Shewanella baltica OS223 uid58775

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217971264|ref|YP_002356015.1| Rhodanese domain protein [Shewanella baltica OS223]
    MQEYIEFFKAHSMLSLAWVGLFVVLVASIIKSSMSKIKSISHQELTIMVNRQDAKVVDVRSNDEFRKGHIVDAINVTLAD
    IKNNQISALEKFKASPIILV
    CNAGMTSSQAAQLLSQQGFENLYNLKGGMGEWQAANMPVSKSKR

    >gi|217971318|ref|YP_002356069.1| formate dehydrogenase, beta subunit [Shewanella baltica OS223]
    MASQDIIRRSGTSAVTPAAKGRNSSEKVAKLFDATKCNGCKACQVACSEWNDLREEVGTFQGSYQNPMSLSGQCWTLMEF
    HEVMESNKLRWQFTHSACMHCADPACLTACSTSGAIIQHANGVVDFDSDKCIGCGYCASACPFDVPKIDPKDNKAYKCTM
    CSDRLAVGLEPSCVKSCTTGALRFGTREDMLFYSQKRVEELKERGFAKAGLYNPEGVGGTGMMMILHDINQPESYNMPDN
    PQIPLSLTLWQDWVKPLGTMGILATAAVACLHKITVGRNIVEEDQPGYQPPEEEAKQEEEGDK

    >gi|217971324|ref|YP_002356075.1| putative inner membrane protein [Shewanella baltica OS223]
    MTWQQFKQEYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEFTRWGGHLMQLFGAEPETWGYFKVIGLQGSPLDRID
    GMMIIGMFGGCIAAALWANNVKLRMPQSRIRIAQALIGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGARFTLLPMFRIPVKLKKVNKATSIKQDENQARRRFRIGMLVFVGIVGWGLLTMFNAPKLGIAMLCGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVPPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHFWWVGLGNVLGSTLLAYYWDDLAQPLATNWDKVNLLTSFGDRGGLLLTYVLLGLSFGAMLLWEKRFFARKAKRDEQLL
    AEAA

    >gi|217971347|ref|YP_002356098.1| molybdopterin biosynthesis protein MoeB [Shewanella baltica OS223]
    MNVPEDILSDSELLRYSRQISIKAMDIDGQEHLKQAKVLMIGAGGLGCAASQYLTVAGIGELTLVDFDHVELSNLQRQVL
    HQDANVGQPKVESAKQSLSQLNPFIKINIINAVLDDHEIDALVADHNLVLDCTDNVSVREQLNLSCFKHKVPLVSAAAIR
    MEGMVTVFDYHSETPCYHCFSALFGEQQLS
    CVESGILAPVVGMIGCLQAVEAIKVITGMGKTLAGRILMIDAMTMEFREM
    KLPKHSNCSVCGTQA

    >gi|217971535|ref|YP_002356286.1| Rhodanese domain protein [Shewanella baltica OS223]
    MFQSLLAKLSGSHSGEKCWQLIEQGARVIDVRSPEEFASGHLPQAINVPLPTLDQWLHQVDNKQHPFVLYCGAGIRAQKG
    CDILKANGFGCVVNGGSLKDLVCCQPS

    >gi|217971851|ref|YP_002356602.1| thiol:disulfide interchange protein precursor [Shewanella baltica OS223]
    MKKLLSLIFTSLLLLTPLAHSEGVFGNKFDFMKSEPELMPVDQAFAFDFKQEGNQVKLNWVIADGYYMYRDKLKFTVNGA
    ELGTVALPKGKPHEDEYFGEQEVYYTYVDIPVALKQADENATLTVTFMGCAEGKLCYPPTKRDVVLKAIAANDGLIAGAE
    ASESTAAAKPASTESASIEPSTADKANTQPITQQDTLSQMLSNDSLIWTLVIFFGLGVGLALTPCVFPMYPILSGIIVGQ
    GQKLSTAKAFTLSMAYVQGMAITYSILGLVVASAGLKYQAALQHPAVLVVLAILFFVLSLSMFGLYDLKLPSSWQEKMNS
    VSNNQKGGNLVGVFLMGVISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGAW
    MDIIKTVFGFLLIAVSIVMLGRIWTGVVSDVLWSLWGVSFTGYLMHQNKLSPFNWKQTVRSVLLTLTLLASFSYGFQAVM
    GHFGFNHNPVGTAATTEEAHGFKRIKSIEDLEQEIAAATAQGKPVMLDLYADW
    CVACKEFEAITFKDADVLARMNKIVLL
    QADVTKSDKVDVALLEKYNVLGLPTLLMFNEQGEQREDLRVTGFMGPKDFAAHLDHLVK

