRCSKSRQTLALLEERNCNIHIVEYLKTPISKGDITDILTKLKLAPREIMRIKEAEYKELGLSDTTLTDEQ
    LIQAMIDTPKLIERPIVLANNRAAIGRPPENVLSIL

    >gi|157961801|ref|YP_001501835.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MKTLTVGEQAPLFTLQNQRDETVSLAEALKSGPVLVYFYPKASTPGCTVQACGLRDSKQDLNDLSVTVLGLSPDPVAKLA
    KFSDKQELNFSLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRQSFLIGQDGKVAHVFNKFKTKDHHEVVLAHLKSQ

    >gi|157961813|ref|YP_001501847.1| arsenate reductase and related [Shewanella pealeana ATCC 700345]
    MRATYKNRLEYPLTLFGIKNCDTVRKARKWLEANQLEVTFHDFREDGLSTEQIEQWVAAVGWEALFNKRSTSFRNLTDTE
    KSDLSQNKAIALMALYPTLIKRPVLVSNGQVQVGFKEADYRVWFNL

    >gi|157962040|ref|YP_001502074.1| heavy metal translocating P-type ATPase [Shewanella pealeana ATCC 700345]
    MSQASCFHCSEPVLTGKQFTTCINDDEQLMCCPGCQAVSQAIIDAGLTNYYKYRTEPGSKQTALVPEELSNFSAYDLPEV
    QQDFIQQRDSLNEVSLTVDGIT
    CAACAWLIEHKINKLDGVAKIQVNSTTQRALIAWDSETIKLSEILNQISLIGYQAAPF
    QVDEQEIKSKRDSRKFLLRLGLAGFATMQVMMFALALYSGYFSDLDTEYRDYFRWVSMLFAAPVVFYSAQPFYFSAVRSM
    LMGRLNMDVSVSIAICGAYIASCIETINGTGEVYFESVSMFTFFLLLGRFFEQNARQKASVSSSNLHKLVPLTAQLKTDE
    GFDEVPAKRLVIGDIILVKPGDVIAADGIVIEGETAVNEAMLTGEQMPLQKMIDAEVFAGTINIEQPILVKVTALGQDQL
    VAEIIRLQEIASNNKPRVALYADRFSNYFTAAILLIAALTYLFWYFYSPEDAFWVTLSVLVATCPCALALATPTAVTCGT
    AIMTRLGIITRRSGVFEKLPKIQHVVFDKTGTLTLGSLSISDVELTADWSETAVLAHIAALESGSLHPIAKAFAAHFNGA
    ITVSHRQSVVGNGLSGTIDGLEYRVGSQQFVNGTNDVEASTIVWFSQGHTLLAKITLNDEVRPETAQAVTQLKKMGCKIS
    IASGDNSTEVAALGQRLGIDDVHKGLSPKDKLALIDKFQQQGQVAMFGDGINDAPVLAGANLSIAMGSGAAISKNSADII
    LLGDNLSRFADAVKVAKSTGRIIKQNLFWALGYNLFIIPLAVSGHVAPYIAALGMSASSLIVVSNSLRLLKVRL

    >gi|157962069|ref|YP_001502103.1| peptide methionine sulfoxide reductase [Shewanella pealeana ATCC 700345]
    MALATFGAGCFWGVEYFFREVEGVIDCTCGYMGGKDSYTRYAEVKTGTTGHAEVVQVEYDPNIVSYQRLLEVFWQNHNPT
    TLNQQGGDIGSQYRSAVFFHDKQQKHQAEVAKLALIKSAKWGSRQIVTEVVPCQQFHQAEAYHQDYLAKNELPSCHISY

    >gi|157962079|ref|YP_001502113.1| thioredoxin reductase [Shewanella pealeana ATCC 700345]
    MTQARHCDLLILGSGPAGYTAAVYAARANLKPVLITGIQQGGQLTTTTEVENWPGDAEDLTGPALMERMQKHAEKFETEI
    IFDHINEVNLNVRPFQLKGDNGEFTCDSLIISTGASAIYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILTKRLMDKVANGNIILHLDNTLDEVVGDQMGVTGLKMKSTKDGSIKDLEVAGVF
    VAIGHKPNTSMFEGQLEMNNGYIKVQSGLDGNATQTSIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDAK

