Shewanella denitrificans OS217 uid58263

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91791482|ref|YP_561133.1| molybdopterin biosynthesis protein MoeB [Shewanella denitrificans OS217]
    MFEAEILSHTEMMRYSRQISIKGVDLEGQEALKQAKILMIGLGGLGCAASQYLAVAGVGELTLVDFDTVELSNLQRQVLH
    HDENIGQNKVDSAKQSLQQLNPHIKLNSINGKLNQNQLTELIQSHDLVLDCTDNLAIRQDLNLSCFNHKTPLVSAAAIRM
    EGTVTVFDYQASSPCYHCYSSLFGEQALS
    CVEAGILAPVVGIVGAIQATEAIKYITQLGQGLQAKVLLIDAMTMEFRQMK
    LLKNPACPVCGASRN

    >gi|91791597|ref|YP_561248.1| selenide, water dikinase [Shewanella denitrificans OS217]
    MTDTKIKLTEYSHGAGCGCKISPQVLSTILASKLPVFTDKNLLVGNQTHDDAAVYKLNDDTGIISTTDFFMPIVDDPFTF
    GRIAATNAISDIYAMGGTPIMAIAILGWPVNKLAPEVAQQVVDGGRQACADAGIMLAGGHSIDAPEPIFGLAVTGQIPLS
    QLKQNSTAKAGDKLYLTKPLGIGILTTAQKQKKLQAEDEHIAVDAMCTLNKIGVDIAKIAGVNALTDVTGFGLAGHLIEV
    CQGAELSAQIDVDALPLLAKVKQYLALGCVPGGTHRNFDSYSAYLPELNDEQKAILCDPQTSGGLLVCVSEASENSLIQL
    LESQGITASCIGSLQAVSSDKLVEIIQ

    >gi|91791653|ref|YP_561304.1| DSBA oxidoreductase [Shewanella denitrificans OS217]
    MKKALLMAAALLIAPLSAVAAEYKEGVHYTVINDGPATEKPEITEFFSFFCGHCYNFSKTVVPKIKTTLPEGVVFSQSHV
    EFIGNEMGVEMSRAFAVAHQLNVDEKMEAAIFAAIHDERKRLINRDDVRALFVANGVEGKDFDSAANSFMVNAQMSKMKR
    DTENAKLSGVPSLVVNGKYRVETGAVKSFDEVLAIAYHLTKLK

    >gi|91791744|ref|YP_561395.1| OsmC-like protein [Shewanella denitrificans OS217]
    MELIYTAQAKTTGGREGRSVSSDNKLDIQLSTPKELGGAGGSGTNPEQLFAAGYSACFIGAMKFVAGQDKINLPTDLSVT
    ADVGIGGNTKGVGFAIAVVLNISLPSMDPDAAKALVDKAHQV
    CPYSNATRGNIDVELIISH

    >gi|91791781|ref|YP_561432.1| thiol:disulfide interchange protein precursor [Shewanella denitrificans OS217]
    MNKILSLLLSSLILLSPLAHSESFGQSKSFSFLSSEPVLLPVNEAFSFDYQQQGNQLKISWVIADGYYMYRDKLSFSIEG
    AKLTEVVLPRGKMHLDDYFGEQEVYYSFIEFPLELQQIDANANLSVTFMGCAEGKLCYPPTKRMVPLIASAGEAASSSAS
    PADKAIIGGSQRDAISADNTPAAEAVHVSTQDSLSQMLAGDSLLWTLAIFFGLGIGLALTPCVFPMYPILSGIIVGQGKK
    LSTAKAFTLSMAYVQGMAITYSLLGLVVASAGLKYQAALQHPAILIVLAILFAVLSLSMFGLYDLKLPAKWQEKMNSLSN
    NQKGGNLIGVFLMGVISGLVASPCTTAPLSGALIYVAQSGDLMQGFLALYVLSMGMGIPLLILGTSGGKILPRAGAWMDI
    IKTVFGFLLIAVSIVMLSRIWVGVVSDVLWSVWALAFVGYLMHQNKLSEFNWKQTARSIMLILMLMASFSYGFQAVMNHF
    GFTSPSLAQQAASQSTGMKAAKHIEFIKIKSLDDLNRELAKASANNQTALLDLYADW
    CVACKDFETITFKDSQVEQRFQQ
    LVLLQADVTKSDDIDVELLEHFNVLGLPTLLMFDKNGQQREDLRITGFLGPKDFVKQLDLLINK