    >gi|217971869|ref|YP_002356620.1| thioredoxin domain-containing protein [Shewanella baltica OS223]
    MHTDIIMHIDSPEMLESMLTEHAAVLLLFGAPNCGVCQTLKPRIAELLAQEFPLMQMAYIDCQAQSEIAASHNVFTLPVV
    ECVFYGKTFGRFSKVFSLADIRVALARPYGLLQKAPVSD

    >gi|217972081|ref|YP_002356832.1| transcriptional regulator, AraC family [Shewanella baltica OS223]
    MSDYDRIASAMAYLVERAIDQPSLEEIAAHVHLSPYHFQRLFCRWAGTTPKRFLQVLTLERGKGLLNHSRSLLDVSHELG
    LSGSSRLHDHFVQLEAVTPGEYKNRGKDVQIEYGVHPTPLGPMFVAVTLRGVCRAAFMDFNSMEELLDDLHNDWPLSSIS
    ENLASTRHAIDAFFSSDTASGQGPLSLHVTGTNFQIAVWRALLKIPPGAVASYAEVARALGAPKSARAVGNAIGANPVAL
    LIP
    CHRVIQQSGALGGYRWGPTKKLMVQTWEKMREDPVVL

    >gi|217972154|ref|YP_002356905.1| DSBA oxidoreductase [Shewanella baltica OS223]
    MIKQLALAVTLAIAPLSSFAANFVEGTHYTQISAKAPSSEPKLTEFYSFYCHNCFNMETNYLPDIKANLNKQISFDNKHV
    DFMNSDIGTEVMRSLAVIQSLDNKEALTHAMFTAIQGAEGANGHDHSAPGHQHEPQINSRDDIKKVFAQFGVDAAKYDEL
    ADSKSTDEKLALWRIQQNEFKIDSVPAFIVNDKYAVNLNSIKTLDELIGLINYLAVEKDAAAAKTSSGGSLGWLFLVFAA
    AIGVTRQQRLS

    >gi|217972456|ref|YP_002357207.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS223]
    MSIILKTLCLAGTLLLTSFTTLAQPIARDEFSISPLLNGQQIPKVNLQDIKGKTVDLAELTQQKPTIFFFYRGGWCPFCN
    NQMGQLKAIEPELLKMGFQLVGISPDTPAQLKASAAKNELKYLLLSDEKMLAAQAFGLAFYTSEKVTEIYTSRLHVDNPM
    WTTPEGAKRLVLPVPAIYISDDKGLIHFQYVNPNYKVRPAPKLILTAASLVGSQE

    >gi|217972484|ref|YP_002357235.1| mercuric transport protein MerT, putative [Shewanella baltica OS223]
    MAAAVVAAVASSLCCIAPLIYLVFGVSAASLSGIEQLSWLQVPMLILSTGLILMGFWRLYFAKKLLCTATLSRTQMVWLY
    WLTVPVVLAFQLYPFVLPWLLEVFE

    >gi|217972485|ref|YP_002357236.1| Heavy metal transport/detoxification protein [Shewanella baltica OS223]
    MKLVLFLALSLCSASSWAANVLVTLDVKGMTCPLCVTVVNKALRKTDGVIKAKASLKTEQAIVTVSEDFNLDNLLKAVDE
    TGYKGSINKIEKQA

    >gi|217972521|ref|YP_002357272.1| glutathione peroxidase [Shewanella baltica OS223]
    MKKLPMIFAMTASLMSVGAMAATCPEYLNLEVRKLHSEETVNLCELTQGKPVLIVNTASNCGYTPQFKALEALHENYKDK
    GLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLSTSAVRGSDANSVFKYLAEKTGAPKWNFYKYVVSGDGAVVQQF
    NSKVKPDSEELKRAIESVL

