Bacillus cereus Q1 uid58529

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222094031|ref|YP_002528084.1| protein disulfide isomerase (S-S rearrangase) [Bacillus cereus Q1]
    MKIEVWSDFVCLFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKNQGKEKEMTENLLFAYFTESKNLSDVDTLASIAEASGLDKQEALQVINDKS
    AYANDVRVDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPVPKLQELSSEGGSDMSCTDESCSVPS
    KEQ

    >gi|222094108|ref|YP_002528165.1| bacterioferritin comigratory protein [Bacillus cereus Q1]
    MPNNKNKEVENTLIEQDGDTFSVLSTFKEKLLTFKGKNIILYFYPRNFTSGCTKLACNFRDYSSEFVDLDTIIIGISPDS
    ALSHQEFIQSYKLPYILIEDESMKIADMYGAVVEADDRKKIIRKTIFINRDGEIVQEWIYDDVDGHVEEILHLIKNYK

    >gi|222094121|ref|YP_002528178.1| probable alkyl hydroperoxide reductase, subunit F [Bacillus cereus Q1]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|222094122|ref|YP_002528179.1| probable alkyl hydroperoxide reductase (peroxiredoxin) [Bacillus cereus Q1]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITSNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|222094181|ref|YP_002528238.1| thioredoxin [Bacillus cereus Q1]
    MKNFETIEELVTYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNG
    KEILRESRFISLENLERTIQLFEE

    >gi|222094271|ref|YP_002528328.1| bacterioferritin comigratory protein [Bacillus cereus Q1]
    MITVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGLFQEKDTIILGVSPDSANRHLKFI
    EKHELPFVLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|222094295|ref|YP_002528354.1| probable thiol-disulfide oxidoreductase (disulfide bond formation protein D) (disulfideoxidoreductase D) [Bacillus cereus Q1]
    MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLK
    EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQ
    FKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK

    >gi|222094347|ref|YP_002528406.1| heavy metal-transporting ATPase [Bacillus cereus Q1]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETEQNKENEVVTEAKQLVTKLEPHIKVQEEKS
    TKVAKEVFILEGLD
    CANCAMKIENKVKEMPTVSTATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVLREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALASLPQMITIPLFVLAYVLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVVEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYAAFAEVYSNHPIAQSIRNAYGKSVDEKMIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKSVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVNIAKRTRRIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|222094398|ref|YP_002528457.1| OsmC-like protein [Bacillus cereus Q1]
    MKLTIKQDDIEADLSYGQLAIGKENGYSPLQLLVSSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSDALSKPVESVHL
    HYKIKAQNITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|222094486|ref|YP_002528546.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus Q1]
    MLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYAESDVENNLPKAVAAKKRLEEINSEVRVEALVQDVT
    AEELEELVTNVDVMIDATDNFETRFIVNDMAQKYSIPWIYGACVGSYGLSYTILPSKTPCLSCLLQSIPLGGAT
    CDTAGI
    ISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNCPSCGENALYPYLNKENTSKTAVLCGR
    NTVQIRPPHKEEIDFERYKELLHDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVLVHGTKDISEAKTVYHRYFG

    >gi|222094511|ref|YP_002528571.1| thioredoxin [Bacillus cereus Q1]
    MKKMLIFGGIIIVLFAAIFAVTQMEKKSASTDEKGYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPTVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKEKFKEWFEQTKK

    >gi|222094523|ref|YP_002528583.1| NADH dehydrogenase [Bacillus cereus Q1]
    MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVQINKEEKTITIKNVTTNETYSEEYDILILSPGAKPIVPSIPGIEEAKALFTLRNVPDTDRIKAYVDEQKPRHATVIG
    GGFIGVEMVENLRERGIDVTLVEMANQVMPPIDYEMAAYVHEHLQKHDVELVFEDGVDALEENGTVVRLKSGSIIETDMI
    ILAIGVQSESSLAKDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGNT
    DSVYKGTLGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKRMDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQWHEIDRIVENGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLDEVPVDKEIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERIVY

    >gi|222094525|ref|YP_002528585.1| rhodanese domain protein [Bacillus cereus Q1]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEIKATDKGSTVDIQSWANKVGHQYIGTKQEGDVLMHYIRKAHEH
    EVNEVAKYPHTITNTELEEILLSDEECIVLDVREAAEFAFGHIPSAISVPLGELDSAVLDQTKQIYVV
    CRTGNRSDVACH
    MLKEKGYENVKNVIPGMLEWQGNIKN