    >gi|91791812|ref|YP_561463.1| thioredoxin [Shewanella denitrificans OS217]
    MSDKIVYLSDDSFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAQEYAGRVTVAKLNVDQNNVSPAKYGVRGIPTLL
    MFKGGELVATKVGALSKTQLKEFMDAQI

    >gi|91791815|ref|YP_561466.1| hypothetical protein Sden_0451 [Shewanella denitrificans OS217]
    MTQDMLTGELTPEMLLSLATFADSHQAYQLDEDKIADLSELTQDTEIVTLVGTWCPDCYREVPRLIKILASLNSPHISTR
    YIGLDRDKRDKQGLGAKFEFSRIPTIIIMQNNQEVGRIVERPNTSLEQALLDILF

    >gi|91792110|ref|YP_561761.1| thiol:disulfide interchange protein DsbC [Shewanella denitrificans OS217]
    MKIAQIFSLIAGLALVPMAMSATATDSSAEAKIKQKLQDTLGVNISLFQDSPIEGLYQVLTDRGVIYVTKDASKVFHGNL
    YDLDNGMKNLTEAALLGPRVSMLKPFEKDMLVYKAKNEKHVVTVFTDVD
    CGYCRKLHSQMQGYNDLGITIRYLAFPRSGI
    PSANADEMQAVWCAKDPLQAMTDAKSGENVKASTCAIDIEKQYRLGMAFGVSGTPALILKDGTLIPGYQEPKDLLRTLEA
    KL

    >gi|91792185|ref|YP_561836.1| hypothetical protein Sden_0824 [Shewanella denitrificans OS217]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDISTENIKLSQNNIVDPE
    DRYNQIFQIQVELPDDISDKDREGILRSIDRCTVKKVIQTGPEFNVETVENLSADANAMLMGSSDQDASTFILGKDLPLE
    QTIANMTAMLAELGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGASKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFPLEDDDALPAGMLDDYCLEIYNQDDELQGSHLIDTNSGNRERGICAIPYKRKSDGQTVYFPSNLI
    ENLFLSNGMSAGNNLQEAEVQCLSEIFERAVKRQIIEQEIVLPDVPMSVLEKYPSILAGIKGLEEQGFPIVVKDASLGGQ
    FPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVISWRF
    FSSKHDYDFCEWDFSGTSEEEAKGLFAILEAMGKEVYIAEFTELGASACRMLVPDYSEVYPVDDLIWDNTNKALLYREDI
    LNLHSLSTKALVKLVNRLEESQLDNHTDIRTLIGIVFDENTVWGKLTIIELKIMIYLALGSHEDAIELVGEFLQFNDNTV
    QRGLFYQAVSAVLEVTLDEDLELEHFIESFNRMYGKDVMDNVVGSVNGTVRFYGLTKTSMQLEGIEPHLRLIESYKKLHQ
    ARKIKAGL

    >gi|91792245|ref|YP_561896.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217]
    MYSDKGHYSMKSLLRALTLGAVCTLLSVNVLAKPIAMDELSVMPLMNGQTLPELTLNNIDGKAVNLTELVSQKPTVFFFY
    RGGW
    CPFCNAQMGQLKAIEPKLIEMGFQLVGISPDTPAQLKASVRDNKLDYLLLSDANMAASQAFGLAYFTSAEVTQIYT
    QKMKLENPLWVTPLGEKRLVLPVPAVYLIDTNGLVHFQYINPNFKVRPAPELILTAAKLLNAH

    >gi|91792345|ref|YP_561996.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella denitrificans OS217]
    MADVKELKQVLTGPIINNNPIALQILGVCSALAVTSKMETALVMSLALTVVTAFSNLFISLIRNHIPSSVRIIVQMTIIA
    SLVIVVDQVLQAYAYEIAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLGVGFFRELFGNGSL
    FGIEILSKISDGGWYQPNGLLLLPPSAFFLIGGLIWVIRTYKPEQVEAKG

    >gi|91792346|ref|YP_561997.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella denitrificans OS217]
    MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPANQIIYQGILAPGALAWAGVPDADLS
    FLKFITFIGVIAALVQILEMTLDKYFPPLYNALGIFLPLITVN
    CAIFGAVAFMVERDYNLTESLVFGVGSGIGWALAIVL
    LAAVREKMKYSDVPNGLRGLGITFISAGLMALGFMSFSGVSL