    >gi|217972529|ref|YP_002357280.1| Redoxin domain protein [Shewanella baltica OS223]
    MQKYVSFLAASCIYGLVLMSPNVLASEKNQVLMGEKTVTLEGKLPKLSQMAPGFKVVDDHFAPVMLSDFKGKTVLISAVP
    SLDTGV
    CALQTKRFNSEVGHFSDDVVMLTISADLPFAQKRFCKVENVDKIKVLSDSVWRDFGEKYGLLIQDYGLLARAIF
    IIDAEGKLQYQELVPNITEHPNYDAALEALKTIQAQQ

    >gi|217972735|ref|YP_002357486.1| methylated-DNA/protein-cysteine methyltransferase [Shewanella baltica OS223]
    MKHAIRQLSQAPSIAEYQPCAVDTFISPAGILQLNANAYGLSHLTVVGSDRTEIALAKASEDALNQAKAHIRETQTQLAN
    YFAGERVEFDLKLAPKGTEFQRDVWQALLNLDYGQSCSYGQIAEQIGRPKAVRAVGAANGANPIAIIVP
    CHRVIGKNGKL
    TGYAYGLAMKQQLLTLETDKHCLDI

    >gi|217972752|ref|YP_002357503.1| Rhodanese domain protein [Shewanella baltica OS223]
    MPHPSAFSALVDAILPNITEVTIEAYQADDSWHLVDVREDREWLQDHLPQAKHLSRGILERDIEARFPDKHTPILLYCAG
    GARSALAAHNLQLMGYTRVASLIGGYKGWVQRQLPVVQD

    >gi|217972758|ref|YP_002357509.1| Rhodanese domain protein [Shewanella baltica OS223]
    MTHTLVTRGQSLMRLALLSLQSLVLMPLLLMPMMASAADQDPVIAWDKIAAGAMVLDVRTPEEFAEGHLANAVNIPFEQV
    AEEFAKRGIAKNAPVVLY
    CRSGRRSSIATEALVAAGYTQTYNGGGYSTLVEAQKTPAK

    >gi|217972810|ref|YP_002357561.1| DSBA oxidoreductase [Shewanella baltica OS223]
    MDKTIIIDYYTDILCVWAWIAQKRVDELNKKLGNNIELQYHYLDVFGDVPTKITTQWKSKGGFMGFAEHIQQSVSAFEYA
    DINPKVWTQVRPTTSANAHLMLKAVEITYDKKKSIDMALTFRTAFFVDGLDIGNLVVLSDLVNANGLDLNAINTSIRDGS
    AMASLMSDYQQSKRQNINGSPSFVLDGGRQTLYGNVGFDVILANIEALLKHSTDEASWC

    >gi|217972886|ref|YP_002357637.1| DSBA oxidoreductase [Shewanella baltica OS223]
    MSVFNRVRPIAALACGLMLSASFALQAASFEEGKDYVTVAGITEAQKPVLREFFSYNCPHCYKQEPLMDLTVQLLGKDVA
    FERTPVGAGRPAWELSQLAYYVAQKLKMTKQTHGAIFKQIHEKGEQFTAPEQVKAFFVAQGAKVDDVDAAMNSVDAKFTL
    MNYDSQAELAGIKGVPSLLVNGRYMLTSTAHTPEELAALVKFLAAK

    >gi|217972967|ref|YP_002357718.1| thioredoxin-dependent thiol peroxidase [Shewanella baltica OS223]
    MNTLTAGAKAPQFTLHDQHGTSVSLADSLKQGPVLVYFYPKAATPGCTVQACGLRDSKAALDSHNVTVFGISPDPVAKLA
    KFAEKQALNFTLLSDEDHSVADAFGVWGEKKFMGKTYDGIHRLSFLINTDGTIAHVFDKFKTKDHHEVVLAQIAG

