Shewanella loihica PV 4 uid58349

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|127510982|ref|YP_001092179.1| molybdopterin biosynthesis protein MoeB [Shewanella loihica PV-4]
    MEPNTQEEILSDAEILRYSRHISIKAMDFEGQERLKQAKVLVIGAGGLGCASTQYLAVAGVGQLTLVDFDTVELSNLQRQ
    VLHHDATIGQPKVESAKTSLMQLNPHLRVETINAVLDDEQILALVAEHDLVMDCTDNIVVREQLNQACFQHKVPLVSAAA
    IRMEGTVTVFDYGEQSPCYHCYSKLFGDQQLT
    CVESGILAPVVGMIGCLQAVEAIKVLAKMGKTLSGRILMIDAMTMEFR
    EMKLPKQPHCQVCGM

    >gi|127511069|ref|YP_001092266.1| selenide, water dikinase [Shewanella loihica PV-4]
    MSAEKIKLTEYSHGAGCGCKISPKVLGTILASQLPSFDDPNILVGNQTRDDAAVYRLNDETGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPMMAIAILGWPVNVLPAEIAQQVVDGGRQACKDAGIMLAGGHSIDAPEPIFGLAVTGQIPLN
    ELKQNDTAKAGDRLFLTKPLGIGILTTAQKQKKLADEDIDIAPGAMCQLNKIGAAIAKISGVTAMTDVTGFGLAGHLIEM
    CQGATLAAKIDLNALPMLPKAMDYLRLGCIPGGTHRNYDSYGEHLPEVNEEQKALLCDPQTSGGLLIAVSNSHEAELLAL
    LGKEGLPTQCIGHLAPQTESQPLVELI

    >gi|127511128|ref|YP_001092325.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella loihica PV-4]
    MKKRLVLFIPLILFLVMGVFLYKGLFLNPQQLDSALEGKPIPAFQLQKLEDANEIITNDSIKGQVSLLNVWATWCPSCKY
    EHPYLMRLARQNILPIYGINYRDERAMAIRELSREGDPYTKNIFDHDGRLGLDLGVYGAPESYLVDHNGIIRFRYAGPID
    MRVWNETLYPMIQELQAQAKAEGAS

    >gi|127511130|ref|YP_001092327.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MKSKLATALLSAALALGGYAASVQAYPGMQKKQGGEVQSSVDLINVLPKAYPIDPVPFKDAQGKAIDFSQYRGQVVMVNM
    WATW
    CPPCVRELPAIDRFKGKFDPKQFRVLPISIDMNGKEKVEPFLASLGMDKFETYYDPQQQLGQVFPLDTIPATFILN
    QQGELIAFVRTFVDWDDEKAVKLIESFIASETQKQ

    >gi|127511178|ref|YP_001092375.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Shewanella loihica PV-4]
    MLDRRSILKMAAGGALLSLVPASTLQAKTLGKRYAMVFDVRRCTGCLSCTVSCSVENQTDAGRCRTRVNQASLSLGERIA
    TLAVPNQCNQCDNPVCTQVCPVEATYKRKEDGIVVIDHEECIHCQLCVDACPYGARRKDESLDNPPEKCNFCIHRVTQGL
    LPACVETCIGGARTFGDLNDPDSQVSKLVRDNKVYAMLSEAGTSPNIFYIGLPTSTDDQAILNLNYLDWQR

    >gi|127511196|ref|YP_001092393.1| hypothetical protein Shew_0262 [Shewanella loihica PV-4]
    MKFKQDYFDQLSGFYSQVTPQGLPRPQWLAWSEDAAALIGLKQPDDELLQGLAGNQAIPGASYYAQVYSGHQFGGYSPQL
    GDGRSIILGEAEGPQGYWDVALKGAGMTPYSRHGDGRAVMRSAVREFLVSEALHHLNIPTTRALAVIGSDLPVWRETQET
    AAITVRLAKSHIRFGHFEFFCHSEQGSKDKLKQLLDFTLSQHYPELSRDQAGYIAWFNRVVADTAKLIAHWQAVGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFEEDFICNHSDPNGRYAFGQQPGVGLWNLQRLAQALVPIIASDDLIAALNTYQHHLV
    QAYLVLMRDKLGIKLVEPAGSERDEADLQLIGGFTLLMEANRLDHTNTWRRFAQLDPNSQHSSLRDDFIDLAGFDTWYQA
    YQERLGQVSDVAGWQAVRAQVNPKYVLRNYLAQEAIIACEEGNTQPLAELHQLLTRPFDEQPEKEAYAKRPPEWGQGLIM
    S
    CSS

    >gi|127511199|ref|YP_001092396.1| DSBA oxidoreductase [Shewanella loihica PV-4]
    MKKALLVALALLVAPMAALAADYKEGVHYTVINDGPATAKPEIAEFFSFYCPHCYNFAKTQVPKIKANLPEGVVFKQNHV
    EFIGREMGPEMSRAFAVANQLKVEDKMEHALFAAIHDKKQRFVSRDDIRQLFIANGVDGKDFDAAANSFMVSAQMAQMKR
    ATENAKLSGVPALVVNGKYRVETGAIKSYDELLQIAYYLTSLK