    >gi|91792718|ref|YP_562369.1| antioxidant Tpx [Shewanella denitrificans OS217]
    MILNINGSQFVNKIGQFFKIVLTLSVVFATSANAKEHSVILAGQVTPLLGTMPSLNQPAPSFKVVDDKFTPVSLADFAGK
    TVLISAVPSLDTGV
    CALQTKRFNTEVSQFSDDVVMLTLSMDLPFAQKRFCQLENVDKLKVLSDSVWRNFGEQYGLIIKDR
    GLLARAIFIIDSKGVLRYQELVSDVSQHPDYSQALSTLKQISAQ

    >gi|91792764|ref|YP_562415.1| rhodanese-like protein [Shewanella denitrificans OS217]
    MQHSPGFVAIVETVLDRVTHVSIAQYQENDAWQLLDVREDHEWLLGHLPQAKHLGRGIIERDIEKRFPDKEQALLLYCGG
    GYRSSLAAYNLQLMGYTNVGSLTGGYSAWVQQQLPIVQD

    >gi|91792768|ref|YP_562419.1| rhodanese-like protein [Shewanella denitrificans OS217]
    MNIHSTISVQITRAIQVLLTTLLLLTSPLSLAHDKGHDVSTNAAWEYIEQGATVIDVRTAEEFAAGHLAGATNIPFEDIV
    AGVSKLELAKDSKILLY
    CRSGRRSGIAHESLVAAGYSDTLNGGGYDALAAKPVTAN

    >gi|91792817|ref|YP_562468.1| iron-sulfur cluster assembly protein IscA [Shewanella denitrificans OS217]
    MAITMTPAAADRVKSFLVNRGKGLGLRLGLRTSGCSGMAYVIEFVDTLNDDDEIYTIDDVNIIIDAKSFIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|91792850|ref|YP_562501.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella denitrificans OS217]
    MTDDYERITLAIDFIRNNVGNQPTLAEVAAHIHLSEYHFQRLFSRWAGVTPKRYLQALTLERAKNLLRKQPLSTLNASYE
    VGLSSGSRLYDHFVQIEAVTPSEFKQKGQGLSIVYGYHTSPYGLVFLAQTSRGICQLDFVDMHDAEAPLRHLQQNWCNAD
    IIEDKIQTAKVIDSLFSGSKPDPSPLSLWVRGTNFQLNVWRALLTLQQSEVASYGDIAQLIGKPKASRAVGTAIGTNPVA
    LIIP
    CHRVLRQNGELGGYRWGETRKHAILTRELAHF

    >gi|91792940|ref|YP_562591.1| glutaredoxin [Shewanella denitrificans OS217]
    MRFILFNIKTIVHSDAFLFCCFFSVGLLGYWVFFNSETAPASLKGDYSVYFNDKSNRIIVYSRKSCKYCIKLEAYFVSNH
    IDYLEKDIGESDFARAEYEQLGGYGTPLVLFRDELIIGFRKELILNKLQNADTNPKLSLSTHTVSPR

    >gi|91792989|ref|YP_562640.1| disulphide bond formation protein DsbB [Shewanella denitrificans OS217]
    MSKLVTFSQQRSAWLILMFSALGLEASALYFQYVMLLDPCVMCIYIRVAVLGLILAGLVGSIAPRFWIVRFLGMSLWGVS
    SAWGAKLSFELYQMQANPSPFST
    CSFYPEFPTWMPLDAWMPSIFMPTGMCSDIPWTMMSLSMTQWTLIAFVGYSIAFLLF
    IYPGLLYKKPTNPYS

    >gi|91792996|ref|YP_562647.1| glutaredoxin-like protein [Shewanella denitrificans OS217]
    METVEKIKQQISENPIIVYMKGSPKLPSCGFSSQVAQVMINCGEQFAFVDILQHPDIRAELPKYANWPTFPQLWIEGELI
    GGCDIITDMFQKGELQPMIKATADKFRTEAE

    >gi|91793002|ref|YP_562653.1| arsenate reductase [Shewanella denitrificans OS217]
    MTEISIYHNPRCSKSRETLALLENRGLKIKVVEYLKQTPTADDIAELLRRLNISARQLMRTKETEYKALGLDDISLTEAE
    LIQAMISTPKLIERPIVLANGKAAIGRPPENVLAIL