    >gi|217973139|ref|YP_002357890.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica OS223]
    MAITMTPAAADRVRSFLVNRGKGVGLRLGLRTSGCSGMAYVLEFVDSLNDDDEVFDIEDVKIIIDAKSLIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|217973156|ref|YP_002357907.1| Glutathione S-transferase domain protein [Shewanella baltica OS223]
    MALAVLYTFRRCPYAMRARLGLLLAQCNVEVREITLKAKPAQMLAASPKGTVPVLVLANGEVIAESIEIMRWALTQADPL
    DLLCQQSPVIEDKMAQLIAQNDQQFKPWLDRYKYADRYPKQTQADYYQQASHFLTQLEACLGQHSFLVADTPRLADYAIV
    PFIRQFAAVDLKRALSDDFPRLAAWLETLISSEIFIRAMEKYVIWDASHSPTCLLGDM

    >gi|217973157|ref|YP_002357908.1| hypothetical protein Sbal223_1981 [Shewanella baltica OS223]
    MTKVVVCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNGQNGLDNIVHKLSFDD
    EMPFYRTKVKLKNEIVTMGVEGIDPLKVVGTYVKPQDWNALISDPDVILVDTRNDYEVQIGTFKNAVNPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVKAEESLWEGECFVFDNRVAVNHDLKKGQ
    YDQCNACRMPITEVEKQSPAYVQGVSCPHCIDKISDEQRKRFVERERQVNLAKARNEAHIGSDVNQVIEARREKKEAQRR
    LAAEKNNAKKSQVL

    >gi|217973169|ref|YP_002357920.1| arsenate reductase and related [Shewanella baltica OS223]
    MTLYGIKNCDTVRKARKWIENHQLPVHFHDFRDDGLRQEDLEFWCNTSGWETVFNKLSTSFRALSDADKIDIDQAKAIQL
    MLAQPTLIKRPVLVVGEHVLIGFDEAAYKRVFSL

    >gi|217973191|ref|YP_002357942.1| alkylhydroperoxidase like protein, AhpD family [Shewanella baltica OS223]
    MSERIPRQQIYQLQPALANALLSLDKAAGDSHFSPLLVHLVKLRASQLNGCAFCQRRHAEEARSDGEEQLRLDLLAAWHE
    VDGIFNERERAALLWTEILTQVATAPVHDSQYAALAEHYSEKEIVDLTSLIIAINGWNRIAIAFHLQPI

    >gi|217973202|ref|YP_002357953.1| UBA/THIF-type NAD/FAD binding protein [Shewanella baltica OS223]
    MSKNPPLAHAEVLCGHIHSDNEHCGHALRDADFIRYSRQVLLPEVGEAGQLQLADAGVAIIGLGGLGQLAAQYLACAGIG
    RLTLIDMDKVEVSNLPRQLLFNDADIGLNKARVAKQKLNGIAPHCTVTAYETVFSAATSAHHFAEVLQLKQQGKRVLVLD
    CTDNFATRQAINHSCIEAALPLVSASIAAFSGQLFAVDQMRFPYGGCYHCIFPAQTRVSQS
    CSTQGVLGPSVGVMASMQS
    LVAMQLLLNVDSCDEPKSALLGRFWRFDAKSLSWTAAILTRDPHCDVCGPKEVRSSSDKPSKL

    >gi|217973360|ref|YP_002358111.1| thioredoxin reductase [Shewanella baltica OS223]
    MSQVRHCNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASARYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVANGNIILHLDQTMDEVVGDAMGVNGLKMKSTKDGSITDLAVAGVF
    VAIGHSPNTGIFEGQLEMNHGYLKVQSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|217973390|ref|YP_002358141.1| heavy metal translocating P-type ATPase [Shewanella baltica OS223]
    MTYPSCFHCQEPVLTGQQFVTRINDRDEIMCCPGCQAVSQAIVDAGLLSYYKFRTEPGSKQSALVPEALTQFSAYDLPEV
    QQDFVHSEDNIESVSLSIDGIT
    CAACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPY
    QVDEQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLVNDN
    GQEEIPAKKLRLNDVILVKPGEMIAADGMVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQL
    VAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPLIKHVVFDKTGTLTCGTLSIGQTQCMADLTKTQALAIAAALETGSRHPIAAAFTVFADNA
    LVAEEVHHKVGFGVRGRIDGTDYLIGNAVFTGASIDTRDPAQKIWLARSCNEQLEVLASFEIQDNIRQDSKATVEMLKQQ
    GCRISIASGDSSGHVHQLAKELGIDDVHSGLMPADKLALVTRLQQHTRVAMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVSVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV

    >gi|217973408|ref|YP_002358159.1| peptide methionine sulfoxide reductase [Shewanella baltica OS223]
    MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVKKGKTGHAEVVQVEFDPALVSYEDLLEVFWKNHNPT
    SLNMQGGDIGTQYRSTIFFHDSEQKAAAEASKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY

    >gi|217973444|ref|YP_002358195.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS223]
    MNEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIFGFGAALGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|217973449|ref|YP_002358200.1| electron transport complex RsxE subunit [Shewanella baltica OS223]
    MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDG
    ADQLLGPWAKSLTIHLWQVDTPFLLAMLPPGAFIVMGLLIALKNVIDKKVKERQPQVAAEPSVTRARITKVG

    >gi|217973570|ref|YP_002358321.1| Redoxin domain protein [Shewanella baltica OS223]
    MKKILLLLSLMAAGVQAAPSLDHQVFNAQNQAVSLSEFKGKVVYVDFWASWCGPCRKSFPWMNEIQKKYQDQGLAVVAIN
    LDTDNELAQEFLKQVPANFSVRFNPEGDVARSFDLLGMPSSFMFNRQGQLVQHHVGFYADKTAEYEQELVSLLKE

    >gi|217973602|ref|YP_002358353.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella baltica OS223]
    MNKLTDFERYVIEEKGTERPFSGEYYDHDAKGLYLCKKCHAPLYRSEHKFNAHCGWPAFDDEIAGAVTRHVDADGRRTEI
    VCSQCGGHLGHVFEGEMLTPNNIRH
    CVNSVSMVFKGMDDAVEPASNSFATFGAGCFWCVEAIFQSLKGVVNVTSGYAGGD
    AHDADYKSVCSGQTGHAEVVHVEFSPEEIDFTTLLQVFFESHDPTTLNRQGNDKGPQYRSVVFAHNAEQIEQTTAMLTQL
    AAAKVFDAPIVTQVSAFETFYPAENYHNDYFALHGEQPYCQMVVRPKVDKVKALFARLQKA

    >gi|217973662|ref|YP_002358413.1| arsenate reductase [Shewanella baltica OS223]
    MTQATIYHNPRCSKSRETLALLEQQGCDITLVEYLKTPPTAEVIGDILAKLGISARQLMRTKEAEYQALELADTSLTEQQ
    LIEAMVNTPKLIERPIVLANQRAAIGRPPENVLAIL

    >gi|217973668|ref|YP_002358419.1| glutaredoxin-like protein [Shewanella baltica OS223]
    METVEKIKQQITENPIIVYMKGSPKLPSCGFSSQVAQIMINCGEQFAFVDILQHPDIRAELPKFANWPTFPQLWIEGELI
    GGCDIVVDMFQKGELQPLIKAAAAKIKTEE

    >gi|217973675|ref|YP_002358426.1| disulfide bond formation protein B [Shewanella baltica OS223]
    MTVITRFAHSRSSWFILAGTALGLELSALYFQHIMKLDPCVMCIYQRLAVFGLLAAGLIGMTAPKYRIVRILAAIVWAVS
    ATWGLKLALSLVDMQTNPSPFST
    CSFLPEFPAWMPLHEWFPSIMMPTGMCTDVPWVFMGVTMAEWMVVAFSGFLVAWLLF
    IVPILSGSNKPSLYK

    >gi|217973700|ref|YP_002358451.1| glutaredoxin 1 [Shewanella baltica OS223]
    MFVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVR
    ENNLLD

    >gi|217973712|ref|YP_002358463.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS223]
    MSVLVGRQAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMNASTEGVAAYLSENASSL

    >gi|217973831|ref|YP_002358582.1| glutaredoxin [Shewanella baltica OS223]
    MFIIRWILGRIILFLNFVFSPKKRQRPLAEQQQIDTQTQALALYQYPACPFCVKVRRAMRRQGLNIVTHDAKKAPHKDEL
    IAQGGKQQVPCLRIEENGQVQWLYESKEIINYLDQRFV

