Shewanella halifaxensis HAW EB4 uid59007

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|167621985|ref|YP_001672279.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MQEYMEFFKANPMLSVAWVGLFIGLIVITIKTSVSKVKNVDHQEATMMINKQDAKVVDVRGKEEFKKGHIVGAINLPLAD
    IKNNQLKTLENSKASPIIMV
    CNAGMTSSQAAQLMVKHGFENVTNLKGGMGEWQSNNLPVSKSKR

    >gi|167622131|ref|YP_001672425.1| glutathione reductase [Shewanella halifaxensis HAW-EB4]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKELGGTCVNVGCVPKKVMWYGAQVAEAMHLYAKDYGFDVTVNKFD
    WSTLVASREAYIDRIHGSYDRGLESNGVTLVRGYGRFVDSSTIEVNGEHYSADNILIATGGAATIPNIPGAEHGIDSDGF
    FALAEQPKRVAVIGAGYIAVEVAGVLQALGSDTHLFVRKHAPLRNFDPMLSEALMESMATDGPTLHTHSVPESVTKNSDG
    SLTLKIENGESYDIDCLIWAIGRQPSTANIGLENTKVKLDEKGYVITDEQQNTTDTGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSCIPTVVFSHPAIGTMGLTEPEAKAEYGEDNVTVYTSGFTSMYTAVTAHRQACKMKLICAGDN
    QKVVGIHGIGYGMDEILQGFGVAMKMGATKADFDAVVAIHPTGSEEFVTMR

    >gi|167622170|ref|YP_001672464.1| disulphide bond formation protein DsbB [Shewanella halifaxensis HAW-EB4]
    MSLQQRLKEFWGQFKATPADSLTHMQDHRPIWLVMVGGALFLILSAIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIIL
    IDPRNHILKFLGLLLAWYAVIQGWMWSVELMKIHDAAHMVVDETMDFFAAAGDAAGSA
    CSTDPRFPLNLPLDEWLPFEFA
    PTGGCGEDDWTLLGMNMAHYCIIAYTVFMVCLAPLTFGWVRSLKKLLPLKK

    >gi|167622171|ref|YP_001672465.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKKTLSAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKIYSINCPFCYKYEKAGIPNDKLMPAGSTLDQYHITS
    KPPFGVEKSTALAIAKEIKGEKTFKQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMSRAEFDTHAQDPKVKQLMTKWD
    KGVEVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK

    >gi|167622175|ref|YP_001672469.1| disulphide bond formation protein DsbB [Shewanella halifaxensis HAW-EB4]
    MSLQQRLKEFWRQFKATPADSLTHMQDHRPIWLVMVGGALFLILSAIFYFQLFLAMDPCELCVYIRFSQCCIVLAGLIIL
    IDPRNHILKFLGLLLAWYAVIQGWMWSVELMKIHDAAHMVVDETMDFFAAAGDAAGSA
    CSTDPRFPLNLPLDEWLPFEFA
    PTGGCGEDDWTLLGMNMAHYCIIAYTVFMVCLAPLTFGWVRSLKKLLPLKK

    >gi|167622176|ref|YP_001672470.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKKTLTAIAATLFLSFGAHAATEGVEYQVLPEVAQFNAPNQVVKIYSINCPFCYKYEKAGIPNDKLMPAGSTLDQYHITS
    KPPFGVEKSTALAIAKEIKGEKTFKQLKDKYYDQYHVKKVKFKDADSTIAFTLDTLGMSRAEFDTHAQNPKVKQLMTKWD
    KGVEVAKIQGVPAITVNGKYLINTKSIRSMDMLKELIAELSAK

    >gi|167622305|ref|YP_001672599.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MLNTQISKLSTKPASSQCWQLIEEGATVIDVRSPQEFASGHLPQAINVPLDNLNKLDTWLHKVENRQQVFVLYCGAGIRA
    QKG
    CDILTANGLECVINGGALKDLLGCQPKR

    >gi|167622418|ref|YP_001672712.1| dihydrolipoamide dehydrogenase [Shewanella halifaxensis HAW-EB4]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIVERFSTLGGVCLNVGCIPSKALLHVSKVIEEAKAVADHGVVFGEPK
    IDLDKLRGFKEKVIGQLTSGLGGMSKMRKVDVVNGLGKFTGPNTLEVQGEDGVKVVHFEQAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVYTKKIKKKFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPVRYDAVLVAIGRIPNGKGLDAEKAGVKIDERGFINVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKDQGVAYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKKK

    >gi|167622431|ref|YP_001672725.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKKRLVSLFLTFAMIACSEPSKLDVDGNLVEGFVEGVHYRTLATPIPASNDDISVTEFFWYGCPHCQLFEKPLHDWEKTM
    ADGVTLVQSPAVWSEAMKLHAKVFFIVQQMENMQQVHAALFEEIVGLREVRDLNEQQAKLGVFLSGYGLTQQKFNEKLNS
    ADIISKLKQAIQLMSSAEINGTPTILVNGRYIVLNDSASSAKQVMDIASYLVELEKARLANP

    >gi|167622440|ref|YP_001672734.1| putative inner membrane protein [Shewanella halifaxensis HAW-EB4]
    MWLTFKNQFFIKFWSPFAAVIAAGILSTYFFGLTGSLWAVTGEFTRWGGHILQWFGAEPESWQYFKIIGLQGTPLDRVGG
    VMIIGMFGGCLAAVLWANNMKLRMPSSKKRIAQALIGGMIAGFGARLAMG
    CNLAAFFTGIPQFTLHAWIFAFAAAAGTYI
    GAKITLLPFFRSTATVKLGGLKKIAKPNPNQVQNRFRLGWVVFAAMIVGSLYIMQSSTKLGIAMLMGIIFGLLIERAQIC
    FTSAFRDMWITGRTHMAKAIILGMAVSVIGIYSYVQLGMTPKTLWAGPNAVIGGLLFGIGIVIAGG
    CETGWMYRALEGQV
    HFWWVGLGNIIGATILAYYWDDIAAPLATDWDKINLLDLFGPLGGLGVTYLLLGLSFVLILVWEQRFFKKQNSLKEAALA
    NVAHQAEAASVKG

    >gi|167622488|ref|YP_001672782.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MNKTHLLSCLLVFSSLLIPAQAQVASNKVYSTGKAIEKPLIMSRFIEMQSARSVPEVMFTDTKGEQISLKQYKGKLVLVN
    LWATW
    CAPCIKEIPQMENIRQVNKNNNLVVVPISIDEESDKVQAFLERHELGHYQTWLDPQKTIDQIMPADVVPATYVFD
    GSGNLIGFLRGYLDWGDKEVQPYLEKLTAKYAHR