    >gi|91793069|ref|YP_562720.1| thioredoxin reductase [Shewanella denitrificans OS217]
    MSEARHSNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASAKYLGLPSEEAFMGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILIDRLMDKVANGNIILHLDSTLEEVTGDAMGVTGLRKKSTKDGVVTDLAVAGVF
    IAIGHSPNTGIFAGQLEMKHGYLQVNSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|91793089|ref|YP_562740.1| thioredoxin-dependent thiol peroxidase [Shewanella denitrificans OS217]
    MNTLQTGQSAPAFELNNQDGQPVALTALLAHGPVLVYFYPKASTPGCTVQAQGLRDSFEALDAMKVSVVGISPDPVARLK
    KFHDKQELNFDLLSDEDHAIADAFGVWGEKKFMGKIYDGIHRLSFLIGTDGKVVKLFDKFKTKDHHQVVLDHLS

    >gi|91793128|ref|YP_562779.1| UBA/THIF-type NAD/FAD binding fold [Shewanella denitrificans OS217]
    MHPKSKTATRELTDRQFIRYSRQIMLSEVDEAGQINLLNAKVFVVGMGGLGQQLVQLLAAAGVGTVLFMDFDKVELSNLP
    RQLLYDAHDIGKYKVNAALSKLETAYPDSHFIAVNDYFDECFFNTGHGGNKLEVLLGAMPDLVFDCTDNFIARHKINDLC
    VHHSLVLISAAVANFNGQLFSYIPKPNIPKKSSSNPSVNKSAANFRDTENSAPACYHCLYPRDTQIEQS
    CSHTGVLGPAV
    ATLAAMQAMMGLNVLLSNSPQGGVLHKFDAKKLSWSRYGLSQDPSCPVCASRIDDNRASLAV

    >gi|91793140|ref|YP_562791.1| peptide methionine sulfoxide reductase [Shewanella denitrificans OS217]
    MALATFGAGCFWGVEHFFREVEGVTQATCGYMGGKDTAVTYKEVKTGTTGHAEVVQVEFDPERVSFNALLEFFWKNHNPT
    MLNMQGGDIGSQYRSTIFFHDKEQKQQAEASKLALARSGKWGLRPIVTEIVPVQTFHIAEEYHQNYLEKNNLPSCHLTY

    >gi|91793163|ref|YP_562814.1| DsrE-like protein [Shewanella denitrificans OS217]
    MKRITIIFRKSPIGTSSAREGLDFALLSASFEQEVSLVFTMEAVLHLLPSQNPELSGSKDYIAALKALSLYDIDTVLVCQ
    ASLKALGLRNEQLAIHATAASFDDIKALINHADEIMVY

    >gi|91793171|ref|YP_562822.1| hypothetical protein Sden_1815 [Shewanella denitrificans OS217]
    MSVTLFGIKNCDTVRKARKWLEAENIKAQFHDFRDDGLSQEQLQHWVESLGWETVLNKRSTSFRALTEQQKNELNQASAM
    QLMLEMPTLIKRPVLVKDDKVLLGFKLTDYQAWFAK

    >gi|91793202|ref|YP_562853.1| heavy metal translocating P-type ATPase [Shewanella denitrificans OS217]
    MNRCFHCAEPFIQVPLYTQINGTAQPMCCPGCQAVSQAIMDAGLMSYYQYRSEPGMKQTGLVPEQLSHFSAYDLAEVQQD
    FVHQQDILSTTSLTITGMS
    CAACAWLIEHRLSPIEGIAKVLVNSTTQRAMISWDNSQVKLSEILTQISQIGYQAAPYQQD
    EQEKQHHKDSRTFLLRLGLAGFATMQVMMFALALYTGYFRDLDEAIRDYFRWVSMIFAAPVVLYSAQPFYFSALRSLLSG
    KLNMDVSVSIAIGGAFTASCVATINGTGEVYFESVSMFTFFLLLGRYFEQNARRRASISSNNLHKLVPLTALRLDGNQQT
    EIPAKSLRLGDIILVRPGDAFAADGVVIDGSSSANEAMLTGEQMPVDKNLDCPVFAGTLNVEQPLQVRVTALGQDQLVAE
    IIRLQEIAAANKPAIAFMVDKLARYFSATILTTALITYLVWLQISPDDAFWVTLSVLVATCPCALALATPTAVTCATAIF
    TRLGIITRKAGVFEKLASIEQVVFDKTGTLTRGHIALGALSIIDPQQNKGDVLTEKQMLAIAAALEAGSLHPIALAFSRH
    YDPNVIATEIAHFVAQGIEGKVQGQVYRIGVKAFVQGNMSLTASDSQTTDNTKPTPDTSPCVWLSQNGRLIASIPIQDEV
    RSDAKQAVEALQQANIQVCIASGDSLSHVNALGHTLGIHQVYAEQKPQDKLTLINQLQLSHNTAMFGDGINDAPVLAGAY
    LSVAMGSGSAIAKNSADLILLGDHLSRFNDAIKVAKKANAIIKQNLFWAFGYNLLILPLAVTGHVPPYIAALGMSLSSIL
    VVSNSLRLLRIKL