    >gi|127511272|ref|YP_001092469.1| thioredoxin [Shewanella loihica PV-4]
    MSDKIITLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLNVDQNNASPAKYGVRGIPTLL
    LFKNGELADTKVGALSKTQLKEFIDAQL

    >gi|127511276|ref|YP_001092473.1| hypothetical protein Shew_0342 [Shewanella loihica PV-4]
    MTNNIKALLATTALFFSTQALANNGCAFDEKQEGFIATCSEEKQEVILTGEVQAQTLVTELDDFTQGYKSYQVDEAAIAP
    IKKLQTPTEIVVIIGTW
    CPDCHRETPRFIRIMEATNNPNIKVTYIGVDRKKLDPEGLAAKYDFTRIPTFIVKQDGKEIGR
    IVERPETSLEVNLAKILD

    >gi|127511279|ref|YP_001092476.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MRKRLVALLKLALLSLALSALSLMTPTSNALAVMPSAKVYDTGENLPKPVIMSRFVEMTSARKVDEATFESLSGDQVKLS
    DYRGKLVLINLWATW
    CAPCIKEIPMMDKIRRDNLDKDLVVLPLSIDEAHDEVGAFLTRHQLAGYPTLIDPQRQVEKMLPA
    NIVPATYAFDGEGNLIGFLRGYLDWGDKAVQPYLERLTAKYAKPNKAQHLH

    >gi|127511283|ref|YP_001092480.1| rhodanese domain-containing protein [Shewanella loihica PV-4]
    MKSKLGLSLALLLGLTPLCSLAGGGAEMAPAHRYEHSLHTISLAEAEALLAQKDVYFFDVNTLELWAEGYIPGAVYFNVD
    NWKTLLPEDKAARMVFY
    CANRLCNASEIAAHQVMKLGYTNVMQMHDGIYGWRLSGRSIEKP

    >gi|127511421|ref|YP_001092618.1| redox-active disulfide protein 2 [Shewanella loihica PV-4]
    MKIEVLGSGCKRCTNLASDIARIADELNLNIELTKVTDMAQIAAYGVMSTPAIVIDGEVLAAGRLPSEEELAQLLTKINK
    VQ

    >gi|127511437|ref|YP_001092634.1| thioredoxin domain-containing protein [Shewanella loihica PV-4]
    MPQLTADNIESSDALDDYLAAHEAVLLLFGGAHCGVCQSIKPRLLQMLAEEFPKMRLCYIDCEQQGDIAAAHRVFTLPVV
    ELYFQGQAFARFVKVFAMVEVREAIARPYQLLD

    >gi|127511603|ref|YP_001092800.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MNKLVTRLLLGLSLLLAAQANATDLKVGDKAPDFRLQATDGHYYQLSDYLGKQTLVLAWYPMANTRGCTLECKSLVEKGD
    LIRQYKAVYMMASVDDLEDNQKFAKEQKADFPMLSDPTKETAKAYDVLNLVRVASRVTFYIGEDGTILKIDEDIHPKTAA
    EDIAANLAALGIAKAE

    >gi|127511620|ref|YP_001092817.1| DSBA oxidoreductase [Shewanella loihica PV-4]
    MIKHIALALTLAVAPLTSFAAQFVEGQHFMTVSDKAPSASPKLTEFYSFYCHNCFNMETQFLGDIKANLDKRVSFDSKHV
    DFMNSDIGTEVMRSLGVIQELGIEDKMVHAMFSAIQGEQGGHGHSHDHDHSAHEKPAINTRDDIKKVFADQGIDISKYDE
    IADGKTVSGKLDLWRAQQREFRIQSVPTFIVNDKYAVNLSQIRTLGELIDLINYLAVEHK

    >gi|127511663|ref|YP_001092860.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella loihica PV-4]
    MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANCGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHE
    VVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGG
    FIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHI
    KGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPL
    AGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLL
    FDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQI
    DNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIF
    CQVGLRGNVAYRQLVNNGYRARNLIGGYRT
    YKFASV

    >gi|127511705|ref|YP_001092902.1| thiol:disulfide interchange protein DsbC [Shewanella loihica PV-4]
    MKFTRALTLVVAMVATPLMAASNNVVDNGDQLKQKLSDTLGVEVQNLSQSPIPGLYEAITNRGVLYISKDGSKLFHGNLY
    DLDNGMKNLTEAALAGPRMEAIKPFEPNMLVYKAKDEKHVVTVFTDIT
    CGYCRKLHNQMAEYNDLGITVRYLAFPRQGVP
    SKNAVDMEAVWCSADPLKAMTDAKAGKQVSGAKCDAKIAQQYQLGQSLGVNGTPAIILEDGTMIPGYQPPEQLLQVLDRV
    Q

    >gi|127511726|ref|YP_001092923.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella loihica PV-4]
    MTQSIINTEIKPFSATAYHKGDFVSVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQSMGVEVYSVSTDTHFT
    HKAWHDSSDTIGKINYPMIGDPTGVISRNFGVMIEEEGLALRGTFVINPEGQIKVAEIHDLGIGRSASELVRKIQAAQYV
    ATHDGEVCPAAWQPGEETLAPSLDLVGKI