    >gi|167622492|ref|YP_001672786.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MNRVLGSVVFTVLLSMLSAGSYAGGGQEMAPAKYYDEPLNTITMVEAETLVGKEGVYFFDVNTLELWAEGFIPGAVYFNV
    KNWKDLLPKNKDAQLVLY
    CANRLCNASEIAARHVMKLGYTNVRQMPDGIYGWRLSNRVTEKP

    >gi|167622508|ref|YP_001672802.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MHCTAIIAEAIERKIMKKALGQILVTFTLLASSASCLAGGGSDMAPAPRYEHQLHTISMMEAESLIGKEGVYFFDVNTLE
    LWAEGYIPGAIYFNVKDWKKLLPANKDALMVFYCANRL
    CNASEVAAHHTMKMGYTNVRQMPDGIYGWRLSNRVTERP

    >gi|167622528|ref|YP_001672822.1| redoxin domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MTKTFKKDNNLVGIARLYVQSRLHQLKKWMPMKTLKLVLASLLMLTITGCATTESQPEYHTYVKVGDNVPVTQFVDTQGN
    SIDLAESKNHKLLILFATW
    CPDSQRAMKYLVKSDLHLSPNVDIIGIGREETNIELNKFGAEYELNFPLVADTDRQIYSQF
    ANAGIPRLILLDADNKVVKTIIGETENPIIEVVW

    >gi|167622610|ref|YP_001672904.1| thiol:disulfide interchange protein precursor [Shewanella halifaxensis HAW-EB4]
    MKRIINLFLASLLLLTPLAHADGIFSSNKFDFLKGEPELMPVDQAFVFDFKQQGDKVKISWVIADGYYMYRDKLKFEAAD
    GAVLGEIALPQGKPHTDEYFGEQEVYYSYVEMPVAIKEASAGSKLYVTFMGCAEGTLCYPPTKKTAELTEVIANDGLLSD
    TDKALDASDATANESAKAPITQQDTLSAMLSGDSLIWTLVIFFGLGVGLALTPCVFPMYPILSGIIVGQGKKLSTAKAFS
    LSMVYVQGMAITYSLVGLIVASAGMKYQAALQHPAVLIVLAILFFVLSLSMFGLYDLKLPSKWQEKMNSFSNNQKGGNVI
    GVFVMGIISGLVASPCTTAPLSGALIYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGRWMDIIKTFFGFL
    LIAVSIVMLGRIWPGFISDLLWSIWGITLVGYLMHQNKLTEFNWKQTTRSVLLMLTLLASFSYGMQAVMAKLGFSSHTAA
    IAGSEAQSHGFKRIKSLDDLNTEVAAASAEGKTVMLDLYADW
    CVACKEFEAITFKDPQVLERMNKMVILQADVTKNDDVD
    IELLEHYDVLGLPTLLMFDENGAIRDDLRVTGFMRPKAFAEHLDHLVN

    >gi|167622739|ref|YP_001673033.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MHQSIINSTIKPFSATAFHNGDFHPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQSMGVEVYSVSTDTHFT
    HKAWHSSSDTIGKIQYPMIGDPTGTITRNFGVMIEEDGLALRGTFVINPEGEIKVAEVHDLGIGRSAAELVRKIQAAQYV
    ATHDGEVCPAAWQPGEATLAPSIDLVGKI

    >gi|167622740|ref|YP_001673034.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MLDANVKNQLSTYLQNLKHPVELVVSIDDSKKAQELKSLAADIDSLSPLISVIDQVGERTPSMSVINPQLNSQITFAGLP
    MGHEFTSLVLALLHSGGHPIKLDSDVIEQIRQLPGEYRFETYVSLS
    CQTCPEVVQALNMMAAINPNITNVMIDGSLFQDE
    VNERNIMAVPSVYLNGEPFSMGAISTVEILNKLDVNAAGRKAEQLNEKEAFDVLVVGGGPAGASAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELALESGAVLRSKTILLATGARW
    REMNVPGEQEYRGSGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDKTLRADEVLQRKAKSMGNI
    DIITEAMTTEVTGDGKRVNGLNYTDRATGESHHVDLAGIFVQIGLVPNSEWLKDTIDMTARGEIVVDAKGETSLPGVFAA
    GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHDVDESSRDNVAA

    >gi|167622743|ref|YP_001673037.1| hypothetical protein Shal_0803 [Shewanella halifaxensis HAW-EB4]
    MPKSIILFIALLLSCLSLPSFAATEATATNNIWHYTNAQGELKVKLYFFWSKTCPHCAEAHPFIDSLPERYPWIEVEDHM
    ITAANTMEVWQNVAKQTGTEARSVPYFASGEKAVVGYSSQAVTGEFLVQRLKSYYVSLGGVLAPEVEGDYATAAPVSGGL
    FETCSESSSKSGEGICDLGLDTSSKLASSDVQPVELPLVGVVHPEQMSLPLLTVVLAGVDAFNPCAFFVLLFLLSIMVNA
    KSRTRMLIVGGIFVFFSGFIYFIFMSAWLNIFQLLGAGSDGGWIILGAGMLALVAGAVNIKDYFFTKGEVTLSMSAKNRT
    GLIKRMGKLTSASSMTAMIAGTVVLSILANAYELLCTAGFPMIYTSVLSMHDLETFERYMYLVMYNVVYVIPLAAIVIAF
    SVSLGKRKLTEKEGQTLKLMSGIMMMGLGGMLAVDPTALQNVALAIGLILSSIVLTVIITLIRKSIEKAQAAKS

    >gi|167622801|ref|YP_001673095.1| thiol:disulfide interchange protein DsbC [Shewanella halifaxensis HAW-EB4]
    MKFTRTFSLIAAMMIAPAAFAASSSTGDDTEALKQKLSDALSVEVISIKPSPISELYEAFTDRGVLYITKDGSKLFHGNL
    YDLDKGMKNLTEAAMSGPRVDMMKPLEDSMLVYKAKNEKHVVTIFTDVS
    CGYCRKLHNEMQEYNDLGITVRYLAFPRAGV
    PSANADEMESVWCAADPLKAMGAAKNGKAVKQASCDAKIKEQYELGQAFGINGTPAIILEDGTLIPGYQPPKALLRTLES
    VQ