    >gi|157962174|ref|YP_001502208.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella pealeana ATCC 700345]
    MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLGYLRTMSFILV
    IAVVVQFTEMLVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNINEKHGFIESAIFGFGAAVGFSLVLILFSAMRERLAA
    ADVPTPFKGGAIAMVTAGLMSLAFMGFTGLVK

    >gi|157962179|ref|YP_001502213.1| SoxR-reducing system protein RsxE [Shewanella pealeana ATCC 700345]
    MSDYKELTKQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVRDFVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVAKSAFDGLMMGLGFTLVLSVLGAAREILGQGTLFYG
    ADQLLGEWAKSLTIHIWQVNTSFLLAMLPPGAFIGMGLLIALKNAIDQYLATKQPKVEQEAPTRARITKVN

    >gi|157962202|ref|YP_001502236.1| UBA/THIF-type NAD/FAD binding protein [Shewanella pealeana ATCC 700345]
    MRNSMSLTDSDFLRYSRQVLLPEVGEAGQIAISKSHVVIIGVGGLGNLVAQQLAAAGVGHITLVDGDRVELSNLPRQLLF
    DDSDIGNNKALVAKDKLSRAYTQTQLIAVSEHLTQDNISQVLTLDEPYAQLLDCTDNFETRQRVNRFAIESRTPLVSASA
    ANFQGQLLNINQQHNPQSGCYHCLYPADMSVNQT
    CQTVGVLGPMVAALASMQALMALQQLLGDRQTVGKLFRFDGKSFSW
    REARLPRSPECVICGDVQGLSGAEKNCGKLPSTEKEYV

    >gi|157962261|ref|YP_001502295.1| disulphide bond formation protein DsbB [Shewanella pealeana ATCC 700345]
    METMSLNALIRFSHSRAAWLILMLSAVALELAALFFQHIMKLDPCVMCIYQRVAVFGLIFAGLIGVIGYRSRIARAIGVI
    VWGVSAIWGLKLALELVDMQMNPSPFAT
    CSYLPEFPSWLQLHEWLPSVFMPTGMCTDIPWEFMGVTMGQWMIVAFGGYLL
    ALAIFFIPALKR

    >gi|157962327|ref|YP_001502361.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella pealeana ATCC 700345]
    MRELTEYEKHVIEDKGTERPFSGEYNQHDAQGVYCCKKCDAPLYRSESKFNAHCGWPAFDDEIAGAVKRNIDADGMRVEI
    VCAKCDGHLGHVFEGELLTPKNLRH
    CVNSVSMTFRPIEQETNETKLELATFGGGCFWCIEAIFSAIKGVTKVTSGYAGGD
    SHDANYKAVCSGNTNHAEVVQIEFNPREVSFESLLEVFWQSHNPTTLNRQGNDVGPQYRSVIFIHNEQQALIANNMIDDL
    TRIAAWPDPIVTQVIAYDGFFAAEDYHNDYYELNGEQPYCQMVVKPKVDKVKALFADKLK

    >gi|157962346|ref|YP_001502380.1| glutathione S-transferase domain-containing protein [Shewanella pealeana ATCC 700345]
    MSLPTLYSFRRCPYAMRARLGILLSGQSVNLREIVLKHKPEAMLTASPKGTVPVLILQDGSVIEESIEIMCWALINDDPH
    NLLLSENPRQQENAQALIHANDNQFKPWLDKYKYADRHPDNSEQYYRQQGEIFIGQIESLLAKQTVKLSQAQTPELISEQ
    AYSATSKSPQLLGFEPSIADYAIYPFIRQFASVDRAWFDNSGYTNVQRWLKAHIESHEFASIMKKYPTWLESGESFQLGL
    D