    >gi|127511727|ref|YP_001092924.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella loihica PV-4]
    MLDANVKNQLTTYLQNLKRPVELVVSADERPKAKELLSLATDIAALSELVSLTESVGERTPSMTVTSPDTGSQIHFAGLP
    MGHEFTSLVLALLHTGGHPIKLAPEVIEQIRDLPGEYRFETYVSLS
    CQTCPEVVQALNMMSAINPNIQNTMIDGALFQDE
    VNERNIMAVPSVYLNGEPFSVGGISVVEILNKLDVNAASRQAEKLSQKEAFDVLVVGGGPAGASAAIYAARKGLRTGILA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHDYDVDIMDNQRALSLKSGELFEIQTESGALLRSKTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAASMGNI
    EIITQAMTTEVVGDGTRVQGLNYTDRATGEQHHVALAGIFVQIGLVPNAEWLKGTVDLSERGEIIVDAKGQTSLPGVFAA
    GDVTNSAFKQIIIAMGSGATASLGAFDYLIRLGEPADAEAA

    >gi|127511731|ref|YP_001092928.1| hypothetical protein Shew_0797 [Shewanella loihica PV-4]
    MFRALMFCFLLLSSALPSFAQAEEHTASQNATWHYVDADGQLKIKLYFFWSKTCPHCAEAHPFIDSLPEKYPWIELESHM
    VSQAGTQEKWQAIAEQTKVAARSVPYIAACEQATVGYSSEAVTGQFILQQLKACYRALGGVVADNDQAVQTGMASAEGEP
    LFATCSASSEPGTCDLGLEESAPAAPVTKVQPIELPLIGVVAPEQLSLPVLTVVLAGVDAFNPCAFFVLLFLLSIMVNAK
    SRSRMLIVGGIFVFFSGFIYFLFMIAWLNIFELLGAGSDGGLIILGAGLMALVAGAINIKEYFFTKGEVSLSMSAENRTG
    LIKRMGKLTSASSMAAMIAGTVVLAILANAYELLCTAGFPMIYTSVLSMHELPAFERYLYLAFYNIVYVIPLAAIVIAFS
    ATLGKRKLTEKEGQTLKLMSGIMMIGLGGMLALDPTALQNAGLAIGLIFASIGLTFIISMGRKLIERRGATS

    >gi|127511882|ref|YP_001093079.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MTKTQNSRAGALLSALLFTLMSLALITPSVSAKPIAESPTSISPLLNGQTVPSIQVKDLKGKSLDLQQMLQEKPSVLFFY
    RGGW
    CPFCNAQMGQLQAIEGDLLKMGFQLIGISPDAPEELRASMTKNDLNYTLVSDADLNAMRAFGLAYFTSQTISDRYM
    AKMQLKNKLWKNAAGESRLVLPVPAVYITDKTGLVHFQYINPNYKVRAEPKLILTAASLIPQ

    >gi|127511901|ref|YP_001093098.1| 3-mercaptopyruvate sulfurtransferase [Shewanella loihica PV-4]
    MELEYPLVTTAWLEANLFEGNLVLLDASMQSVVGKEPILYDEFVCIPRSQKFDIEQVFCDTTSSQLHAMPTPEQFEQGAT
    ALGIDRDSLVVIYDNQGIYSAPRAWWMFKLMGHENVYVLDGGLPQWLSEERMTSESYQPTVIDEESVPYVADFQPGLICD
    ANYVLESLGGDSVILDARAAGRFAGEVSEPRSGVRCGHIPGSVNLPFGELLREHRMKRVEDLQAMFEQLVGEQEAERIFS
    CGSGITACILILASVASGHDKAVLYDGSWADWGSNADLPIEQGA

    >gi|127511950|ref|YP_001093147.1| iron-sulfur cluster insertion protein ErpA [Shewanella loihica PV-4]
    MTEQAEDTMPIRFTDAAAAKVKTLLEEEQNDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|127512168|ref|YP_001093365.1| OsmC family protein [Shewanella loihica PV-4]
    MSFSVTVSWPPATHGSHHTAQNSGPLQREPLAKDSGTGDEKISRDHQLSFASGQVVAGSAAPEYQGSQEKVNPEESLLSA
    LAACHMLSFLTIVAKKRLTLLSYRDEARAELGRNEKGQMAITHIALTPEVEMAQPLSEEQLAKLHALAHKH
    CFIANSLAK
    EIAIEIAPRQKR

    >gi|127512176|ref|YP_001093373.1| OsmC family protein [Shewanella loihica PV-4]
    MKTLYETQATASAGRNGQVTTDDGKLSIALSYPKEMGGSGEASNPEQLFAAGYSACFSNAVLHVAREAKVKLTQAPVTAK
    VGIGARAEGGFGLTVALSVELAVSDELSQEQAAELVRTAHQV
    CPYSNAVRNNIDVALTVNGQSL