    >gi|167622970|ref|YP_001673264.1| iron-sulfur cluster insertion protein ErpA [Shewanella halifaxensis HAW-EB4]
    MTEQAEDALPIRFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKINEGDYTVEKQGVQLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|167623187|ref|YP_001673481.1| OsmC family protein [Shewanella halifaxensis HAW-EB4]
    MTFNINLSWRASEEPIADPQSFCRDHQISFGSGQQIQASSAPEYSGNAANVNPEESLLAALSACHMLTFLTIAHLKRLSI
    ISYQDNAYAELGKNEAGKIFVSKIILRPEIEFATEVEQEVLTKIHEKSHSN
    CFIANSLSPETQFEIKY

    >gi|167623221|ref|YP_001673515.1| alkylhydroperoxidase [Shewanella halifaxensis HAW-EB4]
    MSRILPVSNPQGDVATTLSAIKSKLGMVPNLYATVGHSPTVLNAYLTFSDALSKGRLSTKQRELIALAIAQVNQCQYCLS
    AHSLIAGSTGLGEKNIKEAREGKADNALDQALITLAVDLVEQRGELTTEQLDIANKNGVDSELIFEVLALVTANIFTNYA
    NHLAQTDIDFPLVSLTV

    >gi|167623473|ref|YP_001673767.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella halifaxensis HAW-EB4]
    MNKPLLPLAKLNFKSEFGALSVCANAEGITHVNFIPQQGDEWLSREVDTNQALMGAGACAENGGCDSYHLAKQHLLQAQL
    ELTEYFDGARRQFEVKLAPKGTEFQCQVWHALSELEYGESCSYADIASRINRPKAVRAVGTANGANPIAIIVP
    CHRVIGK
    NGTLTGYAYGIDLKQKLLKLEGLNSKG

    >gi|167623490|ref|YP_001673784.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MKHNPAFLALVESILPQITEVTVEQYQSMAGWDLLDVREDSEWQQGRLPNSQHLGRGIIERDIETRFPDKQSPLVLYCGG
    GYRSALAANNLQVMGYSKVVSLAGGYKAWLERKLPIEHD

    >gi|167623505|ref|YP_001673799.1| iron-sulfur cluster assembly protein IscA [Shewanella halifaxensis HAW-EB4]
    MAISITPAAADRVRSFLASRGKGLGLRLGLKTSGCSGMAYVLEFVDDLNDDDEIYDVDGVKIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|167623578|ref|YP_001673872.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella halifaxensis HAW-EB4]
    MSTQTISTKDILTGPIFTNNPVAMQVLGVCSALAVSNSMQTALVMTLAVTFVLVFSNLIISSIRSLIPNSVRIIAQMTVI
    ASLVIVVDMVLQDVAYELSRQLSVFVGLIITN
    CIIMGRAEAFAMKNPPHLAVVDAVGNAMGYGVILLGVAFVRELLGSGT
    LFGHEILKTVENGGWYLANEMFKLPPSAFFLIGLMIWSINVIQRKRG

    >gi|167623579|ref|YP_001673873.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella halifaxensis HAW-EB4]
    MEHYINLFIQAAFIDNMALTFFMGMCTFLAVSKKVSTSFGLGIAVIVVMTIAVPINQLIYANVLAPGALAWAGYPALDLS
    YLQLITFIGVIAALVQILEMFLDKYIPALYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYTFAESTVFALGSGFGWAMAIVM
    LAGLRERMKFHAIPEGLQGIGIVFITTGLMALGFMAFSGISI

    >gi|167623597|ref|YP_001673891.1| glutaredoxin [Shewanella halifaxensis HAW-EB4]
    MFIIRWVLGRIILFLNFVFAPKKLKRPQEEQQRIDSTTSNMTIYEYKACPFCVKVRRSLRRQGLNIITLDAKQEPHKSTL
    LNGGGKLQVPCMKIEENGQSTWMYESSEIINFLDKKFA

    >gi|167623614|ref|YP_001673908.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MSVLVGRPAPDFTAAAVLGNGEIIDTFNLSEAIKGKTAVVFFYPLDFTFVCPSELIAFDHRMDEFKKRGVEVIGVSIDSQ
    FTHNAWRNTPVDKGGIGQVQYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGQVRHQVVNDLPLGRNVDEMIRMVD
    ALHFHEEHGDVCPAGWEKGDKGMDASPEGVASYLTDNANNL

    >gi|167623626|ref|YP_001673920.1| glutaredoxin 1 [Shewanella halifaxensis HAW-EB4]
    MFVVIFGRPGCPYCVRAVQVAEQLTEKRDDFKFKYVDIHAEGISKADLEKTVGKPVETVPQIFVDQEHVGGCTEFEQYVR
    DNELMPAA

    >gi|167623659|ref|YP_001673953.1| glutathione S-transferase domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MGLAPRNCTSNMLLPTLYSFRRCPYAMRARLGILLSGQKVSLKEIILKHKPEPMLAASPKGTVPVLILQDGTVIEESLEI
    MCWALTNNDPQNLLLSHNPQQQEFAQALIHTNDHSFKPWLDKYKYADRYPEHSEQYYRQQGEQYIAQLESILSKQPQLMG
    HQASIADYAIFPFIRQFASVDKIWFAHSDYLNVQRWLKAHVESDDFSAIMKKYPTWLESGDSFEFGLMSN

    >gi|167623695|ref|YP_001673989.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella halifaxensis HAW-EB4]
    MRLDRDVYMRKLTELEKHVIEQKGTERPFSGEYYQHDAPGVYCCKKCDAPLYRSESKFNAHCGWPAFDDEIEGAVKRNID
    ADGMRVEIVCAQCDAHLGHVFEGEMLTAKNIRH
    CVNSVSMAFKSADELIDKSSGTELATFGGGCFWCIEAVFSAIKGVSK
    VTSGYAGGTADDANYKAVCSGQTGHAEVVQIEFDPKEVSFERLLEVFWQSHDPTSLNRQGNDVGPQYRSVIFIHDESQAQ
    VANNMIEDLTRVAAWPNPIVTQVVAYNGFFAAENYHNDYFELNGEQPYCQMVIKPKVDKVKALFADRLKK

    >gi|167623770|ref|YP_001674064.1| disulphide bond formation protein DsbB [Shewanella halifaxensis HAW-EB4]
    METQSLNALTRFAHSKAAWLILMLSAVALELAALFFQHVMKLDPCVMCIYQRVAVFGLIFAGLIGVVGYRYRIARAVGVI
    IWSVSAAWGLKLALELVDMQMNPSPFAT
    CSYLPEFPTWLQLHEWLPSLFMPTGMCSDIPWEFMGVTMGQWMIVAFGGYLL
    ALAIFFIPALRKSA

