Shewanella oneidensis MR 1 uid57949

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|24371650|ref|NP_715692.1| rhodanese domain-containing protein [Shewanella oneidensis MR-1]
    MQEYIEFFKAHTLLSLAWVGLFVMLVVSVIKSSFSKIKNVTHQELTIMVNRQDAKVVDVRSNDDFRKGHIVGAVNVTLAD
    IKNNQVSALEKFKGSPIILV
    CNAGMTSSQAAQLLSKQGFENLYNLKGGMGEWQAANMPVSKSKR

    >gi|24371708|ref|NP_715750.1| putative inner membrane protein [Shewanella oneidensis MR-1]
    MTWQQFKQQYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEFTRWGGHLLQLVGANPETWGYFKVIGLQGSPLDRID
    GMMIIGMFGGCIAAALWANNVKLRMPQSRIRIAQALIGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGARFTLLPMFRIPVKLKKVDKASSVKQDENQARLRFRIGMLVFAAIIGWGLLTMFNAPKLGIAMLCGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVPPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHFWWVGLGNVLGSTLLAYYWDDLAQPLATNWDKVNLLTSFGDKGGLLVTYLLLALSFAAMLLWEKRFFARKAKRDEQLI
    AEAA

    >gi|24371737|ref|NP_715779.1| molybdopterin biosynthesis protein MoeB [Shewanella oneidensis MR-1]
    MNEQVDILSDSELTRYSRQISIKAMDIDGQERLKLAKVLMIGAGGLGCAAGQYLTVAGIGELTLVDFDTVELSNLQRQVL
    HQDANIGQPKVESAKQSLNQLNPHVKINPINAVLDDHEIDALVASHSIVVDCTDNVSVREQLNQSCFKHKVPLVSAAAIR
    MEGMVTVFDYQAQTPCYHCFSSLFGEQQLS
    CVESGILAPVVGMVGCLQAVEAIKVITGIGKTLAGRILMIDAMTMEFREM
    KLPKQAHCKICSQ

    >gi|24371796|ref|NP_715838.1| selenide, water dikinase [Shewanella oneidensis MR-1]
    MSNSTLPSTDSIKLTEYSHGAGCGCKISPKVLTTILASQLPVFTDPNLLVGNQSRDDAAVYKLNEEVGIISTTDFFMPIV
    DDPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPINKLPAEIAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVT
    GQIALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLKDEDSHIAVNAMCQLNSIGAQIAKINGVNALTDVTGFGLA
    GHLLEMCQGAKLTAKLKLDAVPLLPRALDYLAQGCVPGGTHRNYDSYGEHLPELTDHQKAILCDPQTSGGLLVAVSSEAE
    AELVALLNANQIEPICIGSLEAPTTATNVVLC

    >gi|24371865|ref|NP_715907.1| thiol:disulfide interchange protein DsbE [Shewanella oneidensis MR-1]
    MKKLVLFIPLVIFLGMGVFLYKGLFLNPQKLDSALEGKPIPAFQLERLETPNEMITNEQLKGKVALLNVWATWCPSCKYE
    HPFLVMLKRQNILPIYGINYRDERIPALEELRRQGDPYNINIYDKDGRLGLDLGVYGAPESFIVDHNGIIRYRYAGPIDQ
    RVWSETLYPMIQQLQAEAAKDGAA

    >gi|24371867|ref|NP_715909.1| thioredoxin, putative [Shewanella oneidensis MR-1]
    MKSLALMAVILASLSVAIAGSAYAYPGMQQANKPIESTADLINVLPQTFPIEPVAFSDVNGKPIDFSQYKGKVVMVNMWA
    TW
    CPPCVRELPAIERLATKFKAEEFALLPISIDVDGKQQVQPFLTSLGMANFNSYYDPTQKLGQVFPLDTIPATFILDQN
    GQLIAFVRSFVDWDDAKAVALIQTFIDKGAKKLN

    >gi|24371923|ref|NP_715965.1| dsrE-related protein [Shewanella oneidensis MR-1]
    MQKILIVAHASPYGTEKLFNSLRIALALKDQTDQAVDLKIFLMSDAVFGALKHQTTPDLSYNLQQMFEILSAQQVPVLLC
    KTCAQARGVSTAMLIEGTQIGTLQDLTRWTLDADKVMHI

    >gi|24371928|ref|NP_715970.1| hypothetical protein SO_0330 [Shewanella oneidensis MR-1]
    MKFKQDFFTQLPEFYSQVYPQGISNPHWLAWSDDAAALIGLHQPTDELLQGLSGNAAVEGASYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGAWDVALKGGGPTPYSRHGDGRAVMRSAVREFLVSEALHHLGVPTTRALAVIGSDMPVWRESQET
    AAITVRLARSHIRFGHFEFFSHSERGQADKLTQLLNFTLKQHYPHLSCDPAGYKAWFLQVVQDSAKMIAHWQAIGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPDGRYAFGQQPGIGLWNLQRLAQALTPVIASDDLIAALNQYQHALV
    QHYLALMRAKLGLVQQADSSAEQDQQDLELIGRFTVLMEKNQLDYSHTWRRFGQLDPSSLHSSLRDDFIDLNEFDAWYQV
    YQARLGKVTDVEAWQQQCNRVNPKYILRNYLAQEAIIAVDEGNLAQLQRLHQVLRQPFTEQIEHEELAKRPPDWGQGLIM
    S
    CSS

