Shewanella frigidimarina NCIMB 400 uid58265

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114561284|ref|YP_748797.1| molybdopterin biosynthesis protein MoeB [Shewanella frigidimarina NCIMB 400]
    MDSLDQEILTDNEMLRYSRQISIKAIDIDGQEKLKLAKVLIIGAGGLGCAASQYLAVAGVGEITLVDFDTVELSNLQRQV
    LHYDANIGQAKVESAKQSLMLLNPLININTINALLDDDEINVLVSQHSLILDCTDNMLVREQLNKSCFEHQVPLVSAAAI
    RMEGTVTVFDYQQDSPCYQCFSALFGEQQLT
    CVEAGILAPVVGMIGCIQATEAIKVITAIGEPLTGKLLMIDAMTMEFRQ
    MRLPKQPHCKVCGVNP

    >gi|114561308|ref|YP_748821.1| selenide, water dikinase [Shewanella frigidimarina NCIMB 400]
    MPHTDIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQTRDDAAVYKLNEQTGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPIMAIAILGWPVNLLPPEVAQQVVDGGRQACADAGIMLAGGHSIDAPEPIFGLAVTGQIPLE
    RVKQNNTAKANDRLYLTKPIGIGILTTAQKQKKLRDEDSQIAPNAMCQLNTIGIDIAKIVGVNALTDVTGFGLAGHLIEV
    CQGAQLKANIVLSQVPLLPKVSDYLAQGCIPGGTHRNFDSYSEHLPPLTDDQKAIICDPQTSGGLLVAVSAEAEQELKTL
    LEANGIDAICIGMLNTYEPHADGHDVLVELS

    >gi|114561371|ref|YP_748884.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella frigidimarina NCIMB 400]
    MKKFVLFIPLVIFLGMGVFLYKGLFLNPKVLDSALEGKPVPAFQLERLEVPSEVLTEKDLPAKVSMLNFWATWCPACKYE
    HPYLMMLSKRNLLPIYGINYRDERALAVKELTTQGDPYTVNIFDKDGRLGLDLGVYGAPETFIVDHNGIIRYRYAGPIDQ
    TVWTQTLYPMIQQLQAEAKVDGAS

    >gi|114561373|ref|YP_748886.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MGTASVANAYPGMQAAAKQTSESTLERINILPQPFPIALVDFTNLVGQSVNFEQYKGKVVVVNLWATWCPPCVRELPALN
    RLNQTLNAEHFALLPISIDAEAVAIVQPFLESLGLGEFNSYFDPQQQLRDVFPLDTIPATFILNEQGELVAYVRSYVDWD
    DTSVATFLEQFRQNAKEVQ

    >gi|114561400|ref|YP_748913.1| copper-translocating P-type ATPase [Shewanella frigidimarina NCIMB 400]
    MNTQTTTQLLIEGAGCASCVGKIEKALKTVAQVEQAEMNFADRSVMVTGEVDVARLLDAVEQAGYHAIVINDQGGADAID
    EKEQADAAYYKSLIKHTVVALAVGIPLMIYGLLIGDMTVTSPMQQLVWGAIGVLTLGIMFVSGKHFYTGAWKSFINHSAN
    MDTLIALGTGTAWVYSMVVVLAPDLLPQMARHVYFEATAMIIGLINLGLALEVKARGKTSAAIKRLIGLQAKTARVIRNG
    KAVDIDIALVQLNDKVSVRPGEKIPVDGVVVEGSSFIDESMLTGEPIPVEKGINDDVVAGTLNKLGSLTFTTTRVGKDTA
    LAHIITMVKRAQNSKPPIGRMADVISGYFVPAMMIIAIISAMVWLNFGPEPSMGYAIVSAMTILIIACPCALGLATPMSV
    MVGVGKAAESGVLIRNGEALQTASTITTMILDKTGTITEGAPKITDIIVVNGREQEHVLQLAASIEQHSEHPLAQAVVQA
    AADKGLALFNVEQFTAIAGFGVQAQYQSTQLLFGNEKLMREKGIALSDYQQQAQALAAEAKTPMYFAIDGELAAVIAVAD
    PIKADSVAAIARLKNSGIKVIMLTGDNHATAAAVAAKVGVDDFFADVLPQDKANKVAELQALGEVVGMTGDGINDAPALA
    LANVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLGNIRQNLVGAFIYNMAGIPLAAGVLFPVFGVLLNPVVA
    GAAMAFSSLTVVTNANRLRFFTPQQH

    >gi|114561403|ref|YP_748916.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MIATGQSLPKATLSQLTKDGMVNHDVTELFAGKKVVLFAVPGAFTPTCSEAHLPGFVVLADEFKAKGVDLIACVSVNDAF
    VMKAWGEAQNASELMMLADGDASFAKALGLEMDTAGFGGVRSQRYAMVIDNGVVTLLNVEEGKSFEVSTAEAVMAAL

    >gi|114561594|ref|YP_749107.1| hypothetical protein Sfri_0407 [Shewanella frigidimarina NCIMB 400]
    MQFKQDFFEQLEGFYSQVYPLPISNPHWLGWSDDAAQLIGLEKPNAELLMQLSANYAAPGASYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGAWDVALKGGGPTPYSRQGDGRAVMRSAVREFLVSEALAALNVPTSRALAVIGSDLPVWRESQET
    AAITVRLAKSHIRFGHFEYFFHSEQGDAAKLTQLVNFTIQQHFPHLSTDAAGYKQWFYEVVQSTAKMIAHWQSVGFAHGV
    MNTDNMSILGDTFDFGPFAFLDTFKEGFICNHSDHEGRYAFGQQPGIGLWNLKRLAQTLTPIIESDDLIAALNTYQFELV
    QQYLLLMRAKLGFSQPNQSPNAINAEEQADLGNKDLQLVGQLTGLLETNQLDYTNSLRRFGQLDPSSAHSSLRDDMVDLA
    GFDTWYQAYQSRVGEVADVNAWQCERNSANPKYILRNYLAQEAIIAIEENGDNSKLLQLQQLLQRPFDEQSEMEDFAKRP
    PQWGQGLIMS
    CSS

    >gi|114561597|ref|YP_749110.1| DSBA oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MKKALLMAAALLLAPMAAMAADYKEGVHYTVINDGPETAKPEITEFFSFYCPHCFNFSKTVVPKIEANLPEGVAFNQSHV
    EFIGRDMGVEMSRAFAVAQQLNVEKKMDAALFTAIHDKRQQFTRPDDIRAIFIANGVDGKAYDAAASSFMVNAQMSKMKR
    DTENAKISGVPTLVVNGKYRVETSSIKSYDELIDIAFYLTSMNKK