    >gi|91793218|ref|YP_562869.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella denitrificans OS217]
    MTEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLASAIGMSMATTFVLTLASVLSFLTNEFLLQPFSLEYLRTMSFILV
    IAVVVQFTEMLVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNINEDHNFIESAIYGFGAAVGFSMVLILFSAMRERLAA
    ADVPLPFRGGAIAMITAGLMSLAFMGFAGLIK

    >gi|91793223|ref|YP_562874.1| SoxR-reducing system protein RsxE [Shewanella denitrificans OS217]
    MSQYQEIAKQGLWHNNPGLVQLLGLCPLLAVTATVTNALGLGFATLLVLVGSNMLVSLVRDYVPKEIRIPVFVMIIAALV
    TSVQLLINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNNLAHSAFDGLMMGIGFTCVLVVLGAGRELLGQGTLFEG
    ADLLLGDWAKALVMQVWQVDTPFLLALLPPGAFIGMGLLIAGKNVIDARLKARQPKTQAEPVARVRITKVS

    >gi|91793360|ref|YP_563011.1| glutaredoxin [Shewanella denitrificans OS217]
    MFVIRWILGRIILLLNAVFAPKPLTRTAEAQAHVAQKSQALSLYQYPACPFCVKVRRTMRRQNLPIQTVNAKQDEHKQVL
    VNHGGKLQVPCLRIEKDGQVQWLYESSTIINYLNDEFA

    >gi|91793444|ref|YP_563095.1| glutaredoxin 1 [Shewanella denitrificans OS217]
    MFVVIFGRPGCPYCVRAVELAEKLTEQREDFKFKYVDIHAEGISKADLSKSVGKTVETVPQIFVDEVPVGGCTEFEQYVR
    ENKLLS

    >gi|91793445|ref|YP_563096.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217]
    MSVLVGRPAPDFTAAAVLGNGEIVDSFNLSTAIKGKPAVIFFYPLDFTFVCPSELIAFDHRMAEFTSRGVEVIGVSIDSQ
    FTHNAWRNTPVDKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLVDKEGQVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGEVCPAGWSKGEKGMTASTEGVAAYLRDNSDKL

    >gi|91793454|ref|YP_563105.1| hypothetical protein Sden_2100 [Shewanella denitrificans OS217]
    MSQVVVCALYKFVTLPHYESLRAPLLAVMEASDIRGTLLLAQEGINGTVAGTQAAIDGLLAWFDTQEGLDNIVSKVSFDA
    QMPFYRTKVKLKKEIVTMGVEGIDPRKVVGTYVKPKDWNALISDPDVILVDTRNDYEVQIGTFKHAVNPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVKQEESLWEGECFVFDNRVSVNHNLEKGV
    YDQCNACRMPITEQDKLLPSFVQGVSCPHCIDKIPQEQRQRFIERERQVQLARQRGEAHIGSDVKQVIATRREKKDSLRK
    AQNEQS

    >gi|91793455|ref|YP_563106.1| glutathione S-transferase-like protein [Shewanella denitrificans OS217]
    MTQLFPQLDNQFKPILYSFRRCPYAMRARMALQLSSIQVEIRDIELKNKPPAMVALSPKATVPVLQLGENTVLDESLDIM
    LLALSHPIETLLPSDCATEPASIEIISTIDYQHLMARIQNLAQRNDDLALIAQNDNQFKPWLDKYKYADRFPEQTEGFYR
    QQGEQFITLLEARLSQHAFLSGAQLSLSDIAIFPFIRQFAHVNKAWFDQSPYLKVNAWLTALIDSPLFASIMVKRPVWQW
    VQ

    >gi|91793656|ref|YP_563307.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella denitrificans OS217]
    MQKLTEFEQYVIEQKGTERPFSGEYVNHNAKGVYLCKKCLAPLYKSEHKFNAHCGWPAFDDELPGAVNRHVDADGRRVEI
    TCAQCDGHLGHVFEGEQLTANNIRH
    CVNSVSMVFQPIDDTNAVSNTELATFGAGCFWCVEAIFAALKGVVEVKSGYSGGD
    AHDANYDAVCQGTTSHAEVVQITYSPALIDFESLLEVLFASHDPTTLNQQGNDKGPQYRSVIFCHNSAQVDAANQMISQL
    TQTQVWPKPIVTQVVAFEHFYPAEHYHDDYFAKHGEQPYCQMVVKPKLDKFKQQFADKLKG