    >gi|24371931|ref|NP_715973.1| thiol:disulfide interchange protein DsbA [Shewanella oneidensis MR-1]
    MKKALLMAAALLLAPLTVSAAEYKEGVHYTVINDGPATAKPEITEFFSFYCPHCYTFSKTVVPKILAEKPAGVEFNQAHV
    DFIGKEMGIEMSRAFAVAHQLNVNEKIDTALFTAIHDKKQHFTSRDDVRALFVANGVDGKTFDAAADSFMVKAQMSKMKR
    DTENAKLTGVPALVVNGKYRVETGAIKSYDELLDIAYYLARK

    >gi|24372002|ref|NP_716044.1| thioredoxin 1 [Shewanella oneidensis MR-1]
    MSDKIIYLSDDSFENDVLKADLPVLVDFWAEWCGPCKMIAPILDDVAEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKNGELAATKVGALSKTQLKEFIDAQI

    >gi|24372005|ref|NP_716047.1| hypothetical protein SO_0409 [Shewanella oneidensis MR-1]
    MHNNVKALLATTALFFSCQVLANGGCGFEEQKQGLIATCSEEKQEVILTGVVEAQHLVKDLNEFAEGYKSYQVDTDALAP
    LKKVTEPTEIVVIIGTW
    CPDCHRETPRFIRIIEEVANPNIKVTYIGVDRSKQDPEGLAAKYEFKRIPTFIVQQQGKEIGR
    IVERPTVSLEKDLAEILK

    >gi|24372021|ref|NP_716063.1| dihydrolipoamide dehydrogenase [Shewanella oneidensis MR-1]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPT
    IDLDKLRSFKQKVISQLTGGLGGMSKMRKVNVVNGFGKFSGPNSLEVTAEDGTVTVVKFDQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAREDGIYVSMEGKSAPAEPVRYDAVLVAIGRTPNGKLIDAEKAGVKIDERGFINVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDCSEGMTKL
    IFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|24372047|ref|NP_716089.1| thioredoxin 2 [Shewanella oneidensis MR-1]
    MIIACPHCDTLNRVPNERLTEQPTCGKCKQSLFAAAPIELTSANFINHAHKSELPIVVDFWASWCGPCKSFAPIFSDAAK
    AWEPRFRFGKINTEEQQSLAAQFNIRSIPTLMIFKQGHIIAQQSGALPRTALDQWLKGYR

    >gi|24372070|ref|NP_716112.1| thioredoxin, putative [Shewanella oneidensis MR-1]
    MKSYTAKLTLLCTSLLLSCTVQAHSLQNKLYDTGETIPKPRVMTGFIEMQYARGIPEVPFMDEAGQAQTLKQHQGKLTLV
    NLWATW
    CVPCLREIPELQKLKQQFADKNIAIVPISIDEEVKDVRPFLNQHGFNNYSTWLDPNKNIEQIIPANVVPATYVF
    DAKGNLVGFVRGYLDWTDKEVTPYLEKLIAKYAQ

    >gi|24372074|ref|NP_716116.1| hypothetical protein SO_0480 [Shewanella oneidensis MR-1]
    MNKFIRQTLTQLALFATLLIPAMPTLAGGGSEMSEVPYNEIQLNPISMREAETLVGQQGVYFFDVNTLEIWAEGFIPGAV
    FFNVQNWRELLPKNKDAVMVFYCANRL
    CTASNMAARETMKLGYTGVRHMADGIFGWRMSGRATEKP

    >gi|24372130|ref|NP_716172.1| redox-active disulfide protein 2 [Shewanella oneidensis MR-1]
    MKQVKVLGSGCAKCSKTAEMIADISEEMGIDVIVKKDADPQTLLKFNVMKTPAVVIDGELIHSGSVPTRDEIEGWLRD