    >gi|114561647|ref|YP_749160.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
    MSDKIVYLSDDSFENDVLKSETPVLVDFWAEWCGPCKMIAPILNDVAEEYAGKLTVAKLNVDQNNVSPAKYGVRGIPTLL
    MFKGGELVATKVGALSKTQLKEFIDAKI

    >gi|114561650|ref|YP_749163.1| hypothetical protein Sfri_0463 [Shewanella frigidimarina NCIMB 400]
    MLEYSQVQYFLLNRDIIMHNNVRTLLATTALFFSTQMLPMAASANSGCAFEKDQQGFIATCSEEKQEVILTGVIQPQTLT
    TELPGYTEGFTNYQVDAQAIDVLKAIKEPTQIVVIIGTW
    CPDCHRETPHFMRIIEAAANPNIEVEYIGVDRSKQDPEGLA
    AKYAFSRIPTFIVKQQGKELGRIVERPQATLEADLVEILK

    >gi|114561708|ref|YP_749221.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella frigidimarina NCIMB 400]
    MTQSIINSTIKPFKATAFHNGAFVEVTEQDLLGKWAVVFFYPADFTFVCPTELGDMADHYEKLQAMGVEVYSVSTDTHFT
    HKAWHSSSDTIGKITYPMIGDPTGAITRNFGVMIEEDGLALRGTFVINPEGQVKVAEIHDLGIGRSASELVRKIQAAQYV
    ATHDGEVCPAKWQPGEETLAPSIDLVGKI

    >gi|114561709|ref|YP_749222.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MLDANVKNQLKTYLQNLKRPVELVVSADDSNKGKELTSLAQDIVDSSDLVSVTYQQGKRTPSMSVINPQAATNITFAGLP
    MGHEFTSLVLALLHSGGHPIKLDADIIEQIRQLPGEFHFETYISLS
    CQTCPEVIQALNMMAAINPNITNVMIDGALFQQE
    VSDRNIMSVPSVFLNGEAFSVGAISVVEVLNKLDKNAAGRQAEQLNQKSVFDMLVVGGGPAGAAAAIYSARKGLNTGIVA
    DKFGGQVAETVGIENFISVSKTEGPKLVANLEAHVKDYDVDIMQNQRALSLAKNGLFDVTLESGATLSSKTIILATGARW
    REMNVPGEQEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAKSMGNI
    TIITQAMTTEVKGDGIRVTSLIYTDRATGESNTVTLAGIFVQIGLVPNTEWLKGVVDMTPRGEIIVDERGQTSIPGVFAA
    GDVTNTPFKQIIIAMGSGATASLGAFDYLIRHSEEEDVKAA

    >gi|114561771|ref|YP_749284.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MTKIVIIGGVAGGASAAARARRVSETAEIIILERGEFVSFANCGLPYHISGEIESRDALLLQTPESFKSRFNVDVRVHNE
    VVSIDRQAKQLTVRNLMTYEMYQESYEKLLLSPGASPIKPPISGINNHFVHSLRNIPDMDKILSNLLLHKPKHATVVGGG
    FIGLEMVEALRHLGLDVTLLELADQVMGPVDLEMANMLHQKLVDNGVDLRLKTGLTAVDEYPIQLAEADNTGDYDKPILP
    HYHLQLALSDNNTLATDLVILAIGVKPETSLASECGLVLGPLGGIRVDEGMRTSDADIYAVGDAIETADFVTGNPTLIPL
    AGPANRQGRLAADNMLGGDKKYRATQGTAICKLFDMAIASTGLNEKSLLKQNIPFEKIYVHTASHASYYPGAHPISLKLL
    FCPDSGRILGAQAAGIDGVDKRMDVLAVAQRAGMTVHDLADLELTYAPPFGSARDVVNQAGMVAANVLLGDEAICHSQDL
    HALTAKQIIVDIRNPGELTAVGSIAGAMNIPLPELRDRLNELPKDKELLVF
    CQVGLRGHVAYRMLIQHGFKVRNLTGGYK
    TYQMVNARF

    >gi|114561849|ref|YP_749362.1| thiol:disulfide interchange protein DsbC [Shewanella frigidimarina NCIMB 400]
    MNPCNIGITMKLTKAFALVASLIIAPIVSAATATDVSNESALKQKLTETLGVNVMLIQQSPVDGLYQALTDRGVLYVTKD
    GAKLFHGNLYDMDKGMKNLTEAALAGPRIELLKPFEDEMLVYKAKNEKHVVTIFTDVD
    CGYCRKLHNQMQGYNDLGITIR
    YLAYPRAGIPSANADEMQAVWCAKDPLKAMTEAKNGGNVKAASCDIDIAAQYKLGMSFGVNGTPALILENGVMVPGYQAP
    ADLLRTIESNL

    >gi|114561921|ref|YP_749434.1| hypothetical protein Sfri_0738 [Shewanella frigidimarina NCIMB 400]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDISTENIKLSQNNIVDPE
    DRYNQIFQIQVELPDDISDKDRQGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQTEADASTFILGKDLPLE
    QTIKNMTGLLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFALEEDDALPTGILDEYCLDIYNPDEELCGSHLIDTNSGNKDRGICAIPYTRQSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMAVLEKFPSILAGIKGLEEQGFPIVVKDASLGGQ
    FPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVISWRF
    FSSKFDYEFCEWDFSGTSEEEASGLFGILEAMGKEVYIAEFTDLGASACRILVPEYSEVYPVDDLIWDNTNKSLNYREDI
    LNLHSLSTKALGKLVNRLEESQLDNHTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGSHEDAIELVGEFLQFNDNTV
    QRGLFYQAVNAVLEVTLDEDLELEHFIGNFNRMFGKEVMDNVVGSVNGTVRFYGLSKTSMNLEGIEPHLRLIESYKKLHQ
    ARKANLSI

    >gi|114561927|ref|YP_749440.1| hypothetical protein Sfri_0745 [Shewanella frigidimarina NCIMB 400]
    MTAFTIHTVDTAPEDSKAMLEGAKKQMGMVPNLFGVLAESPSTLQAYQQLHQAFLDTSFNPEELTVVWQTINVEHECGYC
    VPAHTGIAHSMKVDPALTEALRNKAAMPTAKLQALQDATLSIVRNRGNISEAELAAFYAAGYGQQQVLEIILGLSQKVIS
    NYTNHVAKTPVDDVFKKFAW

    >gi|114561928|ref|YP_749441.1| DSBA oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MTAKIKLDIISDVVCPWCIVGYKHLEAAINELGLQDQVEIEWQPFELNPNMPAEGENLREHSARKYGTTPEGSVRARANI
    AQQGAENGFIFDYFEQMKMVNTLDAHVLLEYAKEVGKQTELKLRLFSAFFTEHKDISNREVLSAELIAVGINAAEAISLL
    DNAAVAEQVRAKEAHWQQLGISGVPTVIFNQSSALTGSHPVEAYKQVLADLVAQR