    >gi|157962381|ref|YP_001502415.1| glutaredoxin 1 [Shewanella pealeana ATCC 700345]
    MFVVIFGRPGCPYCVRAVQVAEQLTEKRDDFKFKYVDIHAEGISKADLEKTVGKPVETVPQIFVDQVHVGGCTEFVQYVS
    DNELMPAA

    >gi|157962395|ref|YP_001502429.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MSVLVGRPAPDFTAAAVLGNGEIVDTFNLSEAIKGKTAVVFFYPLDFTFVCPSELIAFDHRMDEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVDKGGIGQVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMIRMVD
    ALHFHEEHGDVCPAGWEKGDKGMDASPAGVASYLTDNADSL

    >gi|157962434|ref|YP_001502468.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MSNAFNLQHKLPKNMIWLLGLSVLLMMLSTFASAADQDAKVAWQKIEAGALVVDVRTPGEFAQGHLPNAINIPYEQINSA
    FSKQQIAKDRSVVVY
    CRSGNRSGIANKMLVSEGYTNVYNGGGYQMLMSQQH

    >gi|157962551|ref|YP_001502585.1| glutathione S-transferase domain-containing protein [Shewanella pealeana ATCC 700345]
    MSAESINPVLYSLRNCPYAMRARMAIYQSGQAVQLRELCLDSKPVEFLTASPKGTVPVLVLPNGEVFEQSLEIMRWAFGT
    HDPDNYLISDNSNKQQQMLRLIKLFDEEFISSLEIYRSAKRYHDESLQECREACEQYLQLLEQRLLQHRYLFSDNPSLAD
    LAIIPFIRQLARVERQWYLNSPYPKVRNWLNGYLQSLMFSKVMAKFPLWSANDVPVIFKAE

    >gi|157962593|ref|YP_001502627.1| copper-translocating P-type ATPase [Shewanella pealeana ATCC 700345]
    MANISLYVPKMSCASCVAKIETAFANASRNGQGDIAARVNLADKLVQVSGAISAEDAIQIIASVGYDSEAIIDARTAAEQ
    KGIDERKEYRLRLIQASIGLGLGVPLMLWGLLGGEMMVSNAQQQQAWGVVGVITFLVMLFTGRHFYQGMWRAIKAKSANM
    DTLIALGTSAAWIYSMMVVIAPEWFPADTRHVYFEASVMILGLINLGHALELRARGKTSEAVQRLLGLQVTTAIRLTDDG
    DEEVEINLLQVGDRLRLRPGDRVALDGEILIGQTLINESMLTGEPIPVHKAVGDNISAGTVNGNGALIYRVTASAKDTKL
    SKIIELVQQAQTSKMPIGRLTDKISAYFVPVVIIIALLSSLIWYLFGPAPALSHALVVLTSVLIIACPCALGLATPMSIM
    VSVGRAAQMGVLVRNGEALQTASKITTVVLDKTGTVTQGSPEVTEILLLDKNICELSLLEDVASLEQHSEHPLASAIMTK
    AKQQSITLKEPDSFANVQGKGITGFIAGRHYAVGNMGLMQQAGLGGKLDADIDGNVDGISGYQQQVAEFASKGQTPVFVA
    VDKVLVAIISIADPIKADAAEAVQAMKNQGLKVVLLTGDNPLTAQAVADKVGIDSVFAQVLPEQKQQKVLELQQAGEVVA
    MVGDGINDAPALMSADVGIAMGSGTEVAIESADFTLLSARLIVINDTLALARASMTNIKQNLFGAFIYNSLGIPIAAGVL
    FPFTGILLSPVIAGAAMALSSLTVVSNANRLRSQRLK

    >gi|157962782|ref|YP_001502816.1| glutathione peroxidase [Shewanella pealeana ATCC 700345]
    MTASIYDFSVNNIQGKTVSLANFKDKVILIVNTASECGFTPQYKELEALYQKHQSQGLAVLGFPCNQFGEQEKGDNQAIS
    SFCELNFGVTFPLFEKIEVNGANTAPLYAHLKQSAKGLLGSEAIKWNFTKFLVDRQGKVTQRFAPTTKPMAIEGEILKLL