    >gi|91793821|ref|YP_563472.1| glutaredoxin 2 [Shewanella denitrificans OS217]
    MASDPALEYTLYHTDGCHLCELAKALVEAAGVDFNHIDICEQPALAERYGISIPVFAQGERELFWPFDAAQLHDFLGV

    >gi|91793875|ref|YP_563526.1| thioredoxin-like protein [Shewanella denitrificans OS217]
    MKLVHSSIRRNPLAEPSSSKPGSSRADSPTISSIPPTAAEAVIPPNWRQRILTACAQVKQRRFWLHLFRDLSLLLIIGFA
    IASYQQRHMLKDIAPSLNMLTTQGSMAFSSYANEPKAKLVYFFGSW
    CPVCRFTSPEVTAIAQDYPTIAIALASGTDLQIN
    QFMTQEDYQFDVINDDNGSISEIWGVQAVPAFYILDEQNKIVFVTSGASSQWGLRLRLWWASL

    >gi|91793882|ref|YP_563533.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella denitrificans OS217]
    MKPKNQIDNKMPAPVIEFLVSSPVGQLSLKASDLGLTHLQVSCLEAVSNTLEVKSSTVLDRDLNAPIEKALVDQGRAHLE
    LTLAQLTDYFAGKRQHFELPLAPKGTEFQRQVWQALSELNFGQVCSYSDIANTISRPKAVRAVGAANGANPIAIVVP
    CHR
    VIGKGGQLTGYAYGLAMKQYLLDLEGVSVNS

    >gi|91793903|ref|YP_563554.1| glutathione peroxidase [Shewanella denitrificans OS217]
    MPNSIYDFTVTDIQGNNISMSSFKGKVLLIVNTASQCGFTPQYKALEELYQSYSAKGFAVLGFPCNQFGAQEKENEAKIS
    QFCEINFGVSFPLFSKIEVNGANAAPLYQYLKNTAKGVLGTEGIKWNFTKFLVDGEGNVLERFAPTTKPETLAPKIAKLL
    S

    >gi|91794030|ref|YP_563681.1| glutathione peroxidase [Shewanella denitrificans OS217]
    MSVSAHGHDPIQSNAEMTASPQAICPEYLRVKARKLHSENIIDLCELTQAKAVLIVNTASNCGFTPQFKALEALHKKYQA
    QGLVVIGFPSDDFFQEENDEAKTAAVCFINYGVSFTMLATSPVRGQDANSVFQHLTAKSASPKWNFYKYLVSPDGQQVQQ
    FNSRVKPSGSKLTQAIETLLKQQGVHSQRVVQ

    >gi|91794166|ref|YP_563817.1| iron-sulfur cluster insertion protein ErpA [Shewanella denitrificans OS217]
    MTEQTDAAMPIKFTDAAAIKVKGLLEEEQNPELKLRVYVTGGGCSGFQYGFTFDEKSSADDFVIEKQGVKLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNASSTCGCGASFSV

    >gi|91794361|ref|YP_564012.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella denitrificans OS217]
    MLDANVKNQLKTYLQNLKRPVELVVSADDSKKSQELTSLAQDIVDSSALVTLSKVQGARTPSMAVINPDNNSQITFAGLP
    MGHEFTSLVLALLHSGGHPLKLDTDVIEQIKQLPGKYQFETYVSLS
    CQTCPEVIQALNMMAAINPNITNVMIDGALFQDE
    VAQRNILSVPAVYLNGEPFSVGAISVVEILNKLDTGAASRKAEALSQKSAFDVLVVGGGPAGAAAAIYAARKGLVTGIVA
    DKFGGQVAETVGIENFISVSKTEGPKLVANLESHVHDYDVDIMANQKANTLVKEGLFKLGLESGASLSSKTILLATGARW
    REMNVPGEQEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANLVEHVTVLEFDVNLRADEVLQRKAKSMGNI
    TIITQAMTTKVLGDGKRVTGLSYTDRKSGESHEVTLAGIFVQIGLVPNTEWLRGVVELTERGEIIVDAKGQTSIPGVFAA
    GDVTNVPFKQIIIAMGSGASASLGAFDYLIRHSDEAVIQQVKASETAASAA