    >gi|114561998|ref|YP_749511.1| DSBA oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MIKYFAIVLTLITASFSTFATPFVAGKHYTQISNNMVPSEPKVTEFFSFYCHNCFNMESQYLPEIKAGLDKKITFDSKHV
    DFMNSDLGTEVMRALAVIHELDNKEALKIAMFGAIQGKDNTGGHDHAAAGHEHKSQINNRDDIKNVFAQFGVDAKQYDTV
    ADSADTNKKLTMWRQQQVTYAVQSVPAFIVNDKYAINLNEMRSLDDIIGVINYLALKQ

    >gi|114562045|ref|YP_749558.1| thioredoxin [Shewanella frigidimarina NCIMB 400]
    MIIACPHCDTLNRVPEERLEQQPTCGKCKQSLFVGEPIELTAANFSHHANKSELPLVVDFWASWCGPCKNFAPVFTQAAK
    KWEPKFRFGKLNTEEQQTLAGQFNIRSIPTLMVFKQGKVLAQQSGAMPASSFNQWLESIK

    >gi|114562130|ref|YP_749643.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella frigidimarina NCIMB 400]
    MADAKELKQVLTGPIINNNPIALQILGVCSALAVTSKLETALVMTIALTAVTAFSNLFISLIRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYAISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVGVVRELFGNGSL
    FGVEILSKISDGGWYQPNGLLLLPPSAFFLIGGLIWLIRTYKPEQVEAKG

    >gi|114562131|ref|YP_749644.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella frigidimarina NCIMB 400]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPANQIIYQGLLAPGALAWAGFPDADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLGESVVFGIGSGIGWALAIVL
    LAGIREKMKYSDVPNGLRGLGITFVSAGLMALGFMSFSGVSL

    >gi|114562259|ref|YP_749772.1| OsmC family protein [Shewanella frigidimarina NCIMB 400]
    MGFKLTVNWQSSPSEEGEFNRDHEVKFGTGQTIQASSAPEYKGNADKVNPEESLLAALSSCHMLTFLAIAHLKRLPVASY
    VDNATADLGKNEAGKVAVVKMTLAPNVTFAEGIEVDEETLAKIHEKAHAN
    CFIANSLACEVEIKQ

    >gi|114562261|ref|YP_749774.1| DSBA oxidoreductase [Shewanella frigidimarina NCIMB 400]
    MATNQIQIDIISDVMCPWCIVGYRRLEQALSKFDDLEVKLQWHPFELNPAMGSEGQHLGEHIAEKYGSTPEQSAQNRQRL
    TQMGADLGFEFNFSDSSRIYNTLLAHQLLYWAAETGKQTDLKLALFSSYFTEQKNPDDIEVLIEAATKVGLDAAEARAVL
    SDKRFETAVKEEEQLWISRGIQAVPAIVFNQQYLVSGAQDPDTIAELITKLLAEAA

    >gi|114562302|ref|YP_749815.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MLFAIGSLGENMMSIGLFCHFRNIKFIALSLAIGLGVNAQAQAAPSLEHDVLDQQGASVSLQQFAGKVVYVDFWASWCAP
    CRKSFPWMNAIQAKYQQQGLEVVAINLDVDTALAHEFLSKLPATFNLRFDPEGDIAQAFDLQGMPSSFLFNRKGELVQTH
    MGFFTENIPAYEQEIQMLLQE

    >gi|114562412|ref|YP_749925.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MLFSRFSGKCLIALGAILLSMQVQALTLGQAAPDFTLKNQQGTNLNLAEQRGEIILINFWASWCGPCRKEMPVLQKLQDK
    YQDLGVQVWGINVEQENQAGKDFLADLDLRFPIFFDQTNSLSKTYQVEAMPTTVIIDRDGNVRFIFQGYQDGFDKKYAAA
    IKQLIRE

    >gi|114562579|ref|YP_750092.1| peptide methionine sulfoxide reductase [Shewanella frigidimarina NCIMB 400]
    MKSTLVLTIFAVSLLSYASNATADKTILAGGCFWCMESDFEKLDGVTDVISGFTGGNIKDPIYNGNHRGHFEAVEITYDP
    SKVSYAELLEHYWVNIDPFDASGQFCDKGSSYLSAIFVANDTERQIAQQSKSKVEKLFPNSKVVTPILNASTFYPIKGDE
    SYHQDYYKNNPIRYNAYRWNCGRDKRLNEIWGDKATH

    >gi|114562585|ref|YP_750098.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MLLDTPICDYGWKAPDFTLKDANGNAFTMSDHLGEKGLLIMFICNHCPYVKAIATRLAADTKQLMAEGINVLAVMSNDYH
    DVEADSPKNMLSFAKQHGFEFAYLVDEDQQVAKQYGAVCTPDFFGFNYLGELQYRGRLDDARLQDAPNREPELLQAMQMI
    AAIGKGPKQQTASMGCSIKWR

    >gi|114562632|ref|YP_750145.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella frigidimarina NCIMB 400]
    MSVLVGRPAPDFTAAAVLGSGEIVDTFNLATAIKGKPAVIFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FTHNAWRNTPVDKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLVDKEGQVRHQVVNDLPLGRNVDEMIRMID
    ALQFHEEHGEVCPAGWSKGEKGMTASTEGVAAYLKDNSDKL

    >gi|114562643|ref|YP_750156.1| glutaredoxin 1 [Shewanella frigidimarina NCIMB 400]
    MFVVIFGRPGCPYCVRAVELSEKLAAQSEDFKFKYIDIHAEGITKADLSKSVGKTVETVPQIFVDEQPIGGCTEFEAYVR
    QNNLLN

    >gi|114562648|ref|YP_750161.1| glutathione S-transferase domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MITAYGDSMSGNCYKLQLVLNMLDVDHLWQEMSITNGETQTPEFLAKNPQGKIPLIELDDGRVLSESNAIMGYLAEGSDL
    IPTDTFSKAKMYQWMFFEQYSHEPYIAVARFIQLYLGLPEDRLAEYHSLHVKGHKALAAMEAELAWQPFLCGSQFTLADI
    ALFAYTHVAHQGGFDLAHYPQINQWLIRIKQQAGFLLMES