    >gi|167623832|ref|YP_001674126.1| UBA/THIF-type NAD/FAD binding protein [Shewanella halifaxensis HAW-EB4]
    MFKGAINRSSDEISLSLSDSDFLHYSRQVLLPEVGEAGQILLANAHVAVIGIGGLGNVAAQYLAAAGVGHITLVDGDDVE
    VSNLPRQLLFTVSDIGGNKAQVAQKKLSHAYTQVKLAAVTDYLTKDNIQQALSIQALGIQEMGIEAGQYDLLLDCSDNFE
    TRQLVNRFAISNQLPLVSASAAHFQGQLLNIDQRHSPQSGCYHCLFPADMQVGQS
    CQTVGVLGPMVGTLASMQALMALQQ
    LLGHRDTVGKLFRFDGKQFSWREARLPRSKDCLVCRADSNNNNGNGNDCEPEYRS

    >gi|167623856|ref|YP_001674150.1| SoxR-reducing system protein RsxE [Shewanella halifaxensis HAW-EB4]
    MSDYKELAKQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVRDFVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNNVTKSAFDGLMMGLGFTLVLSILGATREILGQGTLFYG
    AEQLLGEWAKSLTIQLWQVDTNFLLAMLPPGAFIGMGLLIALKNVIDQHLASKQPKTEQEAPTRARITKVN

    >gi|167623861|ref|YP_001674155.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella halifaxensis HAW-EB4]
    MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLGYLRTMSFILV
    IAVVVQFTEMLVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNINEKHGFIESAIFGFGAAVGFSLVLVLFSAMRERLAA
    ADVPTPFKGGAIAMVTAGLMSLAFMGFTGLVK

    >gi|167623950|ref|YP_001674244.1| thioredoxin reductase [Shewanella halifaxensis HAW-EB4]
    MTQARHCELLILGSGPAGYTAAVYAARANLKPVLITGIQQGGQLTTTTEVENWPGDAEDLTGPALMERMQKHAEKFETEI
    IFDHINEVNLNVRPFKLKGDNGEFTCDSLIISTGASAMYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILTKRLMDKVESGNIILHLDNTLDEVVGDQMGVTGLKMKSTKDDSITDLEVAGVF
    VAIGHKPNTEMFEGQLEMNNGYIKVQSGLDGNATQTSIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERFLDAKN

    >gi|167624079|ref|YP_001674373.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MNKVVNLTLLCALLGLSAHANAYDAKLANSYHEQFSQATGKTVGKDIGLISAEGFVKQLQQKSDVMAIDIRTPEERQVFG
    LAVKDQLNISLNELFSPENLAKIPTDKPVVIV
    CKSGARAMAAGTALRQLGYGNVKVLKGGFNKLSSYVGPNIAK

    >gi|167624126|ref|YP_001674420.1| heavy metal translocating P-type ATPase [Shewanella halifaxensis HAW-EB4]
    MSQASCFHCSEPVLTGKQFITSINDVEQLMCCPGCQAVSQAIIDAGLTNYYKFRTEPGSKQTALVPEELSNFSAYDLPEV
    QQDFIQQRDSLNEVSLTVDGIT
    CAACAWLIEHKINKLDGVAKVQVNSTTQRALISWDSDKIKLSKILNQISQIGYQAAPF
    QVDEQETKSKKDSRKFLLRLGLAGFATMQVMMFALALYSGYFSDLETEYRDYFRWVSMLFAAPVVFYSAQPFYFSAVRSM
    LMGRLNMDVSVSIAICGAYIASCIETINGTGEVYFESVSMFTFFLLLGRFFEQNARQKASVSSSNLHKLVPLTAQLKTED
    GFDEVPAKRLVIGDIILVKPGDVIAADGVVIEGESAVNEAMLTGEQMPLQKTQTSEVFAGTINIEQPILIRVTALGQDQL
    VAEIIRLQEIASNNKPKVALYADRFSNYFTAAILLIATLTYLFWYFYSPEDAFWVTLSVLVATCPCALALATPTAVTCGT
    AIMTRLGIITRRSGIFEKLPKIQHVVFDKTGTLTLGTLSISNIELTCELSKSQALAYIAALESGSLHPIAKAFAPYIDNS
    MTVTQRQSVVGNGLSGVIHGQQCKVGSQQFVNNTDMVESSTTVWLSCEGVVQAKVTLDDEVRPETAKAVSQLKQMGCKLS
    IASGDNSTEVAALGKRLGIDDVHKGLSPKGKLALIDKFQQQGQVAMFGDGINDAPVLAGANLSIAMGSGAAISKNSADII
    LLGDNLARFADAVKVAKLTGRIIKQNLFWALGYNLFIIPLAVTGHVAPYIAALGMSASSLIVVSNSLRLLKVRL

    >gi|167624160|ref|YP_001674454.1| peptide methionine sulfoxide reductase [Shewanella halifaxensis HAW-EB4]
    MAVATFGAGCFWGVEYFFREVEGVIDCTCGYMGGKDHYTRYQEVKTGTTGHAEVVQVEYDPNIVSFDDLLNVFWQNHNPT
    SLNQQGGDIGNQYRSTIFYHDKLQKQQAEDSKLALIKSQKWGARQVVTEIVPCQQFHQAEEYHQDYLAKNDLPSCHISY

    >gi|167624233|ref|YP_001674527.1| arsenate reductase and related [Shewanella halifaxensis HAW-EB4]
    MTQCKQLIKTDWSTLLTLFGIKNCDTVRKARKWLEANQLEVAFHDFREDGLSTEQIEQWVSAIGWEALFNKRSTSYRNLT
    ETEKNDINEKKAVALMALYPTLIKRPVLAMNGQVQVGFKEADYRTWFNL

    >gi|167624247|ref|YP_001674541.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MDKNMKTLTVGDIAPLFTLQNQKDETVSLTEALKTGPVLVYFYPKASTPGCTVQACGLRDSKEELNSLCVTVFGVSPDPV
    AKLARFSDKQSLNFSLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRLSFLIGQDGKVAHVFNKFKTKDHHEVILAHLKSR


    >gi|167624253|ref|YP_001674547.1| arsenate reductase [Shewanella halifaxensis HAW-EB4]
    MPKVSIYHNSRCSKSRQTLALLEDNNCEVKIIEYLKTPLTVSEITDILTKLNIPPREMMRVKEPEYKELGLSDPTLTQEQ
    LIQAMINTPKLIERPIVLANDKAVIGRPPENVLTIL

    >gi|167624259|ref|YP_001674553.1| glutaredoxin-like protein [Shewanella halifaxensis HAW-EB4]
    METVEKIKQQIAENPIILYMKGSPKLPSCGFSSQVAQIMINCDEQFAFVDILQHPDIRAELPKYANWPTFPQLWVEGELI
    GGCDILTEMFQKGELQTLIKETGAKYKTEDDQA