    >gi|157962804|ref|YP_001502838.1| thiamine biosynthesis protein ThiI [Shewanella pealeana ATCC 700345]
    MKFIVKLFPEIMMKSKPVRMRFTKMLETNIRNVLKKVDETAKVQRQWDKIMVMVPDDRPDLVEAFAERLACIPGIAHVLQ
    VNVSTFTTVDDIYQQTLVAYKEQLAGKTFCVRVKRAGKHDFNSIEVERYVGGGLNQFTEAAGVRLKNPDMTVHLEIDNDN
    LYLIDKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKRGSRTHYCFFNLGGDQHEIGVKQVAYHLWQKYGESHKVK
    FISVPFDPVVQEILERIDNGQMGVILKRMMMRAATRVAQKMGIQALVTGEAMGQVSSQTLTNLNVIDRCTEQLILRPLIA
    MDKQDIINISRQIGTEDFAKSIPEYCGVISQKPTVKAVLAKVEAEEAKFSEDLLDRVIADAEIIDIKEIATQMDTKITAT
    ETVDAISAGEIIIDVRAPEEEEKSPLELDGVEVKAIPFFKLATQFADLDKEKNYLLY
    CDRGVMSKLQALYLQEQGYNNVK
    VYRP

    >gi|157962825|ref|YP_001502859.1| OsmC family protein [Shewanella pealeana ATCC 700345]
    MPEKSVEVNTHMGEGWKITAQVRDHQLVIDQPTAGNEGANPLETFIFSLAGCISTIARMVAREQNITLNHFDLSIKAQLN
    TAGLLGKATDDPVGFKHIDITVDMDATMNQEPLFDQQKNEFLDTVCHRCPVHDNLLKPTLVTHQAS

    >gi|157962916|ref|YP_001502950.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella pealeana ATCC 700345]
    MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVKTAMGLGVAVIVVLAISVPVNQIIYQGILAPGALAWAGVPDADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLGESLVFGIGSGIGWALALVL
    LAGIREKLKYADVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|157962917|ref|YP_001502951.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella pealeana ATCC 700345]
    MADAKELKQVLIGPIVSNNPIALQILGVCSALAVTSKMETALVMTIALTAVCALSNLFISLIRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVGFVRELFGNGSL
    FGIEILSKISDGGWYQPNGLLLLPPSAFFLIGALIWIIRVMKPEQVEAKG

    >gi|157963015|ref|YP_001503049.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MSTDSQRPDKPNSRDKIAVKHQSFGRRLFGWLKQLLFMLVVLTVFSAALDVWRSRDISTDQLPNIQATTVQGDKVDLLAM
    SHKQPVLLYFWGSW
    CPVCSFVSPSVDIAASQYPVITVAMNSGTDEKVRKYLQHKGYDFAVVNDPRGEISQQWSMQLTPTL
    LVIKDGELAYYTSGFTSLPGIWWRMLLA

    >gi|157963016|ref|YP_001503050.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MKTHKTHNYLGPKQPIFKSKFQAGLFISTIAAFAFYCAMLIISQNVKAEGSRVNPMWVSAPTMKEMINANRSALFHQADD
    PWKGAETPQITMVYFTDFN
    CPYCKKLEPELDKLMAEYPQLKVIVKMVPLQGQSSVEAVDFAQRVWMNEPDKYLKLKEMLM
    ASPRRLDSQTIAKVAAMTNTSQWLSQADASISPAISDNLELMRGLRLGGTPSMVIGENIIVGLVPFSQLKQQVEQALEAQ
    DEHG