    >gi|114562665|ref|YP_750178.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella frigidimarina NCIMB 400]
    MNDLTEFEKYVIEQKGTERPFSGEYVDHDAQGVYLCKKCYAPLYKSEHKFNAHCGWPAFDDEIKGAVEHTPDADGHRTEI
    TCAQCGGHLGHVFEGEHLTDNNVRH
    CVNSVSMIFKSRDELAQSSSAKTSYQKATFGAGCFWCVEAIFAQFKGVHSVKSGY
    CGGDAKDANYDAVCSGKTAHAEVIHIEFDPAVIQYDTLLSVLFESHDPTTLNQQGNDKGPQYRSAIFVHNSEQADAANKF
    INTLTQQQVWPRPIVTEISAFDTFYPAENYHDDYFAKHGQQPYCQLVVKPKFDKVMSKFADKRKV

    >gi|114562710|ref|YP_750223.1| glutathione S-transferase domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MNSAILYTFRRCPYAMRARISLHLSQLNPLVREIELKNKPAELIAISAKGTVPVLVTANNKVISESLDIMRFALTEYPAP
    ENHYLTTEEYQALQYWLDQSTTESLINANDNEFKPWLDKYKYADRFPEYSKLWYRQQAERFIQTLEDLLQQHNYLCTDSP
    TLADFAIFPFIRQFANVEPVWFNTMPYPNVIVWLTTLVNSSLFNVTMYKYPLWLPQKNMIQLKHSEHDDGQVIPLCKN

    >gi|114562711|ref|YP_750224.1| hypothetical protein Sfri_1535 [Shewanella frigidimarina NCIMB 400]
    MQQPKPASKQESIQKAMQASSQSQVAVCALYKFVALPHFEDVRQPLLDIMEQNEIKGTLLLAQEGINGTVAGTASAIDIL
    LAWLGTQSGLDNIVTKFSFDAEMPFYRTKVKLKKEIVTMGIEGIDPRKVVGTYVKPKDWNALISDPDVVLVDTRNDYEVK
    IGTFKNAVNPVTETFREFPEYVKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVEQEQSLW
    EGECFVFDNRVAVNHSLEKGQYDQCNACRMPITEAEKQTEAYVQGVSCPHCIDKVPQEQRQRFIERERQVQLAKQRGEAH
    IGSDVKQVIDARRQQKEAQRKAQEKINNKG

    >gi|114562901|ref|YP_750414.1| thiol-disulfide isomerase and thioredoxins [Shewanella frigidimarina NCIMB 400]
    MKIIKVLGSGCKKCLETAELAQAIADEKGVAIKIEKVTDMAQIMAYDVMSTPAVVVDEKVVHKGSKPTKDQMAMWI

    >gi|114562916|ref|YP_750429.1| disulphide bond formation protein DsbB [Shewanella frigidimarina NCIMB 400]
    MSQLQQFCHNRFSWGLLLLSAIGLELAALFFQYGMDLAPCVMCIYIRVAVLGIILAALIGILQPKVWLLRLVGMAGWAVS
    AVWGFKLAYELNQMQVNPSPFAT
    CSFYPEFPSFMPLDTWLPSVFSPTGMCSDSPWSWLSVSMAQWMMLGFAIYGVIWLLM
    LLPALKSAK

    >gi|114562923|ref|YP_750436.1| glutaredoxin-like protein [Shewanella frigidimarina NCIMB 400]
    METVEKIKQQISENPIIVYMKGSPKLPSCGFSSQVAQVMINCGEQFAFVDILQHPDIRAELPKFANWPTFPQLWVEGELI
    GGCDIITEMFQKGELQPIIKATADKFRTEDAAE

    >gi|114562929|ref|YP_750442.1| arsenate reductase [Shewanella frigidimarina NCIMB 400]
    MTMTTTKTTIYHNPRCSKSRETLALLQANAADVTVVEYLKTPPTADEIQTILQQLGLTARQLMRTKEDEYKAQNLADASL
    SEDQLIAAMVATPKLIERPIVLANNKAAIGRPPENVLSIL

    >gi|114562941|ref|YP_750454.1| hypothetical protein Sfri_1766 [Shewanella frigidimarina NCIMB 400]
    MTLYGIKNCDTVRKARKWLEAEKIDYTFHDFREDGLNETMVTQWADVVGWETLFNKRSTSFRGLTDAEKTDITQDKAIAL
    MVQHPTLIKRPVLVNNDKLLVGFNLAQYQAWFA

    >gi|114563022|ref|YP_750535.1| hypothetical protein Sfri_1849 [Shewanella frigidimarina NCIMB 400]
    MTNQLSQQTPVTVETVDDLAKLVNYSLMDTLNSDPDATANGDDHAPRQVFSGHYVPVKPTPIENPEYVAHSSNLFAELGF
    ADSMAQSANFMSLFSGDLSNVPEPMSKVGWACGYALSIFGTEYIQQCPFRTGNGYGDGRAVSVLEAVINDKRWEMQLKGG
    GRTPYCRGADGRAVLRSSVREFLAQEHMHALGVPTSRSLSLYVSKTETVQRPWYSEGSNAQDPDQMISEAVAISTRVAPS
    FIRVGQLELFGRRARTQEHPQAMAELELLMLHLIDREYADVIDQKLTNEQKVLLLAREFRSRLTSLIANWIRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCDVFNPQYQPWTGGGQHFAFLNQGVAAERNFLMFCTALSPLLMSTPDYLEQLQQLVDGFAT
    EMQTKMEQMWAAKLGLNTFDAALFNELETLMLQTPVDYTIFFRELSSLPDDIGPLKKSFYRDLAQGPQGLEQRWSAWLVQ
    WQTLLGTEGNSTMLIADENADTQPRNRDDIIAQMQRVNPKFTLREWLLVPAYQQASVGNYALVRELQKVMTQPYAEQSQE
    VEDKYYRLKASEFFGVGGCSHLS
    CSS

    >gi|114563035|ref|YP_750548.1| thioredoxin-dependent thiol peroxidase [Shewanella frigidimarina NCIMB 400]
    MNTLNVGDTAPNFTLQNQAGEAVSLQDTLSKGPVLVYFYPKASTPGCTVQAQGLRDIKAQLDGLHVTVFGISPDPVAKLA
    KFADKQQLNFALLSDEDHAVADGFGVWGQKKFMGKIYDGIHRLSFIVGTDGKISHVLNKFKTKDHHEVVLATLAE

    >gi|114563103|ref|YP_750616.1| thioredoxin reductase [Shewanella frigidimarina NCIMB 400]
    MSEARHVNLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGDAEDLTGPALMDRMQKHAEKFDTEI
    IFDHINEVTLTERPFRLKGDNGEFTCDALIIATGASAKYLGLPSEEAFMGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILINRLMDKVANGNIILHLDQTLEEVTGNDMGVTGLKKKSTKDGSVTDLEVAGVF
    VAIGHSPNTGIFAGQLEMNHGYLQVNSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|114563104|ref|YP_750617.1| peptide methionine sulfoxide reductase [Shewanella frigidimarina NCIMB 400]
    MALATFGAGCFWGVEYFFREINGVSNATCGYMGGKDSATTYKEVKTGSTGHAEVVQVEFDPEVVSYNDLLDTFWKNHNPT
    MLNMQGGDIGTQYRSTIFFHDKEQKAQAESSKLALARSGKWGQRHIVTEIVPIQTFHIAEEYHQNYLEKNNLPTCHLVY