    >gi|217974004|ref|YP_002358755.1| copper-translocating P-type ATPase [Shewanella baltica OS223]
    MSMTRLYVANMNCAGCVAKIEKAFAAQAGVEARVNLADKQVTVEGKMSADTALTVMENAGYPAQVVVDAKVAAEEKRLED
    ATEYRLRMRQAIAALVVGVPMMLWGLLGGEMMINSPAMQLGWGIMGLVTLALLVTTGGHFYQGMWRALKAKTTNMDTLIV
    LGTSTAWAYSMLVVIMPSAFPMDTRHVYFEASVMILGLINLGHGLELKARGKTSEAVQRLLGLQSTTAIRITDKGDEKVE
    ISQLKLGDKLRLRPGDRVALDGEVETGQSLLDEAMLTGEPIPVLKNRGDSVSAGTVNGNGSLVYRVTAGQEDTKLAKIIA
    LVQQAQTSKLPIGRLADRISAVFVPTVVAIALLAAAIWYFVGPAPALSHALVVLTSVLIIACPCALGLATPMSIMVAVGR
    AAQMGVLVKNGEALQTASKVDCVVLDKTGTVTLGKPQVTDFNLVQTLNDADKEALLGEIASLEQHSEHPLAGAIVSYAKE
    SLSQLPDTQAFTNHQGKGIEGKVDGVSLAIGNLALMTALDIINSDGSALDPKATLSFANQGKTPIYIAKAGKLVATIALA
    DPIKPDAKDAIAAMLQRGIRVVLLTGDNPQTAQAVADQVGITEVIAGVLPEQKQQHVLDLQKQGHVVAMVGDGINDAPAL
    MSADVGIAMGSGTEVAIESADITLLSQQLIVIANLLALSRATITNIKQNLFGAFVYNSLGIPVAAGVLYPLTGMLLSPVI
    AGAAMALSSLTVVTNANRLRRQKL

    >gi|217974029|ref|YP_002358780.1| ferredoxin-type protein NapF [Shewanella baltica OS223]
    MTQSINHSRRNLFRCRKDNALRPPWVRDDIEFTDVCTRCSACVEVCETQIINKGDGGFPEVSFKDNECTFCTLCAKACPE
    NIFDLTQTPWSYHAHIQQSCLTFQGIWCQSCKDACEPRAISFVFNIGQAPRPQIDLELCTGCGACVAPCPSKAIEITRPT


    >gi|217974133|ref|YP_002358884.1| Glutathione peroxidase [Shewanella baltica OS223]
    MTTNIYSQSATDIQGNAVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQGLVILGFPCNQFGAQEKADEQGIQ
    AFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAPGVLGTQGIKWNFTKFLVNRQGEAIERFASTTKPEALESKIAALL
    K

    >gi|217974156|ref|YP_002358907.1| thiamine biosynthesis protein ThiI [Shewanella baltica OS223]
    MKFIVKLYPEIMMKSKPVRMRFTKMLETNIRNVLKKVDEDAKVQRQWDRIMVMVPKDKPELAQAFGERLACIPGIAHVVQ
    VDEYSFESVDDIYQQVLPVYRDQLAGKTFCVRVKRTGDHDFNSIEVERYVGGGLNQFTDALGVRLKNPDITVNLEIERDN
    LYMVTKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKKGARTHYCFFNLGGAQHEIGVKQVAYHLWKTYGESHKVK
    FISVPFEPVVAEILERIDNGQMGVVLKRMMMRTAARIADRMGIQALVTGESLGQVSSQTLTNLNVIDRCTELLILRPLIA
    MDKQDIINESRKIGTEDFAKSMPEYCGVISQKPTVKAVLAKVEAEEKKFSEDLIDQIIAQSVTIDIREIAEQMDTRITET
    ETVASIDTNQVVIDIRAPEEEESKPLQIEGIEIKRIPFFKLATQFADLDKQKTYLLY
    CERGVMSKLQALYLIEQGYTNVK
    VYRP