    >gi|222094526|ref|YP_002528586.1| probable metallo-beta-lactamase family protein [Bacillus cereus Q1]
    MSVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPVKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAVRTVEAYEEFAKE
    HAVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKIEIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYQEIRQTNMGQLNPNEDEEREMEIGPNRCAVHN

    >gi|222094529|ref|YP_002528589.1| rhodanese-like domain protein [Bacillus cereus Q1]
    MDVKTILNIILIVLVSWFIISRFLPARGVKNISGKELKRMMGQNNKQFIDVRTAGEYRGNNIKGFRNIPLNELANKAQQL
    DKQKEVIVL
    CQSGMRSKQAAKVLKKLGFQHVINVSGGMNGL

    >gi|222094530|ref|YP_002528590.1| rhodanese-like domain protein (thiosulfate sulfurtransferase) [Bacillus cereus Q1]
    MKEMTAKELEEKLLRKEAVNIVDVREVEEVAAGKIPEACNIPLGLLEFRMHELDKKKEYIIVCRSGGRSARAVQFLESYG
    FQVINMVGGMLAWEGKVE

    >gi|222094917|ref|YP_002528977.1| transcriptional regulator Spx [Bacillus cereus Q1]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|222094971|ref|YP_002529031.1| thioredoxin [Bacillus cereus Q1]
    MALHFSKGINIFSKSGVTMKKMILFSLVIISILSGIFFVQKGNKNQELEVSKIQDGNYYQNSISIKQLKADLINNEKHVI
    YFYKEG
    CLYCEQVSPIIVPMAKDKNIPMKVINLGEYPIEEWDNFRIEAVPTIVEYRNGKEKNRIEGAHSETSYKEWFNII
    R

    >gi|222094978|ref|YP_002529038.1| pyridine nucleotide-disulfide oxidoreductase; NADH dehydrogenase [Bacillus cereus Q1]
    MSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKMFRDKYGIDAKVRHEVTKVDTEKKMVYA
    EHTKTKDIFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVEL
    GKKVRMIERNDHIGTIYDADMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLE
    GTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKF
    MNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNK
    MSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|222095203|ref|YP_002529263.1| thiol-disulfide oxidoreductase [Bacillus cereus Q1]
    MKKNRLLFRVIILLILCGAVGFTLYQGYFSKEEKMEIGKEAPNFVVTDLEEKKIELKDFKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQT
    KEQLEEYLKKITP

    >gi|222095301|ref|YP_002529361.1| rhodanese-like domain protein [Bacillus cereus Q1]
    MLVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPITEHGGRHPLPNIEEFADKLSRAG
    IDEHTTVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPVTTEISVAKRKAFKANVQNHMLVTMETVREN
    IYAGADVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|222095449|ref|YP_002529509.1| thioredoxin family protein [Bacillus cereus Q1]
    MKKLIAIILAGALIWAGVNFYNAKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLNDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVHMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFQFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|222095509|ref|YP_002529569.1| peptide methionine sulfoxide reductase [Bacillus cereus Q1]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHTETQKELAEKSKQTLAESGMFKEPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGRADFIKENWQKK

    >gi|222095535|ref|YP_002529595.1| hypothetical protein BCQ_1875 [Bacillus cereus Q1]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEILEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAEK

    >gi|222095569|ref|YP_002529627.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus Q1]
    MTIKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AHDEANIMAVPTVMIGDEIIQGLASKETLQRVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|222095684|ref|YP_002529741.1| methylated-dna--protein-cysteine s-methyltransferase [Bacillus cereus Q1]
    MYQAYYESELGLLEITANDKGITSVIFVDERQEEHKNEMIDQCINELDEYFKGNRKEFAVPLSPEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|222095756|ref|YP_002529813.1| glutathione peroxidase [Bacillus cereus Q1]
    MTIYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|222095768|ref|YP_002529825.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus Q1]
    MQERYSRQVLFSGIGEMGQRKIREKHVLLIGAGALGAANAEALVRMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRRINSEVEIVPVVTDVTMKEMEELTKEVDLILDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQKKSTCP
    SCGNTRTYPSLTFESQVKTEVLCGRNTVQIRPGIKRALNLNEIKKRLQKIVHVQKTPYLLSFLIDEYRFVLFTDGRAFVH
    GTNDVKMAKRLYAKYIG