    >gi|24372287|ref|NP_716329.1| thiol:disulfide interchange protein precursor [Shewanella oneidensis MR-1]
    MKKLLSLTFTALLLLAPLALSGNAFANNFGFLKSEPELMPVDQAFAFDFKQEGNKVTLNWVIADGYYMYRDKLKFSVNGA
    ELGTIDLPKGKPHNDEYFGEQEVYYTYIDIPVGLKQADDNGTLSVTFMGCAEGKLCYPPTKRDVSLKAVAANDGQIATTA
    ASDATEPVTAQTNANSATNAPITQQDSLSQMLSNDSLLWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGQKLSTAKA
    FTLSMAYVQGMAITYSILGLVVASAGMKYQAALQHPAVLVVLAILFFVLSLSMFGLYDLKLPSRFQEKMNSISNNQKGGN
    LIGVFLMGVISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGVPLLIIGTSGGKLLPRAGAWMNIIKTVFG
    FLLIAVSIVMLGRIWTGVVSDVLWSLWGISFTGYLMHQNKLSAFNWKQTVRSVLLMLTLLASFSYGFQAVMGHFGFNHSP
    VGNTATAEAEHGFKHIKSIEDLDRELAAATAAGKPVMLDLYADW
    CVACKEFEAITFKDAEVLARMNKIVLLQADVTKSDA
    VDVALLEKYHVLGLPTLLMFNEQGEPREDLRVTGFMGPKEFAAHLDHLVK

    >gi|24372386|ref|NP_716428.1| hypothetical protein SO_0797 [Shewanella oneidensis MR-1]
    MQRLILLLLLCCALPLSAAQLTRDYQFQALRSQTLTDLSHLEGQSTALMFFEPECPWCIKQANVLKQLHKSCNQAIQPVA
    LGVNGDNLALKRALFRLNFPFEAYRVPPALLKEMGGIPATPILLLLNPKGELIKGYRGFTDEQELRNQLCHSS

    >gi|24372493|ref|NP_716535.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella oneidensis MR-1]
    MSNSLSMRDMLAGPVFANNPVAMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPNSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVGLIITN
    CIIMGRAEAFAMKYPPHLAVVDAVGNAAGYGLVLISVAFVRELLGTGNL
    FGHSVLTTVENGGWYLPNEMFKLPPSAFFLIGLLIWSINVIQRKRG

    >gi|24372494|ref|NP_716536.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella oneidensis MR-1]
    MEHYINLFIQATFLDNMALSFFLGMCTFLAVSKKVSTAFGLGVAVIVVMTLAVPLNQLIYAKVLAPGALAWAGMPGIDLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFAESAVFAMGSGTGWALAIVM
    LAGLRERMKFHAIPEGLQGIGITFITTGLMALGFMSFSGISL

    >gi|24372538|ref|NP_716580.1| thiol:disulfide interchange protein DsbC [Shewanella oneidensis MR-1]
    MKLTRALSLVFALVVAPLASAATATTPDTAAIKQKLSEMLDVEVISMQDSPIEGLYQAMTNRGVLYISRDGSKMFHGNLY
    DLDKGMKNLTEAALAGPRLAMMKPLEDHMLVYKAKDEKHVVTVFTDVS
    CGYCRKLHSQMADYNKLGITVRYLAFPRAGVP
    SANADEMQAIWCAKDPLKAMTEAKAGKKVSAASCDAKIAEQYQLGNSFGVNGTPAIVLEDGNMIPGYQPPEDLLRTLEAR
    Q

    >gi|24372543|ref|NP_716585.1| alkyl hydroperoxide reductase, F subunit [Shewanella oneidensis MR-1]
    MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLVNDIVSLSTFVSLKEAQGQRTPAMTVVNPALNTQISFAGLP
    MGHEFTSLVLALLHSGGHPIKLSDDIIEQIRNLPGKYEFETYVSLT
    CQNCPDVVQALNMMAAINPNITNVMIDGALFQDE
    VASRNIMAVPSVYLNGEVFAAGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELELASGAKLRSRTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNI
    KIITQAMTTEVTGDGTRVNGLNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
    GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETKTTDTKAA

    >gi|24372545|ref|NP_716587.1| alkyl hydroperoxide reductase, C subunit [Shewanella oneidensis MR-1]
    MTQSIINSTIKPFKATAYHNGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYAKLQGMGVEVYSVSTDTHFT
    HKAWHDTSDTIKKINFPMLADPTGTISRNFGVMIEEEGLALRGTFVINPEGQIKVAEIHDLGIGRSAQELVRKIQAAQYV
    ATHDGEVCPAKWQPGDETLAPSLDLVGKI

    >gi|24372562|ref|NP_716604.1| hypothetical protein SO_0975 [Shewanella oneidensis MR-1]
    MTKYLTKFALLCSLALAMLSTPSWADTPNTSDQTWHYVNAQGELKIKLYFFWSKTCPHCAEAHPFIDSLPQKYPWIELES
    HMVSAPGVQDIWQNIAAKTTTEARSVPYMASCEKAIVGYSSEAVTGEFLVNRLKNCYLSLGGQLSEADMPTKGTPSSAPT
    SSAPLFGTCGSDSGEGTCDASSLASTDQAEVQPVELPLVGVVTPETMSLPLLTLVLAGVDAFNPCAFFVLLFLLSIMVNA
    KSRSRMLLVGGIFVFFSGFIYFLFMTAWLNIFKLLGAGSDGGMIILAAGILALIAGTINVKDYFFTKGEVTLSMSAENRT
    SLIKRMAKLSNSSSLGALILGSTVLAILANAYELLCTAGFPMIYTSVLSMHNLPDIERYMYLVLYNIVYVIPLAIIVIVF
    SATLGKRKLTEKEGQALKLMSGVMMFGMGIALVIDPTALQNVGLALGLILGSLGLTAIIVLSRKLLAAKANKTA