    >gi|91794362|ref|YP_564013.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217]
    MTQSIINSTIKPFKATAFHNGAFVDVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYEKLQAMGVEVYSVSTDTHFT
    HKAWHASSDTIGKITYPMIGDPTGTITRNFGVMIEEDGLALRGTFVINPEGQVKVAEIHDLGIGRSAQELVRKIQAAQYV
    ASHDGEVCPAKWQPGEETLAPSIDLVGKI

    >gi|91794471|ref|YP_564122.1| hypothetical protein Sden_3122 [Shewanella denitrificans OS217]
    MDAPSRSHLASPILVANYRSLPSFMYRDSLPEAAVSPQLLALNTRLLETLEQDLAWFNSSDALEQLSGKTYYGSNLPFAL
    AYSGHQFGGWSPVLGDGRAHVLGQLKTAADELIDVQLKGSGATPFSRGGDGRATLGAVIREYLLSEAMAGLNISTTGSLA
    VIATGEDVWRNGAYPGAILVRTAKSHLRVGSFQYAAVHQGPEAVKTLADFALAQYYPELSHDENPYQALLAQVIKGQAEL
    VAQWMLVGFIHGVMNTDNSSITGETIDYGPCAFMDEFNPNKVFSSIDSQGRYAWGNQGAIAQWNMARLGETLLPLLDSDE
    AKALEIAQAQLGDFNRLFAEHFYQGMARKLSLDASDPELIPFVDSTLQLMTNTRVDFCQFFNALTEYHSTHREQDAGLVA
    LFSTEAFPSLSSTPAQLLQDWLSQWQAKACDSQAALAAMIKANPKFIARNHKVEAAISAAEQNNDYSLFLDMARVLANPY
    VLAEQDKHYQDAPTPDQRVKQTF
    CGT

    >gi|91794729|ref|YP_564380.1| dihydrolipoamide dehydrogenase [Shewanella denitrificans OS217]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPK
    IDLDKLRGFKEKVIGQLTGGLGGMSKMRKVNVVNGLGKFTSPNTLEVTAEDGTVTVVTFEQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKMLVMGGGIIGLEMGTVFASLGSKIDVVEMFDQVIPAADKDVIRVFTKKIKDKFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPSEPVRYDVVLVAIGRTPNGKLLEAEKAGVAVDERGFINVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVISGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDASDGMTKL
    IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKKK

    >gi|91794827|ref|YP_564478.1| electron transport protein SCO1/SenC [Shewanella denitrificans OS217]
    MKKTLKKLMTMLAAVQLYLVLALFGSSVALAQMPVLKGIGGEFSLKSSKGGEVSLSDFKDKVVLMFFGYTNCADICPTTM
    AHISQMMNKLTPEQRSRVQVLFVSIDSDYDTPKHLNKYLAYFDPSFIGLVDEREKIDYVAKLFHADYIKLANDKVTTEFK
    KLSLDDEKQEQKGYLYSHSAKIFVMDTHSRVRGFFYAGTAIEDMRQQVISLL

    >gi|91794858|ref|YP_564509.1| glutathione S-transferase-like protein [Shewanella denitrificans OS217]
    MKLYGDALSGNCYKIQLLLSLLQRDYTWCEIDILKGDTQTLEFLNMNPNGKIPLLELDDGRFLSESNAILGYLAEGSVFV
    PQDPYLKAKVYEWMFFEQYSHEPCIAVARFIQKYLALPKAREQEYQALQAKGHKALAIMERQLSQSEYLVGNVFSLADIA
    LYAYTHVADEGGFDLAQYPNIQAWCKRIEGQSGYRKMG

    >gi|91794888|ref|YP_564539.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella denitrificans OS217]
    MISVGQQLPSATLGQLTKDGMVNHQVSDLFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADEFKAKGVDMIACISVNDAF
    VMKAWGEAQNASELMMLADGDASFTKALGLEMDTAAFGGVRSQRYAMVIENGKVTMLNVEAAKSFEVSKAEAILAAL

    >gi|91794912|ref|YP_564563.1| periplasmic protein thiol [Shewanella denitrificans OS217]
    MKKLILFVPLMIFLGMGFFLYKGLFLNPKVLESALEGKLVPYFELEQLEQSDKVITNKDLIGKVAMLNVWGTWCPACKYE
    HPYLMVLARNKQIPIYGINYRDERDMALEELKLQGNPYEINIFDKDGRLGLDLGVYGAPESFLIDHQGIVRYRFAGPIDQ
    RIWADTLYPIVKTLQEQAVKDGAS