    >gi|127512382|ref|YP_001093579.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella loihica PV-4]
    MNQKTSVLEYIPLSRDAGLSGYQALAERVIDTPLGKVSLAANQFGLSHLSFLPGQDDDFAAREVTLVARDRQALEQAEAH
    LDQAERELSAYFAGKLTAFSLALAPVGTPFQHQVWQALLAHPFGDAASYSDIASAIDNPKAVRAVGSANGANRIAIIIP
    C
    HRIIGKGGALTGYAYGLGIKQQLLALEAEAVGESL

    >gi|127512430|ref|YP_001093627.1| glutaredoxin [Shewanella loihica PV-4]
    MFIVRWVLGRIILFLNFVFTPKKRQRPLAEQAKVDEQTQGLQLYQYAACPFCVKVRRAIRRQGLNIVTVDAKQAEHQQML
    VEQGGLAKVPCLRIDEAGETQWMYESSDIIDYLNKRFA

    >gi|127512445|ref|YP_001093642.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella loihica PV-4]
    MSVLVGRPAPDFTAAAVLGNGEIVDSFTLSEAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVDKGGIGQVQYTLVADVKHDICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMDASPEGVASYLTDNADSL

    >gi|127512460|ref|YP_001093657.1| glutaredoxin 1 [Shewanella loihica PV-4]
    MFVVIFGRPGCPYCVRAVQLSEQLVESRDDFKFKYVDIHAEGITKADLEKTVGKPVETVPQIFIDQEHIGGCTEFEQYVR
    DNNLL

    >gi|127512520|ref|YP_001093717.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella loihica PV-4]
    MRELTEFERYVIESKGTERPFSGEYNQHDAPGVYHCKRCDAPLYLSEHKFNAHCGWPAFDDEIPGAIKRLPDADGHRVEI
    VCAQCGAHLGHVFEGEYLTDKNLRH
    CVNSVSMVFKGEATQQSDDSHIRWATIGGGCFWCLEAVFSQLRGVIAVKSGYAGG
    DASSANYRAVCAGDTGHAEVVQIEFDSHIISFEELLEVFWQSHDPTTLNRQGNDVGTQYRSVIFAHDDEQIRAASQMISR
    LTEANIFDKPIVTELVALDNFYPAEPYHDAYFEHNRQQPYCQMVVKPKVDKIKALFKERLKSGGG

    >gi|127512573|ref|YP_001093770.1| DSBA oxidoreductase [Shewanella loihica PV-4]
    MPSTHSTVIVCLSLLFFTAACQQKNDDKLEKELAYLKQEMGQLKQQVAIMGSQVKEIHTIAMKSQEPQHRSLPTQINPGE
    DGKLPALGEATAQVAIIEFSDYQ
    CPYCKRYMDNTFTKIKSDYIDTGKVKYIARDFPLGFHPKAKGAAIAANCSLQQDAYW
    PMRDALFKNMRQLGDKLYQDTATQLSLDMTKFAACLEDQAIMSKIEQDIGYGSSIGVRGTPSFLIGKLENNRLIEPKLVV
    GAQSYDTFKAVIDALEKPTQTN

    >gi|127512708|ref|YP_001093905.1| glutathione S-transferase domain-containing protein [Shewanella loihica PV-4]
    MAYPTLYSFRRCPYAMRARLGLFLAGQEVELREIILKHKPEPMLAASPKGTVPVLILEDGNVIDESLSIMLWALGKKAKE
    GDQKGDEKTEALLLSHEPDLQHAAMALIAENDNEFKPWLDKYKYADRHPEQTQEDYRAQGEHFIARLEARLNEHAQLMAD
    VTTLADYAIFPFVRQFAHVDSTWWQHAPYPKVRAWLTNHIDSPVFTAIMKKYPTWLDSGESFSLLEN

    >gi|127512709|ref|YP_001093906.1| hypothetical protein Shew_1781 [Shewanella loihica PV-4]
    MSQFVVCALYKFVSLPAFEALQQPLLKEMESLEIKGTLLLASEGINGTVAGSQAGIDSLLAWLDAQPGLDNIVYKLSFDD
    EMPFYRTKVKLKKEIVTMGVEGIDPRKVVGTYVKPKDWNKLISDPEVLLIDTRNDYEVNIGTFKNAVDPKTQTFREFPDY
    VKQNLDPKQHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGVLKYLEEVKPEESLWEGECFVFDNRVSVNHQLEKGQ
    YDQCNACRLPITEEDKQSEHYVQGVSCPHCIDKLSDKQRKRFVERERQVQLAKSRGESHIGSDVKQVIEARRQDKVERKQ
    RQHQEG

    >gi|127512763|ref|YP_001093960.1| glutaredoxin-like protein [Shewanella loihica PV-4]
    MDTNETVEKIKQQIAENPIIVYMKGSPKLPSCGFSSQVAQIMINCGAQFAYVDILQHPDIRAELPKYANWPTFPQLWVEG
    ELIGGCDILTEMYQKGELQTLIADTAAKYADQEGEA

    >gi|127512768|ref|YP_001093965.1| arsenate reductase [Shewanella loihica PV-4]
    MDRTAMTQVSIIHNPRCSKSRQTLALLEEKACDIQVIEYLKTPLTKVEIRSILDKLGLAPRELMRTKEEEYKALNLADVT
    DDEALIQAMVDTPKLIERPIVLANGKAAIGRPPENVLAIL