    >gi|167624423|ref|YP_001674717.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MLRYKRLPLALLLTPLLLTGCQPQNNAELQKEMASLKQEITQLKKEMSTIGGQVNDIHTIAMRSQKPQYKTLPTQSNYGE
    DGKLPLQGDATAQLAIIEFSDYQ
    CPYCKRFIDQTFTKLKSNYIDTGKVQYLTRDFPLNFHPKAKGAAIAANCSLQQDAYW
    PMRDSLFKNMKQLDDELYQQIASNLSLDMTKFNACLADEQMLNKVQQDVAYGSSLGIRGTPSFVIGRVENGQLISPKLIV
    GAQSYQTFARLLDELLANPKKVTSKQ

    >gi|167624492|ref|YP_001674786.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKPFKQSLGRIFIIFTMLCLPWQSASAAPYQEGVDYVKIAGIPESSTPVVREFFSYNCGHCYRQDPFFEQTAHLLGDDIK
    FDRTPVGAGRTSWILSQEAYYLAQKFNVTKQVHGNIFTRIHEQEGAFTRPEQLRDFFVSQGLNAKEVEAAMNSTDAKLAL
    MNYDTQAQLAEIRGVPSLVVNGKYLVKNPGKTPEDLAKLVRYLSTLEEDNKP

    >gi|167624604|ref|YP_001674898.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MSNAFNLQQKRPKTMLWLLGLSVLLMMFSALAMAADQDPKVTWQKIEAGALVVDVRTPGEFAQGHLPNAINIPYEQINTE
    FANKQIAKDRSVVVY
    CRSGNRSGIANQMLVSEGYTNVYNGGGYQMLMSKQH

    >gi|167624730|ref|YP_001675024.1| glutathione S-transferase domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MSAMSSTAILYSLRNCPYAVRARMAVYVSGRTVLLRELRLDNKPVELLEASPKGTVPVLVLPSGEVIEQSLEIMLWALSR
    RDPANYLIADKSDRQQEMLRLIGLFDKEFKTCLESYRSAKRYHGADLFTRRADCERFLQMLELRLLKHQYLVCDKPSLAD
    LAIIPFIRQFSRIERQWYRQSPYPKVRDWLSGYLQSRMFSKVMAKFPIWSACNDQVIFKDD

    >gi|167624781|ref|YP_001675075.1| copper-translocating P-type ATPase [Shewanella halifaxensis HAW-EB4]
    MANINLYVPKMSCASCVAKIESAFDKVNKDLPDGESHSLSARVNLADKLVLVSGEITAKQAIAIVSSVGYDSELVIDAQT
    AAAQKNDDERKEYRLRLIQAAIGLGLGVPLMVWGLLGGEMMVNNATQQFAWGIVGIITLLVMVLTGRHFFQGMWRAIKAK
    SANMDTLIALGTSAAWSYSMMVVMEPQWFPADTRHVYFEASVMILGLINLGHALELRARGKTSEAVQRLLGLQATTAIRV
    SDTGDEEVEINQLNIGDRLRLRPGDRVALDGEVLSGETFINESMLTGEPVPVHKAQADSISAGTVNGNGSLIYRVTAVAE
    DTKLSKIIELVQQAQISKMPIGRLTDKISAYFVPVVVIIAIASSLIWYLLGPQPALSHALVVLTSVLIIACPCALGLATP
    MSIMVSVGRAAQMGVLVRNGEALQTASKITTVVLDKTGTVTQGSPEVTEILMLDNSISQLDLLEDVASLEQHSEHPLASA
    IITKAKLQSITLKEPDSFTNVQGKGITGVIAGRHYAVGNMSLMQQAGLGGEIEADANVSVDDLSGYQQQVSELASKGQTP
    VFVAKDGVLVAIVSIADPIKADAAQAVQAMKSQGLKVVLLTGDNPLTAQAVAEKVGIESVFAQVLPEQKQQKVLELQQAG
    EVVAMVGDGINDAPALMSADVGIAMGSGTEVAIESADFTLLSSRLMVISDTLALARASMTNIKQNLFGAFIYNCLGIPVA
    AGVLFPFTGVLLSPVVAGAAMALSSLTVVTNANRLRSVKLK

    >gi|167624964|ref|YP_001675258.1| glutathione peroxidase [Shewanella halifaxensis HAW-EB4]
    MTASIYDFSVKDIQGQTVSLADFKDQVILIVNTASECGFTPQYRELEALYQKHQTQDFVVLGFPCNQFGAQEKGDNQTIS
    TFCQLNFGVTFPLFEKIEVNGANTAPLYVYLKHSAKGLLGSERIKWNFTKFLVNKKGLVTQRFAPTTNPMAIEAEILKLL


    >gi|167624988|ref|YP_001675282.1| thiamine biosynthesis protein ThiI [Shewanella halifaxensis HAW-EB4]
    MKFIVKLFPEIMMKSKPVRMRFTKMLETNIRNVLKKVDESAKVQRQWDKIMVMVPDDRPDLVEAFGERLACIPGIAHVLQ
    VNVSTFTSVDDIYQQTLVAYKEQLVGKTFCVRVKRAGKHDFNSIEVERYVGGGLNQFTEAAGVRLKNPDMTVHLEIDNDN
    LYLIDKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKRGSRTHYCFFNLGGDQHEIGVKQVAYHLWQKYGESHKVK
    FISVPFDPVVQEILERIDNGQMGVILKRMMMRAATRVAQKMGIQALVTGEAMGQVSSQTLTNLNVIDRCTEQLILRPLIA
    MDKQDIINLSRQIGTEDFAKSIPEYCGVISQKPTVKAVLSKVEAEEAKFSEDLLDRVIADAEIIDIREIATQMDTKITET
    ETVDSINANEIIIDVRAPEEEEKSPLKIDGVEVKAIPFYKLATQFADLDKDKSYLLY
    CDRGVMSKLQALYLQEQGYTNVK
    VYRP

    >gi|167625095|ref|YP_001675389.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella halifaxensis HAW-EB4]
    MEHYISLLIRSIFIENMALSFFLGMCTFLAVSKKVTTAMGLGIAVVVVLAISVPVNQIIYQGLLAPGALAWAGLPEADLS
    FLKFITFIGVIAALVQILEMVLDKFFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYSLVESMVFGVGSGLGFALAIVL
    LAGIREKLKYADVPDGLRGLGITFVTAGLMALGFMSFSGVSL