    >gi|91794939|ref|YP_564590.1| glutathione reductase [Shewanella denitrificans OS217]
    MTQEFDYICLGAGSGGIASANRAAMRGAKVLLIEAKQVGGTCVNLGCVPKKVMWYGAHIADAMNLYAKDYGFDVTVNKFD
    WSTLVASREAYIGRIHDAYGRGFANNKVTLLEGYGRFVNGNTIEVDGKHYSAKHILIATGGAPSFPNIPGAEHGIDSDGF
    FGLNEQPKRVAVVGAGYIAVELAGVMHALGSETHLLVRKHAPLRNFDPILTDALVEAMALDGPTLHTHSVPKEVLKNADN
    SLTLVLENGNSVTVDCLIWAIGRAPSTNNIGLEHTQVERDEKGYIITDAQQNTSAEGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFGAMPDAKMDYNLIPTVVFSHPPIGTMGLTEPEAVTQYGADKVKVYSSTFTSMYTAVTAHRQACKMKLVCAGDN
    EVVVGIHGIGFGMDEILQGFGVAMKMGATKADFDSVVAIHPTGAEEFVTMRG

    >gi|91794964|ref|YP_564615.1| rhodanese-like protein [Shewanella denitrificans OS217]
    MSAFTHLSINQLIHMTQESSDVQIVDIRDAASFQAGHIANSINLNNENISHFIADADMDKPLVVVCYHGMSSQGAASYLH
    EQGFDAVYSLDGGYSAWSLANS

    >gi|91795036|ref|YP_564687.1| heavy metal translocating P-type ATPase [Shewanella denitrificans OS217]
    MSQILQIQITGMSCTSCVGRVEKALKAVQGVMSANVNLATEMASIEGTASLAELVEAVEGAGYKVPTKTASYGVGGMSCA
    SCVSRVENAMKSLPQIQHAQVNLATERLSVTYVGSLTEVEVSASLIQAGYSLEALQGEQASAEGTSASEQAFYHTDWFPV
    LGASLLTLPLVLPMFGMLFNKEWMLPAVWQWLLATPVQFYFGGRFYRAAWGALKAKTGNMDLLVAIGTSAAYGLSVYLWW
    THTGHHGEPHLYFESSSAVLSLVLLGKYLEHRAKRRTTDALRALEDLKPSSARVWRNDKWQQVLASTVVTQERVQITPGE
    RVPVDGVIVSGASHLDEALISGESIPVSKTKGDKVTGGSVNLDGVIEVEATSVGTESTLAKIIRMVEQAQGAKAPVQALV
    DKVSAVFVPVVLVIALITLLSWGLVVGDWQLGILNAVAVLVIACPCALGLATPAAIMAGTGTAARFGILVKDATALEQAK
    AIDMLVFDKTGTLTEGKPKLSQFSAFIGSESALMQQAFALQQHSEHPLGKAIVEQAKAMELEPLSIADFSVVAGKGVQGR
    VEESELFMGSSLWMEQLGLSLPLNRIEVEGASVSWLARTVAGETELLGLFCFRDELKPHAKRAVKQLKQMGIKVAMLTGD
    TQASAELVANELGLDLYYAQVLPDDKAKHVQAFQSQGYRVAMVGDGINDAPALAQADLGIAMATGTEVAVSASAMTLMRG
    EPNLVASALTMAKLTYTKIKQNLFWAFIFNIVGIPLAALGYLNPIIAGAAMAMSSLLVVSNALLLQHWKPEES

    >gi|91795042|ref|YP_564693.1| rhodanese-like protein [Shewanella denitrificans OS217]
    MQAYIEFFQANPILSLAWVGLFSALVVTVIKASTSKVNNISHQELTQLVNKQNAKVVDVRGKEDFRKGHIIDALNVTLAE
    IKNNQLTALEKYKASPIILV
    CKAGMTSSQAAQLLVKQGFENIHNLKGGIDDWQTANLPLVKSKK

    >gi|91792583|ref|YP_562234.1| OsmC-like protein [Shewanella denitrificans OS217]
    MGFQLTVSWDNSVQVADDFSRDHKITYGSGQVIHASSAPEYKGSEDKINPEENLLAALSSCHMLTFLAIAHLKRLPVASY
    VDEASADLGKTESGKLAVTKMILNPKVVFAEGVNVDHETLAKMHDKAHVN
    CFIANSLRSEVEINF