    >gi|24372563|ref|NP_716605.1| organic hydroperoxide resistance protein [Shewanella oneidensis MR-1]
    MKTLYETRATASAGRQGQVSTDDGLLNVALAYPKAMGGSGLATNPEQLFAAGYAACFSNAILHVAKIAKVAITEAPVSAV
    VGIGANETGGFALTVALEVSLDLPQADAQALVRHAHQV
    CPYSNATRNNIDVKLSVNGTALN

    >gi|24372690|ref|NP_716732.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella oneidensis MR-1]
    MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQLLQAYAYQISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSL
    FGVQILHKISDGGWYQPNGLLLLPPSAFFLIGMLIWIIRTYKPEQVEAKG

    >gi|24372691|ref|NP_716733.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella oneidensis MR-1]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPANQVIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYKLGESLVFGFGSGVGWALAIVL
    MAGIREKLKYADVPNGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|24372842|ref|NP_716884.1| mercaptopyruvate sulfurtransferase [Shewanella oneidensis MR-1]
    MEYPLVSTQWLEEQLTSPELVLLDASMAVVLGKEPILYHEPICIPRSRRFDVEEDFCDKTSTQIHALPRFESFVEGIAKL
    GIEPQSLIVIYDNQGIYSSPRAWWIFKVMGFHRVYVLDGGLPQWIAEDRVTSSRYQEEGIDYGVTDSAPLAAVLQYQSAK
    VMDAEAVLARLDDSESAIIDARGATRFLGQVSEPRPGVRSGHIPHSVNLPFGEVLNGYKMKSTTELQAIFQALVGNKALR
    IFS
    CGSGITACILILASVVAGHKSAVLYDGSWADWGSRTDLPIER

    >gi|24372882|ref|NP_716924.1| iron-sulfur cluster insertion protein ErpA [Shewanella oneidensis MR-1]
    MPIKFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVDPMSLQYLVGGEVDY
    TSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|24372959|ref|NP_717001.1| hypothetical protein SO_1381 [Shewanella oneidensis MR-1]
    MLSLLQRFLLTISLLLGSFSTLAQTIAKDEYSVSPLLNGEQIPAITLQDMNGQNVDLVKLTAQKPTIFFFYRGGWCPFCN
    NQMGQLKAIEPKLIEMGFQLVGISPDTPAQLKASSAKNELKYLLLSDEKMLASQAFGLAFYTSKQVTESYTNRLQLENPL
    WTTPEGDKGLVLPVPAIYIADKKGLIHFQYINPNYKVRPAPKLILTAASLVGSPE

    >gi|24373133|ref|NP_717176.1| glutathione peroxidase, putative [Shewanella oneidensis MR-1]
    MTSTIYRHNAIDIQGNPTPLTQYQGKVILIVNTASECGFTPQYKGLEALYQEYKARGFVVLGFPCNQFGAQEKANEQGIK
    SFCELNFGVSFPLFSKIEVNGEHTHPLYQYLKKAAPGMLGTERIKWNFTKFLINRQGEAVARFAPTTKPEDIRDKIESLL
    NK

    >gi|24373257|ref|NP_717300.1| cation transporter E1-E2 family ATPase [Shewanella oneidensis MR-1]
    MSQIKLYVANMNCAGCVAKIEKAFAAESNVSARINLADKQVTVDGKISPDAALAVMDKAGFPAQLIVDAKAAAEEKRIED
    AAEYKLRMRQAVAALAVGIPMMLWGLLGGEMMINSPSMQLGWGIMGLITLALLIGTGRHFYQGMWRALKAKTTNMDTLIV
    LGTSTAWLYSMVMVLIPSAFPMDTRHVYFEASVMILGLINLGHALELKARGKTSEAVQRLLGLQSSRAIRIGENGDEEVE
    ISQLKLGDKLRLRPGDRVALDGVVESGQSLLDEAMLTGEPIPVPKQVGDSLSAGTVNGNGSLVYRVSAGQRDTRLAKIIA
    LVQEAQTSKMPIGRLADNISAVFVPTVVVIALLAAAIWYLVGPEPALSHALVVLTSVLIIACPCALGLATPMSIMVSVGR
    AAQMGVLVKNGEALQSASKVDCVVLDKTGTVTQGKPEVTDIHWHGEYEQALSADDKSALLGAIASLEQHSEHPLANAIVS
    YVKQASIPLPATEIFTNHQGKGIEGRVNYTDYLVGNQALMTAFKVPPLTVLANSNETSELDATAHFAKQGKTPIYVAEAG
    KLVATIAIADPIKADAKEAISAIRSQGIRVVLLTGDNPQTAQAVAEQVGIEEVIAGVLPEQKQQHIKALQQQGHVVAMVG
    DGINDAPALMSADVGIAMGSGTEVAIESADMTLLSHQLIVIANLFALSRATMTNIKQNLFGAFIYNSIGIPVAAGVLYPL
    TGMLLSPVIAGAAMALSSLTVVTNANRLRQQKL