    >gi|114563150|ref|YP_750663.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MKTAQEYISEIKTHIIEVSTQELLTAMLNPDVIIIDVREHDEFTTGHIEGAVNFPRGVLEMKIHEHPLVSHHCEWVLALN
    ELADKDIYLI
    CRTGGRSALAAASLQDMGFSKPMSVAGGMMQWQQDGFPLVPHKK

    >gi|114563153|ref|YP_750666.1| peroxidase [Shewanella frigidimarina NCIMB 400]
    MTDSIVSFPQLNRPAPAFNAKTTHGMRSLTDYKGKWLVLFSHPADFTPVCTTEFIGFAQRAEEFAHINTELLGLSIDSVH
    SHIAWVRNIEENFGVDITFPIISDLSMEVAKAYGMIQPGASDTSAVRATFIIDPEGMLRAMVYYPMSNGRSIDEFVRLVK
    ALQTSDANGVATPENWQPGDDVIVPPPATTADAKARLSQGYDYVDWYFSKKSL

    >gi|114563186|ref|YP_750699.1| heavy metal translocating P-type ATPase [Shewanella frigidimarina NCIMB 400]
    MTSCFHCNEPVLTGEQFTTVINGQPQPMCCPGCQAVSQAIMDAGLSSYYQFRSEPGNRQTALIPEQLSQYSAYDLPEVQQ
    DFVHKQGAIDSTSLSIDGIT
    CAACAWLIEHKLKPIAGVTNVLVNSTTQRALVSWDSQIIQLSEILQIISKIGYQAAPYQV
    DEQEKQSKADSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVEFRDYFRWVSLIFAAPVVLYSAQPFYFSALRSLLS
    GKLNMDVSVSIAILGAYIASCVATIQANGEVYFESVSMFTFFLLLGRYFEQTARQKASVSSSNLHKLVPLTAHLYRDGEI
    TEIAAKQLVIGDIILVKPGEVIAADAEVVNGLSSVNEAMLTGEQMPIGKQINDTVYAGTINVEQPLQVKVTALGQDQLVA
    EIIRLQELASNNKPAIALVADRLARYFSATILSIAALTYIVWLFISADDAFWITLSVLVATCPCALALATPTAVTCATAI
    FTKLGVIPRKAGIFEKLTKIDHVVFDKTGTLTCGQLSIGEVQTFGEYSSEQVLSLAAAIEQGSLHPIALAFKPFYDNKHL
    VENVDHHIGLGIRASIGQLQVCIGTAQFVTPDANVAASQAIETQWIYLSVNNKLIAKIEMLDELRVDSLATVNALKAANI
    KLSIASGDNSGHVEFLASKLGISDVHSGLSPQDKLALVNQLQQQANVAMFGDGINDAPVLAGANLSVAMGSGSAIAKNSA
    DLILLGDHLSRFNDAIDVAKQTQRIIHQNLLWAFAYNIVILPLAVTGHVAPYIAAIGMSVSSLIVVSNSLRLLRIKL

    >gi|114563343|ref|YP_750856.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella frigidimarina NCIMB 400]
    MFNLIFYPLFIGAKPKIILGSIGQKIVAMSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLASAIGMSMATTFVLTLA
    SILSYLTNEFLLQPFDLNYLRTMSFILVIAVVVQFTEMVVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNVNEDHNFIQ
    SAIYGFGAAVGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFAGLVN

    >gi|114563344|ref|YP_750857.1| electron transport complex protein RnfB [Shewanella frigidimarina NCIMB 400]
    MISSILIAVAVLSVLALVFGVILGFASKKFKVEGNPIIDQVETLLPQTQCGQCGYPGCRPYAEAIANGDKINKCPPGGTA
    TMEKIAELMGVEPEALGEEAQASVKKVAYIREDECIGCTKCIQACPVDAILGAGKLMHTVIAKDCTGCDLCVEPCPVDCI
    DMIPVETTIQNWDWKLRAIPVNVINPEQEDKRC

    >gi|114563348|ref|YP_750861.1| SoxR-reducing system protein RsxE [Shewanella frigidimarina NCIMB 400]
    MSKYSEIAAQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGVATLLVLIGSNVLVSLVRDFVPKEIRIPVFVMIIAALV
    TCVQLLINAYAYNLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSLAHSAFDGLMMGLGFTAVLVVLGASRELLGQGTLFGG
    ADLLLGDWASVLTIHVWHVDTPFLLAMLPPGAFIGMGLLIALKNVIDSRVNAMQPKVESVSVTRARITKVN

    >gi|114563370|ref|YP_750883.1| UBA/THIF-type NAD/FAD binding protein [Shewanella frigidimarina NCIMB 400]
    MNSLSGLDYIQYSRTMLLGDIGEAGQLAIMNSPVVIIGVGGLGNVVAHYLAAAGVQQILLIDHDVVELSNLPRQLLFRAS
    DIGQAKVNIAKSALSDAYPQINIDVLAQPITSAHFNQLVKRFTVKPVVFDCTDNVSARQLINQLCVQHQLTLVSGAISAY
    QGQLFCLDFSRPHSHSGCYCCLYPLDTPIMQN
    CTQAGVFGPAVGIIASMQALVGLQHICNTFTQYGVLHRFNAQDLRWQY
    ANMSQDPQCEVCHQYPLTDHQERSNDTN

    >gi|114563592|ref|YP_751105.1| iron-sulfur cluster assembly protein IscA [Shewanella frigidimarina NCIMB 400]
    MAISMTPAAADRVRSFLANRGKGLGLRLGLRTSGCSGMAYVIEFVDDLNDDDELYNIEGVNIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|114563669|ref|YP_751182.1| glutathione S-transferase domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MVLPVLYSLRNCPYAMRARLAIYASNQQINLRDLVLSNKPVEMLTVSPKGTVPVLVTADNEVIDESLSIMLWAFSQTDPD
    DYISQATPNALAEMLAVIAIFDNEFKGHLEKYRCSKRYHEPSLVEDRQQCERYLADLESRLCQHSYLMSDQPSLTDLALM
    PFIRQFARVERQWYLQSPYPKLRQWLNHYLQSRMFSKVMVQNPMWLDSKQEVVFGANV