    >gi|157963017|ref|YP_001503051.1| cytochrome c biogenesis protein transmembrane region [Shewanella pealeana ATCC 700345]
    MKILKQIILVCLLALANPVFAQSTGWLENPNHPPVKVRFMLTGEVDKASNTVPGVLEVELDGEWKTYWRSPGEGGIAPSI
    DWSGSSNLNQVDWDWPAPEQFSLLGLQTFGYHHEAAFPMQLQLDDTNKPTHLQGKFTLSSCTNVCVLTDYELNLDIDPTA
    LNADVDAMFAYNKAVSKVPVKLQREDVTLGWDVKAQQLQVEMDDTGWSMPKFIIDGEPDTTFKFVRFERYDTDSGQQKLR
    AIFDATSWLGEPELIGKSLNLTVMDKEQALEFVANVSGITIQASGHSLLSMLVIALLGGLILNVMPCVLPVLGMKLSSVI
    AAPNLQVKQIRQQFIASALGILVSFWLLAGFILILKFTGQAIGWGVQFQNPWFIGFMAVVTAIFAINMLGAFEINLPSSL
    QTKLATTGGNDHRGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSLFVIFSALALGMALPWLLVAAFPQVARYFPKP
    GRWMSVVKVVFSGLLVLTSLWLLSLLANFIPAAYLWIAAGTLVLLFLVLMAKVQGKAAVIASVSVGIMVIAVGAFSTSNR
    WAQPLPTDLEWHMLNEPEIARQVAAGKTVFVDVTADW
    CITCKANKVGVILQDPVYSELKADNIVLMEGEWTKPSKPITEY
    LQSHNRFGVPFNVVYGPNAPEGIALPVILSASDVIDAINVASVRF

    >gi|157963070|ref|YP_001503104.1| hypothetical protein Spea_3253 [Shewanella pealeana ATCC 700345]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDIPTENIRLSQNNIVDPE
    DRYNQIFQIQVELPDDISDKDRQGILRSIERCTVKKVVQTGPEFKIETVENLDADANAMLMGQSDSDASTYILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNCNFFYNDQFFGEE
    IANSEFVHYPNEKWFELEDDDSLPAGMLDDYCLAIYNPEGELGGSNLIDTNSGNIDRGICTIPYTRHSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAQVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVISWRF
    FSSKHDYEFVEWDFSGTNQEEADGLFGILETLGKEVYTADFDQLGASACRMLVPGFSEVYLVDDLIWDNTNKALDYREDI
    LNLHSLSDDELVDLVNRLEESQLDNYTDIRTMIGIVFDENTVWGQLTIIELKILIYLALGAAEEAMELVGDFLQYNDNTV
    ERGLFYQAVNAVLEVEMDEELELEHFIHSFNRMFGEEVMDNVIGTVSGEVRFFGLTKTSMALEGIEPHLRLIESYKKLHS
    ARAKAAAK

    >gi|157963135|ref|YP_001503169.1| thiol:disulfide interchange protein, putative [Shewanella pealeana ATCC 700345]
    MDSISISILVFFSLLCLSIASLIWLKIKGKIIPNGVIVVLGFMAMCVGSVFAFINYGEDYDAYKKLHWQTLTPSQIQPLV
    DQGYTVFVDVTADW
    CNICYANKVGVTHREKIVNALAADNIILMLGDWTEPNAVVEDYMRMQGRGGTPYNKVYGPGAPDGI
    ILPTQLTMESVLQGLQKAKI

    >gi|157963255|ref|YP_001503289.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MIKHIALALTLAVAPLSSFAAQFVEGKHFTVVSNKAPSSEPKLTEFYSFYCGNCFNMEKMYLADIKANLNKQVTFDSKHV
    DFANTEINTEVMRSLAVIQTLDNQKPLTDAMFKVIQGDNGEKHDHSAPGHKHDEPLKSRDDIKAVFAKFGVDSAQYDKIA
    DSKETNEKLALWRTQQREFQVQSVPAFIVNDKYAINMGSIRTLGELIDLMNYLALEHK

    >gi|157963715|ref|YP_001503749.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MLNTQISKLTTRPAGEQCWQLIQEGATVIDVRSPQEFAGGHLPQAINVPLDTLDTWLHKLENRQQVFVLYCGAGIRAQKG
    CDILMANGLESVINGGALKDLLSCQPKQ

    >gi|157963834|ref|YP_001503868.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MKKTLTAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKIYSINCPFCYKYEKAGIPNDKLMPAGSTLDQYHITS
    KPPFGVEKSTALAIAKEIKGEKTFKQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMSRAEFDTYAKDPKVKQLMTKWD
    QGVEVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK

    >gi|157963835|ref|YP_001503869.1| disulphide bond formation protein DsbB [Shewanella pealeana ATCC 700345]
    MSLQQRLKEFWGQFKATPADSLTHMQDHRPIWLVMVGGALFLILSAIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIIL
    IDPRNHILKFLGLLLAWYAVIQGWMWSVELMKIHDAAHMVVDETMDFFAAAGDAAGSA
    CSTDPRFPLNLPLDEWLPFEFA
    PTGGCGEDDWTLLGMNMAHYCIIAYTVFMVCLAPLTFGWVRSLKKLLPLKK

    >gi|157963839|ref|YP_001503873.1| DSBA oxidoreductase [Shewanella pealeana ATCC 700345]
    MKKTLTAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKIYSINCPFCYKYEKAGIPNDKLLPAGSTLEQYHITS
    KPPFGVEKSTALAIAKEIKGDKVFKQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMNRAEFDTYAQDPKVKQLMTKWD
    KGVEVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK

    >gi|157963840|ref|YP_001503874.1| disulphide bond formation protein DsbB [Shewanella pealeana ATCC 700345]
    MSIKEFWGQFKATPADSLTHMQDHRPIWLVMVGGALFLILSAIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIILIDPK
    NHILKFLGLLLAWYAVIQGWMWSYELMKIHDAAHMVVDESMDFFAAAGDAAGSA
    CSTDPRFPLNLPLDEWLPFEFAPTGG
    CGEDDWSLLGMNMAHYCMIAYTVFMVCLAPLTLGWVRSLKKLLPFKK

    >gi|157963879|ref|YP_001503913.1| glutathione reductase [Shewanella pealeana ATCC 700345]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKELGGTCVNVGCVPKKVMWYGAQVAEAMHLYAKDYGFDVTVNKFD
    WSTLVASREAYIDRIHGSYDRGLESNGVTLVRGYGRFVDSHTIEVNGEHYTADNILIATGGAATIPNIPGAEHGIDSDGF
    FALEAQPKRVAVVGAGYIAVEVAGVLQALGSDTHLFVRKHAPLRNFDPMLSEALMESMATDGPTLHTHSTPESVTKNDDG
    SLTLKIENGESYDVDCLIWAIGRLPSTANIGLENTKVELDAKGYVITDEQQNTTDAGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSVIPTVVFSHPAIGTMGLTQPEAIAQFGEENVTVYTSGFTSMYTAVTAHRQACKMKLVCAGDN
    QKVVGIHGIGYGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|157964027|ref|YP_001504061.1| rhodanese domain-containing protein [Shewanella pealeana ATCC 700345]
    MQEYMEFFKANPMLSVAWVGLFIGVIVVTIKTSVSKVKNVNHQEATMMMNKQDAKVVDVRGKEEFKKGHIVGAINVPLAD
    IKNNQLSTLENSKASPIIMV
    CNAGMTSSQAAQLMIKHGFENVSNLKGGMGEWQSNNLPVSKSKR

    >gi|157964049|ref|YP_001504083.1| DsrE family protein [Shewanella pealeana ATCC 700345]
    MQHVLIIVNDAPYGSEKLFNALRLAIQLNEQDYSPAKVSIFLLSDAVTAVLPNQKPAEGYNIQQMLEIVIAQKTQVKFCS
    SCMYARGLTDLKVVEGCEMATMDDLAQWVLVADKTISF

    >gi|157960733|ref|YP_001500767.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella pealeana ATCC 700345]
    MSSMKFTAGAPFPNIQLPGLDGEPISLGTPAEGSDWRLVIIYRGKHCPLCTRYLNEVEKLVADFLKLGIDVVAASADSLE
    QAQEHKSNLTASFPIAYRLTIENMQQLGLYISNPRSAKETDHPFAEPGLFVINDKGRVQLVDISNGPFARPELSTLLSGL
    SFIRDPENNYPIRGTYS