    >gi|167625096|ref|YP_001675390.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella halifaxensis HAW-EB4]
    MANAKELKQVLTGPIVSNNPIALQVLGVCSALAVTSKMETALVMTIALTVVCAFSNLFISILRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGIGYGAILLSVGFIRELFGNGSL
    FGVEILSKVSDGGWYQPNGLLLLPPSAFFLIGMLIWIIRTYKPEQVEAKG

    >gi|167625189|ref|YP_001675483.1| alkylhydroperoxidase [Shewanella halifaxensis HAW-EB4]
    MTQSTNQTLSITAALESAEISSGVMNCMLKTEHYVNNCGIEHTLLELIRYRVSLINGCAYCIDMHFKESLAAGETAQRLT
    SLSIWREAPYYTDRERAVLNWAEALTDLPHAGVTHEQTRLVDATRGLKAYFSDKEISELTLVVIQINAWNRLAKTFDFGV
    GSFEVTQSK

    >gi|167625191|ref|YP_001675485.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MSTDSQRPDKSNTSDSRADGANRADSVGKPLPFGRRLIGWVKQLLFMLVVLSVFSAALDIWRSRDLPKTALPNIQATTVQ
    GQAVDLIAMSHEQPVLVYFWGSW
    CPVCNFVSPSVNMIADRYPVITVAMTSGTDEKLLKYLQHKGYDFAVVNDPSGELSQD
    WSMQLTPTLLVIKDGELAYYTSGFTSLPGMWWRMLLA

    >gi|167625192|ref|YP_001675486.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKTRKTGNNLGCKQPIFKSRLQATLFITTIAAFALYCAMLVISQNVKAEDSRVKPMWATAPTMKEMINSNRSALFHRATD
    PWKGAEKPQVTMVYFTDFN
    CPYCKKLEPELDKLMAEYPQLKIIVKMVPLQGQSSVEAVDFAQRVWLNEPAKFLKLKDTLM
    AAPRRLDRQTLAKAAAMTKTSQWLTQAEKSISPAISDNLELMRGLRIGGTPSMVIGEQIIVGLVPFERLKQQVELTLEAR
    DEHG

    >gi|167625193|ref|YP_001675487.1| cytochrome c biogenesis protein transmembrane region [Shewanella halifaxensis HAW-EB4]
    MKIIKQIILVCLIALANPVFAQSTGWLENPNHPPVKARFMLTGELDKATNTMPGVLEVELDGEWKTYWRSPGEGGIAPSI
    DWSGSTNLDNVNWNWPAPEQFSLLGLQTFGYHQQAAFPMLVTLNDASKPASLQGKFTLSSCTNICVLTDYDINLEIDPRE
    LNSDVGAMFSYNKALSKVPQKKISDTLVFGWDAKAKQLQVEMDDTGWIMPKFIVDGEPDTTFKFVIFERFETDTAAKKLR
    AVFDASSWLGEPELLGKPLNLTVIDSNRAVEYTSKVEATTIKSSQTSLLKMLLIALLGGLILNVMPCVLPVLGMKLSAVI
    AAPDLQRRQIRQQFIASALGILVSFWLLAAFIFTLKLTGQAIGWGVQFQNPWFIGFMAIVTSVFALNMLGAFEITLPSNL
    QTKLATTGGNDHRGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSLFVIFTALALGMALPWLVVAAFPQVANYFPKP
    GRWMNVVKVVFSGLLVLTSLWLISLLANFIPTVYLWIAAAILLLLFLMLMAKVQGKAAVIASVSIGIMVLAVAAFSTSNR
    WAQPLPTDLDWRALNESEIARQVAAGKTVFVDVTADW
    CITCKANKVGVILQDPVYSELKTENIVLMEGDWTKPSAPITEY
    LQSHNRFGVPFNVVYGPNAPEGIALPVILSASDVIDAINVASVRF

    >gi|167625237|ref|YP_001675531.1| hypothetical protein Shal_3326 [Shewanella halifaxensis HAW-EB4]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDIPTENIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISDKDRQGILRSIERCTVKKVVQTGPEFKIETVENLDADANAMLMGQDDSDASTYILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNCNFFYNDQFFGEE
    IANSEFVHYPNEKWFELTDDDSLPTGMLDDYCLAIYNPEGELGGSNLIDTNSGNIDRGICTIPYTRHSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAQVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSIEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVISWRF
    FSSKHDYEFCEWDFSGTNQEEADGLFGILETLEKEVYTAEFDQLGASACRMLVPGFSEVYLVDDLIWDNTNKALDYREDI
    LNLHSLSDDELVDLVNRLEESQLDNYTDIRTMIGIVFDENTVWGQLTIIELKILIYLALGAAEEAMELVGDFLQYNDNTV
    ERGLFYQAVNAVLEVEMDDELELEHFIHSFNRMFGEDVMQNVIGSVSGEVRFFGLTKTSMALEGIEPHLRLIESYKKLHS
    ARAKVAAK

    >gi|167625305|ref|YP_001675599.1| thiol:disulfide interchange protein, putative [Shewanella halifaxensis HAW-EB4]
    MGTISVTILIFLIFICIAIASLIVLKIKGRLIPNAVIAVLFCFATCIASVFGFINYGEDYDAYKKLQWQTLTPDQIQPLV
    DNGYTVFIDVTADW
    CNICYANKAGVTHREKIVNALTQKHIILMQGDWSQPNMVVENYLQMQGLNSVPYNRVYGPGAPNGI
    VLPSQLTVEAVMFALEKAKG

    >gi|167625430|ref|YP_001675724.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MIKHIALALTLAVAPLSSFAAQFVEGKHFTVVSNKAPSSEPKLTEFYSFYCGNCFNMEKMYMADIKANLNKQVTFDSKHV
    DFANTDINTEVMRSLAVIQTLDNQKPLTDAMFKVIQGDNGEKHDHSAPGHKHDEPLKSRDDIKAVFAKFGVTAEQYDAAA
    DSKETNEKLALWRTQQREFKVQSVPAFIVNDKYAINMGSIRTLGELIDLMNYLALEHKS

    >gi|167625446|ref|YP_001675740.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MIKQLSKFGFIALLLLPLSALATDLKVGDMAPDFKLQATDGHFYQLSDYKGKQTLVLAWYPMANTYGCTLECKSLVEKGH
    LIREYNAVYMMASVDDLEDNQAFAREQKADFPMLSDPSKETAKAYDVLNFVRVASRVTFYIGTDGKILKIDEDINAKTAA
    EDIAANLAELNIEKENPESTAP

    >gi|167625798|ref|YP_001676092.1| thioredoxin [Shewanella halifaxensis HAW-EB4]
    MSDKIVYLSDDSFENDVINSELPVLVDFWAEWCGPCKMIAPILDDVAEEYEGKITIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKAGELAATKVGALSKTQLKEFIDAQL