    >gi|114563679|ref|YP_751192.1| flavocytochrome c [Shewanella frigidimarina NCIMB 400]
    MMNEKVFSQTRRNIIKAAALAGVGSTTLSLTAEAKPMHEFDETYDVVIVGSGFGGLATALQSRELGMSVLVVEKMPAFGG
    NS
    CLNGSGFAVAGLDEQAKLGIDDSPEKFMQDILSSGQGLSTPTLAHAIAYGAKDAFEWAQSHGVKFADGVYLYGGHSVA
    RVKIGVRATGGDITIPLREKGELLGAQYRSRCSMKSILLENGKAIGIQVANHHDWTNAESGIVKNIRAKKGVVIATGGYA
    NDVQFRQMQDPRLDASISNTNQPGGSAQGLKEVLRAGGAPHQLSIIQIGPWASPDEHGYGDSPDYSPFAGYTHGIAVDVN
    TGERFLNETGDRNIRAKNITNILDKTPGVYPVLFCDSIGHNDPGIPATRRRRIIKSGTVKEFATLEQIAKHYGIPVAPFL
    KQVERYNASVKAGVDKDFGKLVSRLKPISTAPFYAQRVSNTIHYTEGGAYINENASVLSLEGEPIPNLYAVGEVSSGAHG
    AGRLGGCGTADPMVMGRIAAKHIAAKA

    >gi|114563828|ref|YP_751341.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MSILTKMCQWLPFGKVPEMHAQGVYKRLQKNDVQIIDVRSKMEWDRSHIEGSINLPITSLSIDAIKQLELSPEITTVVIC
    LSAHRSIPGVRKLKQFGFTDVYQLEGGMLSWWKLSLPTSK

    >gi|114563856|ref|YP_751370.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MFKKSMPLSVQSILALLVLFAASLMPTWAAEQEPSVAWEKIDRGVTLIDVRTAEEFAAGHIDGAINIPFENIVSELAKRN
    ITKDSEIVLY
    CRSGNRSGMAQESLVKQGYSNTYNAGGFDSLISAR

    >gi|114563861|ref|YP_751375.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MQPSPAFASLVDSVMPHVNLLTIEQYQQQDQWQLIDVREDNEWLQGHLPDAKHLSRGIIERDIEHRFPDKSTPILLYCGA
    GQRAALSAYNLQLMGYTQVASMIGGYRAWIQHQFPIVED

    >gi|114563870|ref|YP_751384.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MPSWLLNLKYTLKTKRFWLTSLRDIIVIAVVLFAIANYLQRDMRTGVAMPINAYTIANKPISLFTAPSINAQQHIRENST
    QHKPTLVYFWGTW
    CPVCKVTSPMVNSVSLNPDYQVVSIAVASGSDDDISTFMQHHHYHFDVINQHQTMLLSQQWGAMALP
    AIYIVDAENNIRFVTSGVTSSWGMSLRLWLATW

    >gi|114563876|ref|YP_751390.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella frigidimarina NCIMB 400]
    MTHFTSPKCHALVTSPVGLLSLKASEHGLTHLQVEDLAQTSSLVEIQTQFRFQQGTTETTQDLVVQAQQHIDTTVIQLTE
    YFANQRQHFSVPLAPKGTVFQHEVWHALSQLTFGQRCSYSDIANTIGRPKAVRAVGAANGANPIAIIVP
    CHRVIGKGGKL
    TGYAYGLDMKQWLLDLEGIEEIN

    >gi|114563929|ref|YP_751443.1| glutathione peroxidase [Shewanella frigidimarina NCIMB 400]
    MTAAIYPISVKDIQGNDVVMESFKDNVLLIVNTASKCGFTPQYKALETLYQQYKDRGLVILGFPCNQFGKQEQGNEDEIS
    QFCELNFGVTFPLFSKIEVNGSNSHPLYQHLKKSAKGLLGSESIKWNFTKFLVDKQGNVIERYAPTTKPEDLNAVIEKLL
    G

    >gi|114563950|ref|YP_751464.1| thiamine biosynthesis protein ThiI [Shewanella frigidimarina NCIMB 400]
    MKFIVKLYPEIMMKSKSVRMRFTKMLETNIRNVLKNVDEGAKVQRLYDRIIVQVPSDKPELCDVFADRLACIPGIAHVVQ
    VSEYSFDSIDHIYQQALPKYRDEIAGKTFCVRVKRSGNHDFNSIDVERYVGGGLNQHTEALGVKLKDPDVTVNLEINQDK
    LYMVERRIQGLGGFPMATQEDVLSLISGGFDSGVSSFQFIKKGARTHYCFFNLGGAQHEIGVKQVAYHLWKKYGESHKVR
    FVSVPFEPVVEEILERIDNGQMGVVLKRVMMRAATRIADKYGIQALVTGESLGQVSSQTLTNLNVIDRSTDLLILRPLIA
    MDKQDIINQSRIIGTEDFAKSIPEYCGVISQKPTVKAVLSKVEAEELKFSEDLIDRVVASAVVMDIRDIEAEMNQQVTET
    ETVKDVASGEIIIDVRAPEEEERSPLLIDNVMVKAIPFFKLATQFADLDKSKTYLLY
    CDRGVMSKLQALYLVEQGYTNVK
    VYRP

    >gi|114563967|ref|YP_751481.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MKLFSTFAAITLLSSSVMSAPSFAGEKTMITMGGNPVALEGHIPKINTVAPLFTVVDERFNPVSLSDFKGKTVLISAVPS
    LDTGV
    CALQTKRFNKEFTQYDADVVMLTISEDLPFAQKRFCQTENVDKIKVLSDSVWRDFGEKYGLLIKDRGLLARSIFI
    IDPQGILKYQELVTEVSEHPDYDAALAALTEISSAAK

    >gi|114563979|ref|YP_751493.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MSLSTQLTEKRDANAANLPPEVLAIMSDATLNLKLSGIIDSAPKAGDKLAAFSLTNPLGVTRHLSELLVNGPVVVTFYRG
    SW
    CPYCNLALRAYQQHLAEFKQLGATFVAITPELPDMSLSTAEKNELEFDVLSDVNAEYAKALGLVFSLPDSIRDLYKKF
    GVEVEKHNGADQFNFPLAATFVVAKDGTIVKAFVDADYTYRLDPEDIISSLKAL

    >gi|114564017|ref|YP_751531.1| glutathione peroxidase [Shewanella frigidimarina NCIMB 400]
    MIKYITAIGLMALSFSTVAANCPDYLNVEARKLHSTENVNLCELTQGKAVLIVNTASHCGFTPQFEALEALHKQYADKGL
    VVIGFPSDDFFQEEKDEAKTADVCFINYGVTFTMVATSPVRGDEANSVFKYLDDKSAAPKWNFYKYVVSPDGQTVQQFSS
    RVKPDSEELKNAIESVL