    >gi|127512774|ref|YP_001093971.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MKTLTQGDKAPDFTLQNQNDESVSLADFKGKKVLVYFYPRASTPGCTVQACGLRDTKSELDELNVVIIGISPDTPKKLTN
    FTNKQELNFTLLADEEHAVCEAYGVWQLKKFMGRENMGVVRTSFLIDESGNIEHIFNKFKTKDHHEVVLKYIQENS

    >gi|127512791|ref|YP_001093988.1| arsenate reductase and related [Shewanella loihica PV-4]
    MTLYGIKNCDTVKKALKWLDANQQAVTFHDFRVDGLTEAQLNTWVEQIGWESLFNKRSTSFRNLSDAEKADIDQAKAVAL
    MLTYPTLIKRPVLEHQGELSVGFKPAQYEEIFNR

    >gi|127512823|ref|YP_001094020.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MSREQKMQGVQPSVEGRMRSPMMAKLLWLSMAMLVSLSMVQPSHAAPRLDLSAKTQSGELVSLESYKGKVVYVDFWASWC
    AP
    CRDSFPWMELMHQRYGDKGLAIVAINLDEESEMAGPFLADFKTSFDILYDPKGEMAGHFNLQGMPSSYLFDAEGNLVS
    EHLGFFKSKQAAVEQEIQSLLKKRSADAN

    >gi|127512851|ref|YP_001094048.1| peptide methionine sulfoxide reductase [Shewanella loihica PV-4]
    MALATFGAGCFWGVEYFFKQIDGVTSATCGYMGGDDKATTYKEVKTGTTGHAEVVQVEFDETKVSFDDLLAVFWSNHNPT
    MLNMQGGDIGSQYRSAIFFHDKTQKEQAEASKLALARSGKWGLRPIVTEIVPVLTFHKAEEYHQNYLEKNNLPSCHLTY

    >gi|127512918|ref|YP_001094115.1| heavy metal translocating P-type ATPase [Shewanella loihica PV-4]
    MDALNCFHCGEPVTTGRQFETLIDNVPQPMCCPGCQAVSAAIIEAGLTNYYKYRTEPGSKQTALVPEALNAFSAFDLKEV
    QQDFVHQDVHKDKQSASTSLTIDGIT
    CAACAWLIEHKLQHLDGINKIAVNTTTERAQVSWNPEKLKLSEILAQISRIGYQ
    AAPYQVDDEEIQSKKNSRKFLLRLGLAGFATMQVMMFALALYSDYFTDLDVEFRDYFRWVSMIFAAPVVFYSAQPFYFSA
    VRAMLSGRLNMDVSVSIAICGAYIASCIATVSGQGEVYFESVSMFTFFLLLGRYFEQNARQKASISSNNLHKLIPLTANL
    LDKDGIQTEVPAKRLKVGDLIMVKPGEVIAADGDIIEGMSSVNEAMLTGEQMPVTKNITSQVYAGTINVDHPIKVQVTAT
    GQDQLVAEIIRLQEAASNNKPKVALYVDTISNYFTWTILVVAALTYLVWKHYWPDDAFWVTLSVLVATCPCALALATPTA
    VTCATGLFTRLGVVARRSGVFEKLPKVDQVVFDKTGTLTCGSLTLRETKKFTQRFNQDASLDVLAIAAAMESHSIHPIAK
    AFAPYYQTGYRLDESQYVAGAGVQAKVNGTRYFLGSADFIRQNTSLTAIDGQCSVYLADNDALLAGFTLSDTVREDAKAT
    LVTLKEMGFATCIASGDTSEHVEQVAKEVGIENLHKGLKPQDKLKLINQLKDEGKQVVMFGDGVNDAPVLAGANLSVAMG
    SGADIAKNSADLILLGDQLSRFPQAVRIAKMTEQIIRQNLIWALGYNLLIIPLAVTGHVLPYIAAIGMSASSLIVVANSL
    RLLKVRL

    >gi|127512956|ref|YP_001094153.1| thioredoxin reductase [Shewanella loihica PV-4]
    MSQARHCNLLILGSGPAGYTAAVYAARANLKPVLITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFETEI
    IFDHINEVNLQERPFQLKGDSGEYTCDALIISTGASAMYLGLESEEAFKGKGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILTKRLMDKVANGNIVLHLDSTLDEVVGDNMGVTGVKIKSTKDESITEFDVMGVF
    VAIGHKPNTQMFEGQLEMNNGYIKVQSGLGGNATQTSIPGVFAAGDVMDQHYRQAITSAGTGCMAALDAERFLDAQ

    >gi|127512994|ref|YP_001094191.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella loihica PV-4]
    MSEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVDTYLLTPFDLSYLRTMAFILV
    IAVVVQFTEMLVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIESAIYGFGAAVGFSIVLILFSAMRERLAA
    ADVPAPFKGGAIAMITAGLMSLAFMGFTGLVN