    >gi|167625855|ref|YP_001676149.1| flavocytochrome c [Shewanella halifaxensis HAW-EB4]
    MKRREFLTKSMGVTAAMALPFSTTAVASENSWDREYDLIIVGSGFAGLAAAYSANKAGIKNILVLEKMETWGGNSAICGG
    IACMPNTSLQKKHGIEDSPELMIKDMVKAGRGFNHPELCKTLATEAHTVYDMLIGCGVEFMDKIIRLGGHSAPRAHIPAN
    ASGGGIVVPMHKYLLDKGVQFQNRTQVTTLLRDKHNAITGVAVQEKFDFDTEKFKSEQTYKSRHGVIVATGGWGQDKQFV
    KTTMPIYAHLEATAQPGATAGMIKSLLAVGSLPIMIDMYQLGPWASPDERGAGPASFFADYSFSEGIAIDPMTGKRFMNE
    LADRRTRAEAQLVVLEKGTENKPNFPFTFCSEATTQRAEGFKGAYRDGAVNKSNSVAELAKRHGVDEAILAQSIADWNEI
    VEGKPDPFNKPLDRRTELKPPFYSLRLSPKLHYCMGGVAITPNAEVIDATTCEPIKGLFAAGEVAGGTHGMDRLGGCSSV
    DGLVFGQIAGRTAANYKANV

    >gi|167625885|ref|YP_001676179.1| DSBA oxidoreductase [Shewanella halifaxensis HAW-EB4]
    MKKALLVAFALLMAPMAAMAAQYEEGVHYTVINEGPGTAKPEIAEFFSFYCPHCYTFAKEQVPKIKATIPDGVTFKQNHV
    DFIGREMGVEMSRAFAIAHQLKIEEKMEHALFSAIQDKKQHFTNLDDIKALFVVNGVDPKAFDAAAKSFMVNAQMSKMKR
    DTENAKIAGVPALVVNGKYRVETGAIKSYQELLDIAYYLATQK

    >gi|167625888|ref|YP_001676182.1| hypothetical protein Shal_3983 [Shewanella halifaxensis HAW-EB4]
    MRFKQDFFEQLVGYYSQVFPQGISNPHWLAWSEDAAGLIGLTQPTDELLQGMSGNAQIDGASYYAQVYSGHQFGGYSPQL
    GDGRSIILGEALGPQGTWDVALKGAGPTPYSRHGDGRAVMRSAVREFLISEALHHLHIPTTRALAVIGSDVPVWRETQET
    AAITVRLAKSHIRFGHFEFFCHSERGAPTKLKQLLDFTISQHYPDLSCDAAGYKAWFARVVTDTAKMIANWQAIGFAHGV
    MNTDNMSILGDTFDFGPFAFLDTFKEDFICNHSDPEGRYAFGQQPGIGLWNLQRLAQALSSIIASDDLIAALNMYQGELV
    KHYLILMRGKLGLTTSVTEAELDDQDLALIGGFTSLMERNQLDYTNTWRRFGQLDPSSSHSSLRDDFVDRDGFDAWYQLY
    QARLGNVEEVEQWQAARNRANPKYILRNYLAQEAIIGVEEGNLAPLQQLQQVLQNPFDEQLEFDDLAKRPPDWGQGLIMS
    CSS

    >gi|167626003|ref|YP_001676297.1| redoxin domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MRSTIVGLVAATMLVAAGAQAYPGMEKQAESQVQSSVDLISVLPKPFPIEAVPFKDSKGEAVDFSQYKGKVIMVNMWATW
    CPPCVRELPAISRFSAKIGSDDFEVLPVSIDLEGNKQVEPFLKSLGMEGFNTYYDKEQKLGHVFPLDTIPATFILNREGE
    LIAFVRTFVDWDDDKAVTLIKEFLAEPQSSNQVTKNAD

    >gi|167626005|ref|YP_001676299.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella halifaxensis HAW-EB4]
    MKKLVLFIPLVVVLGMGVFLYKGLFLNPQQLDSALEGKPIPAFQLEVLEKSGETVTNETLKGKVGLLNVWATWCPSCKYE
    HPFLMSLARKNILPIYGINYRDERALAIRELSREGNPYAINIYDHDGRLGLDLGVYGAPESFLVDHKGVIRYRYAGPIDR
    NVWKETLYPMVQQLQAEAAKDGAS

    >gi|167626062|ref|YP_001676356.1| selenide, water dikinase [Shewanella halifaxensis HAW-EB4]
    MIGYLPFLGRFKLMTDSEIKLTEYSHGAGCGCKISPKVLGTILATQLPVFDDPNLLVGNQTRDDAAVYKLNETTGIISTT
    DFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPVNKLPAEVAQKVVDGGRQACADAGIMLAGGHSIDSPEP
    IFGLAVTGQIPLDELKQNDTAKAGDKLYLTKPLGIGILTTAQKQKKLADADLNTAAEAMCQLNILGPKIAKIPQVNALTD
    VTGFGLAGHLLEMCHGADLSAKIDISLLPLLPNARHYLEMGCVPGGTHRNFDSYGEHLPTLTDEQKAIICDPQTSGGLLI
    AVANDGEAALKTLLADNDIEPICIGQLVEKNALKTVELI

    >gi|167626096|ref|YP_001676390.1| molybdopterin biosynthesis protein MoeB [Shewanella halifaxensis HAW-EB4]
    MSTEQAATDEILSDAEILRYSRQISIKSMDFEGQEKLKQAKVLIIGAGGLGCAASQYLAVAGAGSMTLVDFDTVEISNLQ
    RQVLHQDANVGQAKVDSAKQSLMALNPHIQIETINAVLDDHEIDALVEQHSIVMDCTDNVAVREQLNQSCFKHKKPLISA
    AAIRMEGMVTVFDYQDKTPCYHCFSKLFGEQQLS
    CVESGILAPVVGMIGCLQAVEAIKMIANMGQSLAGRILMIDAMTME
    FREMKLPKLPSCSVCS

    >gi|167626122|ref|YP_001676416.1| rhodanese domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MSAFQHLSVSELIQMQQTSAELQIVDIRDAASYEAGHIDGAFNLNNENLAHYIGDADMDLPIVVVCYHGNSSQSAAAYLN
    EQGFDDVYSLDGGYSAWHLAHL

    >gi|167626194|ref|YP_001676488.1| DsrE family protein [Shewanella halifaxensis HAW-EB4]
    MQHVLIIANDAPYGSEKLFNALRLAIQLNEQDYSPVRVSLFLLSDAVTAVLPNQKPVEGYNIQQMLEIVIAQKTQVKFCG
    SCMHARGLTELKVIEGCEMATMDDLAQWVLVADKTITF