    >gi|24373442|ref|NP_717485.1| thioredoxin-dependent thiol peroxidase [Shewanella oneidensis MR-1]
    MNTLTAGAKAPLFTLQDQQGNTVSLQECLTRGPVLVYFYPKASTPGCTVQACGLRDSKAELDSHSVTALGISPDPVAKLA
    KFAEKQSLNFTLLSDEDHSVADAFGVWGEKKFMGKIYDGIHRLSFLINTDGTIAHVFDKFKTSDHHQVVLAQIAGQ

    >gi|24373660|ref|NP_717703.1| thioredoxin family protein [Shewanella oneidensis MR-1]
    MKKLVLFLGMFSASVLAAPSLDHFVFDTQSQTVSLNEFKGKVVYVDFWASWCGPCRKSFPWMNAMQQKYREQGLAVVAIN
    LDTDKALADEFLKQVPAHFTVRFNPEGDVARSFDLLGMPSSFIFNRQGQLVNQHAGFFQDNIADYEQELVNLLKE

    >gi|24373819|ref|NP_717862.1| HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
    MAITMTPAATERVRSFLANRGKGIGLRLGLKTSGCSGMAYVLEFVDALNDDDEVYDIDGVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|24373841|ref|NP_717884.1| glutathione-S-transferase domain-containing protein [Shewanella oneidensis MR-1]
    MPLPILYSFRRCPYAIRARLGLILGQCDVEIREITLKAKPAEMLAISAKGTVPVLQLPNGQVISESIEIMSWAISLGNST
    SATMLLGQTSAEQRLISELIIQNDTEFKPWLDKYKYADRYPEHSQADYFANASLFLARLETCLRLHPYLISHQLTIADYA
    IHPPISCGRRQT

    >gi|24373843|ref|NP_717886.1| hypothetical protein SO_2290 [Shewanella oneidensis MR-1]
    MSNVVVCALYKFVSLPHFESLREPLLSMMEQAEIKGTLLLASEGINGTVAGNQAAIDALLIWLNQQNGLENITYKLSFDD
    EMPFYRTKVKLKKEIVTMGVEGIDPLKVVGTYVKPKDWNALISDPEVVLVDTRNDYEVQIGTFKNAINPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFEEVYHLEGGILKYLEEVNKAESLWEGECFVFDNRVAVDHDLKKGQ
    YDQCNACRMPITEAEKLTPDYVQGVSCPHCIDKISEEQRKRFVERERQVNLAKSRNEAHIGSDVNHVIEARRQKKEALRK
    QSAEKNKAKQANA

    >gi|24373856|ref|NP_717899.1| thioredoxin reductase [Shewanella oneidensis MR-1]
    MSQVRHSNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDAEDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASARYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVANGNIILHLNQTMDEVVGDAMGVTGLKMKSTKDGAITDLAVAGVF
    VAIGHSPNTGIFEGQLEMNNGYLKVQSGLQGNATQTSIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|24373884|ref|NP_717927.1| peptide methionine sulfoxide reductase [Shewanella oneidensis MR-1]
    MALATFGAGCFWGVEYFFRQVNGVTNATCGYMGGNNEVTTYEEVKKGKTGHAEVVQVEFDPTIVSYDELLEVFWKNHNPT
    TLNMQGGDIGTQYRSTIFFHDREQKAAAEASKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHLEY

    >gi|24373906|ref|NP_717949.1| cation transporter E1-E2 family ATPase [Shewanella oneidensis MR-1]
    MTHPSCFHCNEPVLTGTQFVTQINDRDELMCCPGCQAVSQAIVDAGLLSYYKFRTEPGNKQTALVPEALNQFSAYDLPEV
    QQDFVHSEDNSDSVSLSIDGIT
    CAACAWLIEHKVKQLSGVRQVMVNSTTQRAMISWDKQQVKLSDILGQISRIGYQAAPY
    QVDEQELTTKQNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAFTASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLVNEQ
    GQEEIPAKKLRLGDIILVKPGEMVAADGCVVEGHSSINEAMLTGEQMPIDKPVDSQVFAGTINLEQPIKVKVTALGQDQL
    VAEIIRLQELASNTKPAVAMLADKLSRYFSGTILTIATITYFVWLQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPQIKHVIFDKTGTLTCGTLSVSEVKCHSHLAIEEVLAIAAALETGSLHPIATAFAAYLTPD
    VVANQVHHEVGFGVKGLINGTEYRIGNAQFTGALVNPEFINQQIWLAWGNDDSLEVLATIEIKDNIRVDSKETVGILKQQ
    GCRVSIASGDSSGHVHQLAKALGITDVHSGLTPADKLALVKKLQQSNPVVMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVRVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRIKI

    >gi|24373990|ref|NP_718033.1| thiF protein, putative [Shewanella oneidensis MR-1]
    MSATAQKSSSLNDKDFIRYSRQIFLPEVGEAGLLQLKQCHVVIIGCGGLGQLAAQYLACAGIGSITLVDDDRVELSNLPR
    QLLFNEADIGQYKAWVAKQKLAVLAPDCQLFAFVQMLTLDSAESLLAHVATANRQQSALLLDCTDNLAARHCINQLCIEH
    ALPLVSASIAAFNGQLFAVDQQRFPAGGCYHCVFPADTYAPQN
    CSNQGVLGPSVGVMASMQALLAIQLLLTATVPNLEHS
    TKPQAVGAEHLLGRFWRFDAKSLQWHSARLTRDPECEVCAPSWNTNTDHVLKSVHKGELL

    >gi|24374014|ref|NP_718057.1| hypothetical protein SO_2470 [Shewanella oneidensis MR-1]
    MTLYGIKNCDTVRKARKWIETHQLPVNFHDFREDGLAEKDLQHWCQIAGWETVFNKRSTSFRALSDADKTNIDQAKAIKL
    MLTHPTLIKRPVLVVGEQVLLGFNEAEYKKVFSL

    >gi|24374052|ref|NP_718095.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella oneidensis MR-1]
    MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLGYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAA
    ADVPEPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|24374057|ref|NP_718100.1| SoxR-reducing system protein RsxE [Shewanella oneidensis MR-1]
    MTNYREIAWQGLWKNNPGLVQRLGLCPLLAVTTTLTNALGLGIATMLVLIGSNVLISLVRDYVPKEIRIPVFVMIIAALV
    TAVQLLVNAYAYGLYMSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSSAFDGLMMGLGFTLVLVLLGATREILGQGTLFDG
    ADQLLGPWAKALTFQVWQVDTSFLLAMLPPGAFIVMGLLIALKNVIDKKLRERQPETAVQPSVARARITKVS

    >gi|24374131|ref|NP_718174.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella oneidensis MR-1]
    MNKLTDFERYVIEEKGTERPFSGQYYQHDAKGVYLCKKCHTPLYRSEDKFNAHCGWPAFDDEIPGAVSRHIDADGRRTEI
    VCSQCGGHLGHVFEGEFLTPKNIRH
    CVNSVSMLFKAQDEAEDIAPKHAFATFGAGCFWCVEAIFKSLKGVLNVRSGYSGG
    EASDADYKSVCSGQTGHAEVVHIEFDPEQIAFTTLLQVLFESHDPTTLNRQGNDKGPQYRSVVFAHDATQVDEANAMIAK
    LTEARVFDAPIVTQVVAFESFYPAEAYHNDYFALHGEQPYCQIVVRPKVEKIRALFAELQV

    >gi|24374286|ref|NP_718329.1| glutaredoxin 1 [Shewanella oneidensis MR-1]
    MYVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVR
    DNNLLG

    >gi|24374332|ref|NP_718375.1| hypothetical protein SO_2797 [Shewanella oneidensis MR-1]
    MFIIRWILGRIILLLNFVFAPKKLKRPLAEQQKIDAQTQALALYQYNACPFCVKVRRAMRRQGLNIQTLDAKKSPHKDEL
    ITLGGKQQVPCLRIEENGQVQWLYESKDIISYLDQRFA

    >gi|24374389|ref|NP_718432.1| DsbA family thiol:disulfide interchange protein [Shewanella oneidensis MR-1]
    MKSLINVVRPWVAMACGLVLSASFTLQAASFEEGKDYVTVTGISEAQKPILREFFSYNCPHCYKQEPFVASTVKLLGKNV
    AFERTPVGVGRPAWELSQLAYYVAQKLNMTKQVHEAIFKQIHEKGEQFTRPEQVKAFFVAQGAKADDVDAAMNSVDAKFS
    MMNYDSQAELAGIKGVPSLLVNGRYLVTSQVHTPEELAELVKYLAAK

    >gi|24374400|ref|NP_718443.1| arsenate reductase, putative [Shewanella oneidensis MR-1]
    MTHTSTMTKVTIYHNPRCSKSRETLALLEQQGCDITVVEYLENPPSAAEIHEILAKLQLSARELIRTKEDEYQALGLSDP
    TLSEETLIKAMVNTPKLIERPIVLANQQAAIGRPLENVLNIL

    >gi|24374409|ref|NP_718452.1| glutaredoxin domain-containing protein [Shewanella oneidensis MR-1]
    METVEKIKQQIGENPIIVYMKGSPKLPSCGFSCQVAQIMINCGEQFAFVDILQHPDIRAELPKYANWPTFPQLWIEGELI
    GGCDIVVDMYQKGELQPLIKATAEKYKTAE