    >gi|127512999|ref|YP_001094196.1| SoxR-reducing system protein RsxE [Shewanella loihica PV-4]
    MSNYRDIAWQGLWKNNPGLVQLLGLCPLLAVTATLTNAIGLGLATLVVLVGSNVLVSLVREFVPKEIRIPVFVMIIAALV
    TCVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVVKAAFDGLMMGLGFTLVLMLLGACREILGQGTLFDG
    ADLLLGDWAKGLTIHLWQVDTNFLLAMLPPGAFIAMGFLIAIKNMIDKQLEARKPALEAAPAVTRARITKVS

    >gi|127513022|ref|YP_001094219.1| UBA/THIF-type NAD/FAD binding protein [Shewanella loihica PV-4]
    MSLNDSAFIRYSRQIMLPEVGELGQQRLMEASVAIVGVGGLGQLCAQYLSAAGIGQLTLIDDDKVELSNLPRQLLFSHDD
    CGQYKAEVARDRLVGKGTGDNSQVSAFGQIAAKVVRLELHNAESLLSGVDLVLDCCDNFATRQHINAACVALSTPNVVAA
    AAHFAGQLMAFDLSKSPNSGCYHCLFPAELRVSEN
    CSTIGVLGPMVGTMASMQALLAIKLLLGLPGLGQVHRFDGLTGEM
    RKLTLRRDHKCSVCAAIKESNIKAYAACGELACSSALGENDE

    >gi|127513104|ref|YP_001094301.1| disulphide bond formation protein DsbB [Shewanella loihica PV-4]
    MSALTRFAQSRLAWTLLLLTAVGLEACALFFQHVMKLDPCVMCIYQRLAVLGVLTAGLIGVVGHQFRLLRFLGVLLWGVS
    AAWGLKLALELVEMQTNPSPFST
    CSFLPEFPEWMPLHEWFPSVFLPTGMCTDIPWEMFGITMSQWMVVAFSTYLIALVVF
    IVPALMPTKKA

    >gi|127513243|ref|YP_001094440.1| iron-sulfur cluster assembly protein IscA [Shewanella loihica PV-4]
    MAITMTPAAADRVRSFLANRGKGIGLRLGLKTSGCSGMAYVLEFVDELNDDDEVYEIDGVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|127513268|ref|YP_001094465.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MPFVKPRRKRYRYLRDAALMALLAFAVLSYQQRNMISGEAPPLKDITTQGQPIALEQGEVTLVYFWGTWCPVCRVTSPMV
    NRVAEQHKVISIAVASGTDGEINQFMAEHGYQFDVIGDEVILHQAWGASVFPAIYIVDKQGQIRFKTSGATSSWGMRLRL
    LLAAW

    >gi|127513301|ref|YP_001094498.1| DSBA oxidoreductase [Shewanella loihica PV-4]
    MKRVVNLCRYVGLLFIALAAFQVSAQAKYVEGVDYVKVAGIPEVNQPVVREFFSYNCPHCYRQDGLITSAVAKLKADLGE
    KLAFERTPVAGGRAAWQLSQEAYYLAKKFHVTEQTHGNLFKRIHEGNGAFKRQEELSQFFVEQGLSKAEVDKALASVDNK
    LAVADYDTQAQLSGIRGVPSLLVNGKYLVSNKQRSAEELADLLAYLSTLK

    >gi|127513370|ref|YP_001094567.1| rhodanese domain-containing protein [Shewanella loihica PV-4]
    MRQANKMLSKSIISLMALLFVAIMGVSAPSYGEEKNPKVAWEHIQQGAMVVDVRTPEEFAEGHLENAINIPFENIAEEFT
    KRGIAKDQSVVLY
    CRSGRRSGIAQESLVKLGYSNTYNGGGYQSLAKH

    >gi|127513633|ref|YP_001094830.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella loihica PV-4]
    MEHYINLFVQAVFIDNMALSFFMGMCTFLAVSKKVSTSFGLGIAVIVVMTLAVPLNQLIYSKVLAPGALAWAGYPELDLS
    YLKLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYTLGESVVFATGSGLGWAMAIVL
    LAGLRERMKFHAIPAGLQGVGITFITTGLMALGFMSFSGISL

    >gi|127513634|ref|YP_001094831.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella loihica PV-4]
    MSKSMTATRDILTGPIFANNPVAMQVLGVCSALAVSNSMQTALVMTLAVTFVLVFSNLIISSIRNFIPNSVRIIAQMTVI
    ASLVIIVDMVLQDVAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKMPPHLAVVDAMGNAMGYGVILLSVAFVRELLGAGT
    LFGHEILKTVENDGWYLANEMFKLPPSAFFLIGLLIWAINVIQRKRG

    >gi|127513669|ref|YP_001094866.1| glutathione peroxidase [Shewanella loihica PV-4]
    MSIYDFSLTRIDGSTQPMADYKGKVLLIVNTASKCGFTPQYQALQALYEQFGPERFAVLGFPCNQFGQQEQGDESEISQF
    CELNFGVSFPLFAKIEVNGDKAHPLYRYLKREAKGVLGSESIKWNFTKFLVDGHGCVLERFAPTTKPESLAEKIAALVSQ
    SK