    >gi|222095905|ref|YP_002529962.1| thioredoxin [Bacillus cereus Q1]
    MKEIKSEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|222096032|ref|YP_002530089.1| dehydrogenase [Bacillus cereus Q1]
    MKKFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALYRGGAAFLTFNELGMNLPGGI
    PSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFSRLMIRLGNLDVRKVQKVSLTTWAENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKDGVFYVDGGWETIITKLRDIANHAGVQFLDKKHVLEIEHYEDKQRIYCFDDEVFEV
    GTVIVTTPPKEACNIIKGVEGTSLHRWSKQSVPVTVAALDIGLRRLPNPTHQFALGLDQPIFFTNQSRAAKLSDDGSITV
    SLIKYHNPVLEMKQTHEDKEQLESTMDLLHPNWKREAVAQQYLPKITVVYDFPHINRVEKPGPNIPEMPGIYVAGDWTGH
    DEILADAAVASGKRAALHILKQLESEGVHHGNGAII

    >gi|222096274|ref|YP_002530331.1| dihydrolipoamide dehydrogenase [Bacillus cereus Q1]
    MSKLVVIGGGPAGYVAAITAAQNGKDVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKANHYGVILNNGSISIDWK
    QMQARKSQIVTQLVQGIQYLMKKNKIKVIQGKANFETDHRVRVIYGDKEDVVDGEQFIIAAGSEPTALPFAPFDGKWILN
    SSHAMSIDYIPKSLLIVGGGVIGCEFASIYSRLGTKVTIVEMAPQLLPGEDEDIAHILRGKLENDGVEIFTGAALKGLNN
    YKKQASFEYEGSIEEVNPEFVLVSVGRKPRVQQLDLEKAGIQYSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLTEKDAREKYGDIQIGEFPFTANGKALIIGEQTGKVKVIVEPKYQE
    IVGISIIGPRATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALLQAVGHAVHA

    >gi|222096328|ref|YP_002530385.1| possible carboxymuconolactone decarboxylase [Bacillus cereus Q1]
    MEHEQHHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGSLTKREKQLIALGISLATQDEYCTVYHTKGCLDQ
    GCSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNHKH

    >gi|222096866|ref|YP_002530923.1| transcriptional regulator Spx [Bacillus cereus Q1]
    MVVLYTTASCGSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY
    QLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|222096964|ref|YP_002531021.1| hypothetical protein BCQ_3304 [Bacillus cereus Q1]
    MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQMTPAGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDHENRYTALLQEVIKRQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTLENTPLFDSPEFKEWY
    KLWQSRLEKQDESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALANPYAYTTDQEEYCVPPAPTNR
    PYRTF
    CGT

    >gi|222097021|ref|YP_002531078.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus Q1]
    MAERYSRQHLFKSIGSRGQEKIRNKHVLIVGVGALGSASAESFVRAGIGKLTIIDRDYVEWSNLQRQQLYSEQDAREKLP
    KAIAAKNRLEKLNSEVQIHAFVMDACVENLEGLLENVDVIIDATDNFDIRFIINDLSQKHNIPWVYGSCVGSYGMSCTII
    PQETPCLHCVLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFAAIRKTFFIFDIWSNQNHFIKLGKIKTDNC
    SSCGLNRIYPYLLYENQTKVAALCGRNTVQIRPVDNRKYNFDDIEKVLKKVGEVNRNPYLLSCQLDEYRIVVFRDGRVFI
    HGTNDISKAKQLYYCVFG

    >gi|222097066|ref|YP_002531123.1| ahpC/TSA family protein [Bacillus cereus Q1]
    MWRKLTIIVVLLCLAGYAAYEQFGKNDQVVQGEQTKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNVKLSDLKGKKAI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAINYTPSEKGGGIEKVSNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRIAKLK

    >gi|222097185|ref|YP_002531242.1| heavy metal-transporting ATPase [Bacillus cereus Q1]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNEATVNFALESATVDFNPDEINVNEMKSAITKLGYKLEVKSDEQDGSTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNEEEILRLVGAAEKNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLLIGTRRLMKKFNIDIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAITR
    LKKMGLDVVMITGDNTQTAQAIAGQVGIEHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAALGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|222097186|ref|YP_002531243.1| copper-ion-binding protein [Bacillus cereus Q1]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSAVTLKDIVAVIEDQGYDVQ