    >gi|167622043|ref|YP_001672337.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MSNSETQVGLKEIRQKVLAGTQVIQNLIPPTVSYTTEGNVLVIGPEDLARLAADKLSSMGQCAILANEPITSQDEAHLEK
    VMTAAENVESYYNKLIEIKGFLGQFQVKVEHGDGSAELSTVAIRKAHFDLILDLSVSP
    CINLEMLPPGYFYVGQDQAKLD
    EALEQLPSLVGQFDKPRYVKVNSDICAHYRSGNEGCTRCLNFCPADAIASIEKKIEIDPYLCHGAGSCTNACPTGAISYD
    LPTPQAMHTYLQKLVTSFRSQAQIAPVILFHDMGKGAELVTDALAGEIIPIEMEEITVASMDHWMSALAWGARQVLILQT
    DATAPTLTQMLHGELSLANDILDEMGQPQRISLITEAHLTEVGAKALSELLITSASWPVIVPAEFVATTKRETIYNAIDH
    LNEQAASVDSCFSQSNIPYGQVSVNTENCTLCMSCVSTCPTMALTDGGDLPALHFVEQDCVQCGLCETACPEKVISLTPQ
    VNLDKAARQTRQTLHEEAPFECITCGTPFATQSMVKRMLDVVGTHSAFSANTDRLKMCGDCRVKDMFEDILQDPEKQLR

    >gi|167624997|ref|YP_001675291.1| FAD linked oxidase domain-containing protein [Shewanella halifaxensis HAW-EB4]
    MSINYEAILRDLRRQVGEHAATNDPVRRFAWSTDASYFRIVPEIVVHADTLEQAKRTLAIARTYGAPVTFRAAGTSLSGQ
    AIGEGILLILGHDGFRTLIVSEDASKITLGTAVIGADANAALKPLNKKIGPDPATLAAAKIGGIVSNNASGMCCGTAQNS
    YQTIASAKLLFADGTELDTGCEESKAAFTQSHPQLLKQLTELAELTVNNTTLAARIRKKYSIKNTTGYSLNALVDFADPF
    ELINHLIVGAEGTLAFVEEVTYHTVDEARFKASAMAVFFNMEDAARAIPPLVGDSVAAAELLDWASIKAVTGKAGMPEWL
    AQLPEGASILLIESRANDKDTLERYTKDVTAKLAHIETERPIIFSDDPAVFGQYWAMRSALFPIIGGERPKGTSVIIEDV
    AFELEHLAAAANDLTELFHKHNYPEGVIYGHALAGNFHFIITPTFNSQIDIERFHAFMQDVAEMVINKYDGSMKAEHGTG
    RAVAPFVEMEWGSDAYSLMKRIKQIFDPEGLLNPGVILNDDNQIHVKNIKPCPVVDDLIDKCIECGF
    CEKTCPTSALNMS
    PRQRIATLREIERLEQSGGKRAAEQMRAAAKYDVVDTCAACQLCTIACPVDNSMGELVRKLRTPYITSTEQKVLDFQAKH
    FGAVNQVISTGFDVLGTIHKITGSAVTGAIMKAGRVISKEVPYWNPDFPKGGKLPKLAAPIPGQETVVYFPACGGRTFGP
    TPKDPDNRTLPEVVVTLLERSGYNVITPEKTRDLCCGQMWESKGDFKNADAKRKELIEVVAAMTQGGKLPVIIDALSCTY
    RTLAGDKSLSDKVEIVDMVDFIHDKLLDKLTITRKKPAVALHLGCSARKMKVEPKMEAIVDACSNRVVRPAGINCCGYAG
    EKGLYKPEINASALRNIKKLIPVDVSEGYYANRMCEVGLTQHSGISYRHLAYLLEECTR

    >gi|167622898|ref|YP_001673192.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella halifaxensis HAW-EB4]
    MSSMKFTAGARFPDIQLPTLAGESIALGTPAQGSDWRLVIIYRGKHCPLCTRYLNEVEKLAADFLKLGIDIVAASADSLE
    QAQFHKTNLTANFPIAYNLTIENMQQLGLYISHPRSEKETDHPFAEPGLFVINDKGLVQVLDISNGPFARPELATLLSGL
    SFIRDPENNYPIRGTYS

    >gi|167624041|ref|YP_001674335.1| NADH:flavin oxidoreductase/NADH oxidase [Shewanella halifaxensis HAW-EB4]
    MAHFEHLLKPGKIGNLSLKNRMVMAPMGSNFAESNGHCGERIQAFYEERAKGGAALLTMGVGAIAYPSGTAEPYQVGIST
    DEFIPGLKQLTDRVHKHGAKIAIQLQHAGKTAVRDLAEGRDLWVPSMPPATNSDMMKTLTHNELASFIRPKAGGQIKIRV
    MDEDDIKQMVAWFASAALRAKQAGFDGVEIHAAHSYIIAGFLSSYYNKRDDQYGGNLENRARLLLEVIAAVREQVGNDYP
    VWLRLDAAELRTPGGITIEDCIEVAKLVEAAGLNAISISAYATINRGDAFTEAPLVQKPAGFLDWAAMVSKHVSIPVTAV
    GRLEPDVANKAIGSGQIAFVAMARKLLADPQLPNKIINNRAQDIRPCIYCYACVSQIFINQRVKCAVNPRTGHESTLNII
    ATDKAKHVVIVGAGPSGMEAAKVASDRGHRVTLIERASRLGGTLFFASMTYPENGKLLEYQINQLKQSNVDIQLNTEVSV
    ELLSQLQPDEVFLAVGALRTSPNIEGSQLQHVWSGDELRKLMTGEGKDIAKQKLSLSQRAMFNAGSVSGVTSSLDA
    CRQL
    SKLWMPLGKNIAVIGGGLVGLELAEFLALRGRNVTILEATRDLGSELSIVRRWRILQEHNELGVTIINNASVNKIDAKTV
    TFTDKEGKLQLLDSDSVIMAQGATPNSTFEQILVDEGFKVSSIGDSSAVNYIEGAIASGMNAAIKL

    >gi|167625008|ref|YP_001675302.1| OsmC family protein [Shewanella halifaxensis HAW-EB4]
    MAEKIIELKTHMGEGWKVTAQVREHQLIIDQPTAGDEGANPLETFIFSLAGCISTIARMVAREQKIKLNHFDVSIKAQLN
    TLGLLGKATDDPVGFKHIDITVEMDAAVNSEPLTEEQKQVFIDTVCHRCPVHDNLLKPTLVTHQAG