    >gi|127513805|ref|YP_001095002.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella loihica PV-4]
    MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPVNQIIYQGILAPGALAWAGVPDADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLGESLVFGIGSGIGWALAIVL
    LAGIREKLKYADVPNGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|127513806|ref|YP_001095003.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella loihica PV-4]
    MADAKELKQVLTGPIISNNPIALQILGVCSALAVTSKMETALVMTIALTAVTALSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVGFVRELFGNGSL
    FGVEILSKISEGGWYQPNGLLLLPPSAFFLIASLIWIIRTIKPEQVEAKG

    >gi|127513961|ref|YP_001095158.1| hypothetical protein Shew_3033 [Shewanella loihica PV-4]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDISTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPDDISDKDREGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPEGDSSTYILGKDLPLE
    QTIANMTEILAGLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGASKESALCSALGEFIERLNCNFFYNDQFFGLD
    IANSEFVHYPNEKWFALTDDDSLPEGMLDDYSLEIYNPDGELCGSHLIDTNSGNIERGICTIPYKRRSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAEVQCLSEIFERAVKRQIIEQEIVLPDVPMAVLEKYPSILAGIKGLEEQGFPVVVRDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRF
    FSNKADYAFCEWDFSGTNEEEAKGLFGILESLGKEVYVAEFEELGASACRILVPDYSEVYPVDDLIWDNTNKALDYREDI
    LNLHRLSDDELADLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHEEALELVEDFLQFNDNTV
    QRGLFYQAMSAVLEVTLDEELELEDFIGNFTRMFGEEVMAQVVGSVNGEVRFSGLTETSMALEGIEPHLRLIESYKKLHQ
    ARKIKAGL

    >gi|127514008|ref|YP_001095205.1| thiol:disulfide interchange protein, putative [Shewanella loihica PV-4]
    MNNILLVSALTLSLLLGLFVWLSYKKLKGSQIPTGVLAVLLVFALINGAVSYFIAPKAGDDAYKQLVWQSLSPNAIPDQL
    AQGKTVFVDVSADW
    CNICKANKDRVLHQAVVVERLKDKDMVLMRGDLTQSDARIEAYLAQYQAYGVPFNIVYSQAHPDGL
    VLPRVLSIDDLLSALPPRD

    >gi|127514194|ref|YP_001095391.1| thiol:disulfide interchange protein precursor [Shewanella loihica PV-4]
    MKKILFLFLSTLLLIAPGAQSESLFSNSKFDFLKDEPQLMPVDQAFVFDAQQEGNLVKISWVIADGYYLYRDKLKFTADG
    ATLGEIQLPKGKAHSDEYFGEQQVYYSYVEVPVALKEATAEANISVTFMGCAEGKLCFPPTTRSAPLTQVAANAGLLPEA
    MKATPVASETASNQAPITQQDSLSQMLSGDNLLWTLVIFFGLGIGLALTPCVFPMYPILSGIIVGQGEKLSTGKAFSLSM
    VYVQGMAITYSLLGLIVASAGMKYQAALQHPAVLVGLAILFLVLSLSMFGLYELRLPSSWQEKMNRFSNNQKGGNVLGVF
    VMGIISGLVASPCTTAPLSGALVYVAQTGDLMQGFLALYVLSMGMGLPLLIIGSSGGKLLPRAGAWMDVIKTVFGFLLIA
    VSILMIGRIWTGLVSDLLWALWGVSLTAYLMHQNKLTEFNWKQTVRSVLLLLALLGSFSYGFQAVMTSLGYQAHTGAVSH
    KVSHKTIKSLEDLQAEVAAASAQGKPVMLDLYADW
    CVACKEFEKITFVDPEVQARLSQMVFLQADVTKNDAIDIELLEHY
    EVLGLPTLLMFDAKGEIRDELRVTGFMKPAEFAAHLDHLLAK

    >gi|127514261|ref|YP_001095458.1| electron transport protein SCO1/SenC [Shewanella loihica PV-4]
    MTRVNQGKFHLALSLCVLLIGSLMSAASMANMPILKGIGGDFSLRSSKGGEVRLSDFHDKVVMMFFGYTNCADICPTTMA
    HISQLMHQLPSETRDRIQVLFISIDSDYDTPKHLNKYLSYFDPSFIGLVDEREKIDEVAALFKADYTKLAEEKVTTEYKK
    LSLEDSKAPKRQGYLYSHTAKIFVLDGKQRVRGFFYTGTPIDEMRQQIESLL

    >gi|127514357|ref|YP_001095554.1| dihydrolipoamide dehydrogenase [Shewanella loihica PV-4]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKAISNHGVVFGEPQ
    IDLDKLREFKQSVISQLTGGLGGMSKMRKVNVVNGLGKFTGPNTIEVAGEDGVKVVHFEQAIIAAGSRPIQLPFIPHEDP
    RIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDIVRVYTKKIKNKFNLILETKVTA
    VEAKEDGIYVSMEGKKAPTEPVRYDAVLVAIGRTPNGKLIDADKAGVNIDERGFINVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETASFPWAASGRAIASDCSEGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKK

    >gi|127514456|ref|YP_001095653.1| rhodanese domain-containing protein [Shewanella loihica PV-4]
    MFQSLLAKLSGSHPAEQCWQLIEQGVQVIDVRSPQEYAGGHLPNALNVPLDQLAQWLTQHSDKQTPFVLYCGAGIRAQKG
    CDILRANGFSCAINGGALKDLLCYQPQSVANG

    >gi|127514569|ref|YP_001095766.1| redoxin domain-containing protein [Shewanella loihica PV-4]
    MRLNKAQIGPPKFTVNHKDFSMIAQGQPLPAATLGQLTENGMVNHDVNELFANKKVVLFAVPGAFTPTCSEAHLPGYVVL
    ADQFKAKGVDIIACVSVNDAFVMKAWGEAQNASELMMLADGDASFTKALGLEMDTAGFGGIRSQRYAMVIDNGVVSLLNV
    EAPKSFEVSKAEVVLAAL

    >gi|127514588|ref|YP_001095785.1| glutathione reductase [Shewanella loihica PV-4]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNVGCVPKKVMWYGAQVAEAMHLYAKDYGFDVSVNKFD
    WSKLVESREAYIERIHGAYDRGLDSNGVTLVRGYGQFVDNNTIEVNGEHYSADHILIATGGTPTIPNIPGAEYGIDSDGF
    FALNEQPKRVAVVGAGYIAVELAGVLHALGSETHLFVRKHAPLRSFDPMLSEALMESMATDGPSLHTHSIPESVTKNADG
    SLTLKLENGESYEIDTLIWAIGRRPSTDKIGLENTDVKLNDKGYVVVDAQQNTTAKGIYCVGDIIEGGIELTPVAVKAGR
    LLSEHLFNGMTDAKMDYSLVPTVVFSHPAIGTMGLTEPEAIAQYGEENVKVYNSGFTSMYTAVTAHRQACKMKLVCAGKE
    EKVVGIHGIGYGMDEILQGFGVAIKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|127514639|ref|YP_001095836.1| rhodanese domain-containing protein [Shewanella loihica PV-4]
    MSAFQHLSVNQLIHMLEDNTEVQVVDIRDGASFEAGQIPGSTNLNNENLARYIAEADMDSPLVVVCYHGISSQNAAQYLH
    EQGFDDVYSLDGGFQAWREAH

    >gi|127514733|ref|YP_001095930.1| rhodanese domain-containing protein [Shewanella loihica PV-4]
    MLQSAGTIGYTLSPNSLSSHRSRPKTMQEYIEFFKANPMLSLAWVGLFAALIVSVFKSSISKVKTVDHQQATLLINKQDA
    KVVDVRSKEEFKKGHIVDAINMPLAEIKNNKTSALEKFKASPIIMV
    CNAGMTSSQAAQLMVKAGFETVYNLKGGMSEWQQ
    NNLPVAKTKR

    >gi|127514746|ref|YP_001095943.1| copper-translocating P-type ATPase [Shewanella loihica PV-4]
    MDTNRVQLNIIGAGCASCVGKIEKALNSVPGVDSAEMNFAERIVEVSGTATPQQLIAAVEAAGYNATQLQAEAGNDAMDE
    KEQADLDYYRSLLRHTFIALSVGIPLMIYGLFIGEMTVTTTNEQLAWGLVGLVTLSIMLLSGKHFYVGAWKSFVHHNANM
    DTLIALGTGTAWLYSMLVVAFPTLLPEMARHVYFEATAMIIGLINLGLALEVKARGKTSEAIKRLIGLQAKTARVIRDGK
    ELDIDIAQVLQGDKVRVRPGEKIPVDGVVIEGATMVDESMLTGEPMPVEKAIDSEVVTGTLNKSGSIVFSATRVGKDTAL
    ARIIAMVKRAQNSKPPIGRLADVIASYFVPAIMIIAIVSAMVWFNFGPEPSMVFAIVSATTVLIIACPCALGLATPMSVM
    VGVGKAAESGVLIRNGEALQTASKISVMVLDKTGTITQGSPQVTDVVVTQVSSCGEDEVLALAAGIERHSEHPLAEAIVE
    TANSRGIQMEAVEDFNAISGRGVEAKLNGQTLLFGNQALMQDFGVDTQAYQAKAQQLAAEAKTPMYLAQENELIAIIAVA
    DPIKPDSAEAIARLKHSGIKVVMLTGDNQATAAAVAAKVGIETFFAEVMPQDKASKVAELQQEGEVVGMTGDGINDAPAL
    ALANVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLRNIKQNLFGAFVYNAAGIPIAAGILYPMFGLLLNPVI
    AGAAMAFSSLTVVSNANRLRLFKAKAH

    >gi|127514768|ref|YP_001095965.1| DsrE family protein [Shewanella loihica PV-4]
    MQQVLIVVNDAPYGSEKLFNALRLAIQLNEQIPTPKVKLFLLSDAVTGVLPRQQPGEGYNLQQMLEIILAQGAEVKYCTS
    CVQARGLNDLSAIEGCVKATMDDLALWLLQSDKVINF