    >gi|24374416|ref|NP_718459.1| disulfide bond formation protein b [Shewanella oneidensis MR-1]
    MTAFTRFAHSRVSWFFLTGSAIALEAAALYFQYVMKLDPCVMCIYQRLAVFGILAAGLVGMTAPKYRIIRILGVLGWAIS
    ATWGLKLALALVDMQNNPSPFST
    CSFLPEFPAWMPLHEWFPAIMLPTGMCTDVPWQFIGVTMAEWMVVAFSGYLVVLLLF
    IVPILSGSNKPSLYK

    >gi|24374624|ref|NP_718667.1| phage shock protein E [Shewanella oneidensis MR-1]
    MFNKLLFGSKKLLGVALLSLFSLSIVPHEANAADQQPQVAWEKIASGAMVLDVRTPEEFAAGHLVNAVNIPFEQVAAEFA
    KRGIAKDTPVVLY
    CRSGRRSGIATDALVAAGYTKTYNGGGYQTLAETQPKTE

    >gi|24374636|ref|NP_718679.1| thioredoxin, putative [Shewanella oneidensis MR-1]
    MTRVKPTATSSQSKGWRQTLQSPRFWLKQLRDLAIMALLLYGVSLYLQRDMVTGEAPTLNGIAIDGNHLALDTAQTKPTL
    VYFWGTW
    CPVCRVTSPMVETINQDHRVISVAVASGSDSNIQTYMDEHQYHFPVLNDDSGEQSAKWGAMAFPAIYIVDTQG
    DIRYVTSGITSTWGMKFRLWLAQF

    >gi|24374644|ref|NP_718687.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella oneidensis MR-1]
    MATLVTPVGELQLNANAYGLSHLTVMGSSRTEILLRHASEAEYALASEHIEQAKAQLARYFNGDLTQFNLSLAPKGTEFQ
    RQVWQALIAVDYGQCCSYADIAERIARPKAVRAVGAANGANPIAIIVP
    CHRIIGKNGQLTGYAYGLGMKQQLLMLESTSK
    GAHFTLE

    >gi|24374852|ref|NP_718895.1| anti-oxidant AhpCTSA family protein [Shewanella oneidensis MR-1]
    MPKYVSFLAAGCVFSLMLLSPMAIANDKSQVMMGEKTVTLEGKLPKLEQMAPRFKVVDDKFNPINLTDFKGKTILISAVP
    SLDTGV
    CALQTKRFNSEVGHFSDNVVMLTISTDLPFAQKRFCKVENVENIKVLSDSVWRDFGEKYGLLIEDYGLLARAIF
    IIDAEGKLKYQELVPNITEHPNYDAALEALKTIQAQQ

    >gi|24374860|ref|NP_718903.1| glutathione peroxidase, putative [Shewanella oneidensis MR-1]
    MMKFPLFILTSLMSTSVFAATCPSYLDVEVRKLHSEQSVNLCELTQGKPVLLINTASNCGYTSQFKALEALHKEYKDKGL
    VVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLATSPVRGSDVNSVFKYLGDKAGAPKWNFYKYVVSGDGNTVMQFNS
    KVKPDSTELKQAIESVL

    >gi|24375158|ref|NP_719201.1| thiol:disulfide interchange protein, putative [Shewanella oneidensis MR-1]
    MGTITLISLIILALLVGAIGLLMWQRSKGKPIPLAVIVVLGCFALGLGGIIGFVHKGEDYQAYQKLQWHTLAPEKIAPLV
    AQGYTVFVDITSDW
    CSICQTNKAEVTHREQVVNALMADDIILMQGNWSEADNTIAGYMQYEGIPGTPYNKIYGPRNPNGI
    VLPSKLTIEAVINGLAQAKAL

    >gi|24375215|ref|NP_719258.1| DsbA family thiol:disulfide interchange protein [Shewanella oneidensis MR-1]
    MIKPIALAVALIVAPFSTFAANFVEGTHYTQISDKALSSEPKLTEFFSFYCHNCFNMETNYLPDIKANLNKSIAFDSKHV
    DFMNSALGTEVMRSLAVIQDLDNKDALTHAMFAAIQGEEGANGHDHSAPGHKHESQINSRDDIKQVFAKFGIDAAKYDKL
    ADSKSTEEKLALWRAQQNQFRIESVPAFIVNDKYAVNLSSIRTLDELISLINYLAVEKDPQPAKSSGGSLNWLFLAFAAV
    FALSRQTRLS

    >gi|24375359|ref|NP_719402.1| disulfide bond formation protein [Shewanella oneidensis MR-1]
    MSINEVFRSFKAQPVNQLAKIQAERPIWFVMVGAAIFLILSAIFYFQLFLAMAPCEKCVYIRFSQSCIVIAGLIILINPR
    NNILKTLGLLLAWYAMIQGWIWSFELMKIHDAAHMVVDESMDFFAAAGDAAGSA
    CSTEPRFPLGLPLDKWLPFEFAPTGG
    CGEDDWALFGLNMAHYCMIAYATFMVCLAPLTLGWFASFMTDRRNTIVYQTR