    >gi|222097195|ref|YP_002531252.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus Q1]
    MNSYKNNYIYWTLLTHANWKFHIAATETGLCFIGSQNETFEEVNIWARKKLPQHILIHSPDYLQVYTKEIIEYLENKRET
    FTSPIAAYGTAFQLSVWSTVREIPYGKTYSYTEIADRIQKPTAVRAVASAIAANPILIMIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLALEKLQVEFI

    >gi|222097418|ref|YP_002531475.1| dihydrolipoamide dehydrogenase [Bacillus cereus Q1]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVTIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|222097435|ref|YP_002531492.1| glutaredoxin family protein [Bacillus cereus Q1]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|222097572|ref|YP_002531629.1| Na+/H+ antiporter NhaC [Bacillus cereus Q1]
    MVSKIESVLLTFFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISTLEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYVSKTGMKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITQLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPVVTIIVGFTGFGLSWKKEKAVTLS

    >gi|222097610|ref|YP_002531667.1| dihydrolipoamide dehydrogenase [Bacillus cereus Q1]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGIISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|222097656|ref|YP_002531713.1| possible rhodanese-related sulfurtransferase [Bacillus cereus Q1]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|222097914|ref|YP_002531971.1| organic hydroperoxide resistance protein [Bacillus cereus Q1]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|222097987|ref|YP_002532044.1| thioredoxin [Bacillus cereus Q1]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|222098113|ref|YP_002532170.1| thiol peroxidase [Bacillus cereus Q1]
    MTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVLTISADLPFAQ
    KRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALEAAKAAK

    >gi|222098165|ref|YP_002532222.1| thioredoxin [Bacillus cereus Q1]
    MKSLESMEQFQELKNEENVIFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|222098179|ref|YP_002532236.1| possible NAD(FAD)-utilizing dehydrogenase [Bacillus cereus Q1]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSIKPNR

    >gi|222098197|ref|YP_002532254.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus Q1]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKGVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDYGALRETMLSFDLWNNQQMAFKVNRQKKETCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYTRYIG

    >gi|222098202|ref|YP_002532259.1| rhodanese-like domain protein [Bacillus cereus Q1]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGEIK

    >gi|222098245|ref|YP_002532302.1| hypothetical protein BCQ_4587 [Bacillus cereus Q1]
    MYVTVTEAAYKKIVDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSTMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|222098387|ref|YP_002532445.1| hesB/yadR/yfhF family protein [Bacillus cereus Q1]
    MYNRTRTERMVYFMIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKE
    SAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|222098390|ref|YP_002532448.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus Q1]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLKEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|222098438|ref|YP_002532496.1| thioredoxin [Bacillus cereus Q1]
    MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFE
    NGTLMKKIYAFHSVEYLYTELK

    >gi|222098441|ref|YP_002532499.1| possible arsenate reductase [Bacillus cereus Q1]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|222098578|ref|YP_002532636.1| glutaredoxin family protein [Bacillus cereus Q1]
    MKVVLYTKNDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDPLEKYHLMIPVVEIDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|222098610|ref|YP_002532668.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus cereus Q1]
    MTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYAYGDVKEVIDGKEYKTIIA
    GKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSAVEEGVFLTRFASKVTIVHRRD
    TLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIGMLPLSKPFVELGITNENG
    YLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|222098910|ref|YP_002532968.1| peptide methionine sulfoxide reductase [Bacillus cereus Q1]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELARSGRFSKPIATKILPAATFYPAEEYHQGYHKKNEFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLSEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPTEELEKEGYGDFLILFGNK
    K

    >gi|221642289|ref|YP_002533376.1| hypothetical protein BCQ_PI199 [Bacillus cereus Q1]
    MNKVYKIGAIVTTLCVACIAIFTLTKNESVNPETVTPNKTIVSAAETKGSPENIKDISKEELKQKIQSHEEFIAYYYQPT
    CHYCKKAAPDINSMSKKHDRTIYRIDISTPENQSAFQEFDIPGTPVVVAYNRGEEIERLEGAVSAATYDGFFARRNSSAS