    >gi|114564121|ref|YP_751635.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Shewanella frigidimarina NCIMB 400]
    MFKKIVLLLIAASLVGLFFHFDLHQLLTLEGLKGSMNDFSQLREQSPLLVIGGFFLLYVAVTALSLPGAAILTIASGALF
    GIVEGLIIASFASSIGATMAFLVSRYLLRDSIKQRFPERLAAIDTGIEKEGGFYLFTLRLVPIFPFFLINMLMGVTAFKS
    WTFYWVSQVGMFLGTFVYVNAGTQLAQIDSLSNILSVNLILSFALLGLFPLIAKAIVNMIKKRRVYSKWTKPAKFDRNMI
    VIGAGAGGLVTSYIAAAVKAKVTLIEAGEMGGD
    CLNYGCVPSKAIIKSAKIAQQIRNAHHYGLEDSTPEFSFKKVMARVH
    QVVADIAPHDSVERYTNLGVDVVKGYAKLVDPWTVEISHPDGNTSRLTARSIVIATGARPFVPPLPGIEEVGYVTSDTLW
    DEFAKLDTAPQKLVVLGGGPIGSELAQSFARLGSKVTQVEMAERIMIKEDLEVSEFATQALQKSGVNILTSHQALRCELR
    DGKKYLIVKHQEQELALEYDQLLCAVGRSARLSGYGLEELGIETNRTIVTNEYLETLYPNIYAAGDIVGPYQFTHVAAHQ
    GWYAAVNGLFGHLKKFKVDYRVIPWTTFIDPEVARVGINEYEAKQQGIDYEVTRFDFAELDRAITDSATEGFIKVITPKG
    KDKILGVTVVSEHAGDLIAEFVLAMKHGLGLNKILGTIHSYPTWAEGNKYAAGEWKRNHAPETVLRWLEKYHTWRRG

    >gi|114564140|ref|YP_751654.1| iron-sulfur cluster insertion protein ErpA [Shewanella frigidimarina NCIMB 400]
    MTEQVDATMPIQFTDAAAIKVKGLLEEEQNPELKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTIEKQGVQLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|114564182|ref|YP_751696.1| 3-mercaptopyruvate sulfurtransferase [Shewanella frigidimarina NCIMB 400]
    MNFPLVTTDWLAQHLEDPDLVLLDASIEIVLGKEPLVYDELYVIPGALSCQIDKLFFNHQSPQTHAMPTEDQFTVAAKSL
    GVSHNSTVVIYDDQGIYSAPRAWWTFKAMGFDKVFVLDGGLPLWRSEGRDTVRQFATATDSGDIKGRLQQYKVCDTEFVL
    THLGHAKVDIIDARAAGRFNGTTPEPRVGMRGGHIPGSLNLPFAQVLNGFKMKSIRELHTIFASLDTSNNAQRVFS
    CGSG
    ITACILILASYVAGHHQAALYDGSWAVWGGDAALPIE

    >gi|114564232|ref|YP_751746.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MLKTLLIATALTLTSLASVAKPIASDENNVMPLLNGHQIPAITLQDVDGKAVELSKLVAQKPTIFFFYRGGWCPFCNSQM
    GQLKAIEPKLIEMGFQLVGISPDTPEKMRASMNKQELDYLLLSDTSMAASQAFGLAYYTSADITKKYTASLAVTNELFTT
    PAGDKRLVLPVPAVYLADKSGLIHFQYVNPNYKVRPAPELILTAAELLVKP

    >gi|114564257|ref|YP_751771.1| thiol:disulfide interchange protein, putative [Shewanella frigidimarina NCIMB 400]
    MTTLMLILLLVIFSAVVILIWAKIKGKSIPTLVIAMLIFMGICFAGIIAFVNKGEDYQAYQTLNWQPLEPEKIATYVEQG
    NIVFVDITADW
    CVPCQTNKANVLHREQVVNQLNQQHIILMQGNWTQADTVIEQYMGQQAAAGTPFNKIYGSSYPEGIELP
    KALIIDDVYRALALVVK

    >gi|114564368|ref|YP_751882.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella frigidimarina NCIMB 400]
    MEHYINLFIQAAFIDNMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVMVLAVPLNQIIYVNILAPGALAWAGFPELNLS
    YLQLITFIGVIAALVQILEMFLDRYIPTLYQSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFTESVVFASGSAVGWAMAIVL
    LAGLRERMKFHAIPDGLQGIGITFITTGLMALGFMSFAGITL

    >gi|114564369|ref|YP_751883.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella frigidimarina NCIMB 400]
    MSRAISTREILTSPIMANNPVAIQVLGVCSALAVSNSMQTAFVMTLAVTFVLVFSNLIISSIRNFIPNSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVSLIITN
    CIIMGRAEAFAMKHPPHLAVFDALGNALGYGLILMGVAFIRELLGRGTL
    FGHNIFTTIENGGWYLANEMFTLPPSAFFLIGVMIWVIKIIQRKRG

    >gi|114564618|ref|YP_752132.1| heavy metal translocating P-type ATPase [Shewanella frigidimarina NCIMB 400]
    MSECASKGCGCTTEPIIQPTAPAPLATGSAQAVYRIENMDCPTEEALIRSKLAGLAGVAGLEFNLMQRTLAVRHELPSLS
    PVEQALKAIGMQAVRMDQASAEQTTKLSIAKMD
    CPTEETLIRNKLGTVAGVADLDFNLMQRTLSVRHANQVLPDVLVALQ
    ALGFEAQVVDTAEVASPSAAPVTTPTNWWPLGISLVTASAAEAVYWLHNGNHWSVVVLALVAVFTGGLSTYKKGWIALKN
    RNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQITI
    GARVRVKPGERIALDGEVLEGRSAVNQAPITGESLPVEKSPGDSVFAGTINESGSFEYRVTALANNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPVVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALASDSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FNALPGRGVQGQINGETYHLGNQRMLEELGQRTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRSAIAEL
    HALGINTMMLTGDNPHTAQAIAAQAGIDRAQGNLLPDDKLREVELLAIKGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDNLGKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLR
    K

    >gi|114564641|ref|YP_752155.1| putative mercuric reductase [Shewanella frigidimarina NCIMB 400]
    MILLSIRLSIQGMSCPSSVEHIKEALDAVEGVIKTEVSYAKALAVITTRDGVNVAELILAINALGYVATELKDTTRCGDT
    DQQEDISPQQRVAIIGSGSGAFACAIKAAERGAQVTIIEASEVIGG
    CCVNVGCVPSKILIRAAQLAQQQRSNPFAGLENH
    APELSRARLSEQQTARVEELRAAKYQNILDNNPALSLIKGFARFNDANTLIIRKVDGSELVLHADKILIATGSTPTIPPI
    DGLAGTPYWTSTEALFAKALPQHLIVIGSSVVALEIAQAYRRLGSEVTVLARHSLLYAEDPLLGEKLSECFEKEGINVLN
    HTQAASVSYQGEQFTLETNAGTLIGDQLLISTGRNANTSQLNLAAIGVKTNQGGEVIVNERMETNISGIYAAGDCSNMPQ
    FVYVAAAAGSRAAVNMIGGDAKLDLTTMPAVIFTDPQVATVGLTEVQAKAQDIETDSRVLGMENVPRALANFETDGFIKL
    VAEKKTGRIIGAQILAHEGGEIIQSAALAIRNRMTVTELADQLFPYLTMVEGLKLCAQTFNKDVKALSC
    CAG