    >gi|24375360|ref|NP_719403.1| DsbA family thiol:disulfide interchange protein [Shewanella oneidensis MR-1]
    MKKSLIVITTSLLMSFGAHAATEGVEYQVLPKAIQFDAPNQVVKIYSINCPFCYKYEKAGIPNVKIIPAGMSFEQYHITT
    KPPFGIEKSTALAIAKVVKGDSVFKELKNKYYEQYHVKKEKFKDSDSAIAYSLDILSMSRAEFDSHAKDPAVKALLAKWD
    LGVEVAKIQGIPAITVNGKYLINTKSISSMEVLKELIAELSDK

    >gi|24375874|ref|NP_719917.1| phage shock protein E [Shewanella oneidensis MR-1]
    MFQSLLAKLSGSSNGEKCWQLIEQGARVIDVRSPEEFASGHLPQAINVPLPTLDQWLHQVENKQHPFVLYCGAGIRAQKG
    CDILRANGFECVVNGGSLKDLVCCQPNP

    >gi|24376113|ref|NP_720156.1| anti-oxidant AhpCTSA family protein [Shewanella oneidensis MR-1]
    MIAQGQKLPAATLSQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADELKAKGVDLIACVSVNDAF
    VMKAWGEAQNASELLMLADGDASFTKALGLEMDTAGFGGVRSQRYAMIIDNGVVTLLNVEAPKSFEVSKAEVVLAALS

    >gi|24376144|ref|NP_720187.1| glpE protein [Shewanella oneidensis MR-1]
    MSSFKHLSVNQLVQMTEAKSVQIVDIRDGNSFNNGHIDGAFNLNNENLAHFIGQADMDRPLVVVCYHGISSQNAAQYLCE
    QGFDDVYSLDGGFSAWHEANA

    >gi|24376174|ref|NP_720218.1| glutathione reductase [Shewanella oneidensis MR-1]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHIAEAMNLYAKDYGFDVSVNKFD
    WNTLVNSREAYIGRIHEAYGRGFTNNKVTLLNGYGRFVNGNTIEVNGEHYTADHILIATGGAPTIPNIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLFVRKHAPLRNFDPMLIDALVDAMKTEGPTLHTNSVPQSVVKNADD
    SLTLNLENGESVTVDCLIWAIGRSPATGNIGLENTEVQLDSKGYVITDAQQNTTHKGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNAMSDAKMDYSQIPTVVFSHPPIGTMGLTEPEARAQYGDGNVKVYTSSFTSMYTAVTSHRQACKMKLVCAGKE
    DKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|24374919|ref|NP_718962.1| OsmC/Ohr family protein [Shewanella oneidensis MR-1]
    MGFNLTVNWQTSPAEEGEFCRDHSITFGSGQTIQASSAPEYKGNEHFVNPEESLLAALSSCHMLTFLAIAHLKRLPVTSY
    VDEASAELGKNEAGKLAITKMILNPKIVFADGVEVTQETLEKIHEKAHAN
    CFIANTLATDIQIKF

    >gi|24373417|ref|NP_717460.1| hypothetical protein SO_1852 [Shewanella oneidensis MR-1]
    MQINNALQASYVLYHTEGCHLCELAAALLNAAEVRYTAIDICDDETLAERYGVSIPVVKAQDERCLCWPFDATQLQEFLG
    A

    >gi|24374812|ref|NP_718855.1| flavocytochrome c flavin subunit [Shewanella oneidensis MR-1]
    MAGRRDFLKLATGITAAMAFPIKASNDNYGRTWDKEFDIIIIGSGFAGLSAAYSAHKAGIKNIIVLEKMEAFGGNSAICG
    GLMCMPLTPMQKKLGIEDSAELMIKDMLKAGRGFNHPELCRTLATEAHKAYDMLMECGVKFQDKVIRLGGHSAPRAHLPE
    SASGGGIVVPMHNYLRKAGIIFQNRTNVEEIIRGDSGVTGIVVSEKYDFKSGSNRGQFAYKAKKGVIVASGGWGQDHQFI
    KTTMPAYQKLESTAQPGATATMIKSLLSIRALPVMLDMYQLGPWATPDEKGAGPASFFADYAFAEGIAIDPKTGARFMNE
    LADRRTRADAQLAVLASGTKEKPNMPFVFCGEATANHAEGFKAAYRDGAIKKSETLEELAKRYDVDINALQNSINEWNEI
    VQGKAKDPFNKPLDEKTILKPPYYSIRLSPKLHYCMGGVAITPNAEVIDSNTCEPISGLFAAGEVTGGTHGMDRLGGCSS
    IDGLVFGQIAGNQAAIRKV