    >gi|114564749|ref|YP_752263.1| OsmC family protein [Shewanella frigidimarina NCIMB 400]
    MKALYTTSATALAGRNGQVSTDDKKVDLQLSYPKEMGGSGEFTNPEQLFAAGYAACFSNAILHVASQSKVAIKAAPTTAT
    VDIGANDNGGFALTVALAVELDLDQAEAEQLVTTAHQV
    CPYSNAVRGNIDVKLTVNGQAI

    >gi|114564818|ref|YP_752332.1| thiol:disulfide interchange protein precursor [Shewanella frigidimarina NCIMB 400]
    MDKRQLTIMKKLVAICLTSLLMMSSILLAPAAHSANVLSNKFSFLSSEPELMKVNDAFVFDYQQQGNQLKINFVIAEGYY
    LYRDKLQFSVDGAVIGDIELPHGKNHHDEYFGDQEVFYSFVEIPIAFKEAQADAVFHVTFMGCAEGTLCYPPTKHDVTLT
    AIEANDGTLSSKKVIGAPDDAQASTTATDAPAAPITQQDTLNQMLQNDSLLWTLVIFFGLGIGLALTPCVFPMYPILSGI
    IVGQGKKLSTAKAFTLSMAYVQGMAITYSLLGLVVASAGLKFQAALQHPAILIFLAVMFVLLSLSMFGMYDLKLPSKWQE
    KMNSMSNNQKGGNLIGVFMMGVISGLVASPCTTAPLSGVLIYVAQSGDLLQGFLALYVLSMGMGLPLLVIGTSGGKILPR
    AGAWMDIIKTIFGFLLISVSIVMIGRIWPGLVSDLLWSLWAICLVAYLMHQNRLSEFNWKQSTRGVFLLLALMASFSYGF
    QAIMTGFGHKTPDITQAGVEGKTQNKENHFIRIKSLEDLEVELDKASISGKTVMLDLYADW
    CVACKEFEAITFKNKDVAT
    RMSQMVLLQADVTASDDIDITLLEHYGVLGLPTLLMFNSDGKQREDLRVTGFMGPKDFAAHLDILLAK

    >gi|114564927|ref|YP_752441.1| dihydrolipoamide dehydrogenase [Shewanella frigidimarina NCIMB 400]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTIIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVADHGVVFGEPK
    IDLDKLRGFKNKVISQLTGGLGGMSKMRKVNVVNGFGKFTGPNSLEVTAEDGTVTVVQFEQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAKDDGIYVTMEGKKAPAEPVRYDAVLVAIGRSPNGKSLAAEKAGVNVDERGFINVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGVAYETATFPWAASGRAIASDCSEGMTKL
    IFDKETHRIIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLYESIGLAAEMYEGSITDLPNPKAVKKK

    >gi|114565027|ref|YP_752541.1| glutathione reductase [Shewanella frigidimarina NCIMB 400]
    MAQHFDYIALGAGSGGIASANRAAMRGAKVLIIEAKHVGGTCVNVGCVPKKVMWYGAHVAEALNLYAKDYGFDVTVNKFD
    WNTLVDNREAYIGRIHDAYGRGFASNKVTLLNGYGRFINNNTIEVDGEHYTADHIVVATGGAPTIPNIPGAEHGIDSDGF
    FALRAQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILTDALVDAMATDGPTLHTHSVPKSVTQNADG
    SLTLLLENDQSLTIDCLIWAIGRSPSTGNIGLENTDVQLDAKGYVITDEQQNTTAKGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFGNMPDAKMDYSLIPTVVFSHPPIGTMGLTEPEAAEKYGQDNIKVYASTFTSMYSAVTAHRQACKMKLVCAGDD
    EVVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|114565090|ref|YP_752604.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MSGFKHLSINELIHMSTESNDIQVVDIRDAASFAAGHIEGATHLTNENLADFIGDADMDKPVVVVCYHGMSSQSAASYLN
    EQGFDDIYSLDGGYSAWSLAHA

    >gi|114565170|ref|YP_752684.1| rhodanese domain-containing protein [Shewanella frigidimarina NCIMB 400]
    MQEYMEFFKANPMLSLAWVGLFVALVVSVIKSGTSKVKNVSHQELTLMVNKQDAKLVDVRGKEEFKKGHIVDSLNVTLSE
    IKNNQVTSLEKFKTSPIILV
    CNSGMTSGQAAQLLTKQGFENVFNLKGGMGEWQGANLPVVKSKR

    >gi|114562770|ref|YP_750283.1| glutaredoxin [Shewanella frigidimarina NCIMB 400]
    MFIVRWILGRIILLLNFVFAPKKRQRPQDQQAIVDQQTQSLALYQYAACPFCVKVRRDIRRQNLTINLVDAKQDDNKSVL
    VSQGGKLQVPCLRIEQDGNTQWLYESKAITSYLNERFA

    >gi|114563826|ref|YP_751339.1| glutaredoxin 2 [Shewanella frigidimarina NCIMB 400]
    MQKNSSVAYVLYHTEGCHLCDIAQVLVDQTAINYQHIDICDNASLAERYGMSIPVFVQGERELFWPFDAAQLQEFLGV

    >gi|114564051|ref|YP_751565.1| hydroxymethylbutenyl pyrophosphate reductase [Shewanella frigidimarina NCIMB 400]
    MLKVDPTSPELSILLANPRGFCAGVDRAISIVERALELFEPPIYVRHEVVHNRYVVENLKQRGALFIDELDQVPDNSIVI
    FSAHGVSQAVRKEAKNRGLKVFDAT
    CPLVTKVHLQVTRASRKGIECILIGHEGHPEVEGTMGQYDNPKGGVYLIESPEDV
    NNLQVNNPDNLCFVTQTTLSVDDTLDIITALQKRFPSIEGPRKDDICYATQNRQDAVRSMSSEVDLLIVVGSKNSSNSNR
    LRELAEKTGTQSYLVDTAADVEAMWFDGVKKVAVTAGASAPEVLVQQVVNAIAKLAPSIITEVEGRKEDTVFAVPAELR