    >gi|217974306|ref|YP_002359057.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica OS223]
    MTDQADTAMPIQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNDGDFTIEKQGVLLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|217974355|ref|YP_002359106.1| Rhodanese domain protein [Shewanella baltica OS223]
    MEYPLVSTQWLEAHLTDPHLLLLDASMETVIGKEPLVYDEPICIPRSRRFDLENVFCDKTSTQIHALPTFEQFSQGIAQL
    GIEADSVIVIYDNQGIYSSPRAWWTFKVMGFNRVYVLDGGLPQWIEEDRITSSRYQAEGVDYGQTDIDTLAGVLQYHPER
    VMDAEAVLSRIEDADTAIVDARGAPRFLGQVSEPRPGVRSGHIPRSVNLPFAQVLDGNKIKTTSELQAIYQGLAADKSAR
    IFS
    CGSGITACILILASVAAGHTHPILYDGSWADWGSRTDLPIEC

    >gi|217974486|ref|YP_002359237.1| thiol:disulfide interchange protein, putative [Shewanella baltica OS223]
    MSTITLISIVILCLLIGAILLLIWQRQKGKTIPLAVIFVLGFFALGLGAIIGFVHKGEDYQAYQKLQWHTLAPEQIAPLV
    AQGYTVFVDITSDW
    CTICQTNKAEVTHREQIVNALMADNIILMQGNWSEANKTIESYMRHEGVPGTPYNKIYGPSAPNGI
    LLPSKLSMSDVLNGLAAAQTNRS

    >gi|217974518|ref|YP_002359269.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS223]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPANQVIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYKLGESVVFGFGSGVGWALAIVL
    MAGIREKLKYADVPNGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|217974519|ref|YP_002359270.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS223]
    MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQLLQAYAYQISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSL
    FGVEILHKISDGGWYQPNGLLLLPPSAFFLIGVLIWIIRTYKPEQVEAKG

    >gi|217974583|ref|YP_002359334.1| OsmC family protein [Shewanella baltica OS223]
    MKTLYETRATAKAGRQGQVSTDDGLLDVALAYPKAMGGSGLATNPEQLFAAGYAACFSNAVLHVAKIGKVDITEAPVSAV
    VGIGANDAGGFALAVALEVTLDLPQEAAEALVRHAHQV
    CPYSNATRNNIDVKLSVNGVALG

    >gi|217974584|ref|YP_002359335.1| hypothetical protein Sbal223_3428 [Shewanella baltica OS223]
    MTKYLSKISLFCSLLFLFAFSIPSWAETAPASSADQTWHYVNAQGELKIKLYFFWSKTCPHCAEAHPFIDSLPQKYPWIE
    LESHMVSAPGVQDIWQTIAAKTTTEARSVPYMASCEKAVVGYSSEAVTGEFLVNRLKNCYLSLGGQLSEADLPTKGVVST
    SASTETDAPLFGTCGTDTGEGTCDATSLGDARVPSSMQSEVQPVELPLVGVVTPETMSLPLLTLVLAGVDAFNPCAFFVL
    LFLLSIMVNAKSRSRMLLVGGIFVFFSGFIYFLFMTAWLNIFQLLGAGSDGGMIILAAGCLALIAGVINIKDYFFTKGEV
    TLSMSAENRTSLIKRMGKLSNSSSLGALLIGSTVLAVLANAYELLCTAGFPMIYTSVLSMHNLPDIERYMYLVLYNIVYV
    IPLAIIVIVFSATLGKRKLTEKEGQALKLMSGVMMLGMGIALVIDPTALQNVALALGLILGSLGITAIIVIGRKLFSAKA
    K

    >gi|217974600|ref|YP_002359351.1| peroxiredoxin [Shewanella baltica OS223]
    MTQSIINSTIKPFKTTAYHNGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADYYEQLKGMGVEVYSVSTDTHFT
    HKAWHDTSDTIKKINFPMLADPTGTISRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIGRSAQELVRKIQAAQYV
    ATHDGEVCPAKWQPGDDTLAPSLDLVGKI

    >gi|217974601|ref|YP_002359352.1| alkyl hydroperoxide reductase, F subunit [Shewanella baltica OS223]
    MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERTPAMTVINPQLNTQISFAGLP
    MGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFETYVSLT
    CQNCPDVVQALNMMAAINPNITNVMIDGALFQDE
    VASRNIMAVPSVYLNGEVFAAGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELELASGAKLRSRTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNI
    KIITQAMTTEVTGDGTRVNGLNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIVVDTRGQTSIPGVFAA
    GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA

    >gi|217974604|ref|YP_002359355.1| thiol:disulfide interchange protein DsbC [Shewanella baltica OS223]
    MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMTNRGVLYISRDGSKLFHGSLY
    DLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHVVTVFTDVS
    CGYCRKLHSQMADYNKLGITVRYLAFPRAGVP
    SANADEMQAIWCAKDPLKAMTDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
    Q

    >gi|217974645|ref|YP_002359396.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS223]
    MEHYINLFLQATFIDNMALSFFLGMCTFLAVSKKVSTAFGLGVAVIVVMTLAVPLNQIIYVKVLAPGALSWAGLPGIDLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFGESVVFAMGSGLGWAVAIVL
    LAGLRERMKFNAIPEGLQGIGITFITTGLMALGFMSFSGISL

    >gi|217974646|ref|YP_002359397.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS223]
    MSNTLSMRDMLTGPVFANNPVAMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPTSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVGLIITN
    CIIMGRAEAFAMKYPPHLAVVDALGNATGYGLILISVAFVRELLGTGNL
    FGHSVFTTIENGGWYLPNEMFKLPPSAFFLIGVLIWTINVIQRKRG

    >gi|217974753|ref|YP_002359504.1| protein of unknown function DUF181 [Shewanella baltica OS223]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISDKDREGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPNGASSTFILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFALEEDDALPAGILDDYCLEIYNPDDELCGSHLIDTNSGNVKRGICAIPYTRKSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRF
    FSSKFDYEFCEWDFSGTSEEEASGLFGILEELGKEVYIAEFTDLGASACRILVPDYSEIYPVDDLIWDNTNKALAYREDI
    LNLHSLSTKQLVNLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHEDAIELVGEFLQFNDNTV
    KRGLFYQAMNAVLEVTLDDELELDDFIHNFNRMFGKEVMDNVVGSVTGKVRFYGLTKTSMQLDGIEPHLRLIESYKKLHQ
    ARKAAKALN

    >gi|217974827|ref|YP_002359578.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Shewanella baltica OS223]
    MDKSKRQFLGKMASVSVGAALIPVVQVYAQDDKRSPQVHSASEGQVGKRYGMVIDLRRCVGCQACTVACTIENQPPLGQF
    RTTVQQYEVSQQEDTTPPAFLMLPRLCNHCENPPCIPVCPTGATFQRKDGIVVVNNEWCVGCGYCVQACPYDARFINHDT
    NTADKCTFCAHRLDAGLLPACVETCVGEARVIGDLNDPHSQISQLLANNKTDIKVLKPTANTSPRVFYIGMSSAFEHKIS
    GQAPVRTLLTDTGEEIHHGH

    >gi|217974925|ref|YP_002359676.1| redox-active disulfide protein 2 [Shewanella baltica OS223]
    MKQVKVLGSGCAKCNKTAEMIADISEEMGVDAIVKKDTDPQTLLKFKVMKTPAVVIDGELIHSGSVPTRDEIEGWLRD

    >gi|217974962|ref|YP_002359713.1| Redoxin domain protein [Shewanella baltica OS223]
    MLLRQIIVMCLAVVSFATFAGDKAYQDIALKTYPDQQQVTLGSVAGDKPIYLKFWATWCQPCMEQMPHFEALQKKYQDKI
    NIVAVNININEEQPKIADVIARFGLTMPVWLDNEGELGVALGLVGTPYSVMINRAGDVVYTSHESDANLDKFIDMLANGQ
    ELTAQTTEAPSAEQTAKLLKPWEQGEHLLFFTATW
    CDWYLAESRPEMSKECIAVQKGLNNLAQKVPNKAWHGVVNHLWTD
    DKALEDFKQLYQTKIDFSIDELGVLFNHFKIRNIPTLLWVKDGKVIQRITDFSQPEQLVKQLSAQ

    >gi|217974982|ref|YP_002359733.1| thioredoxin [Shewanella baltica OS223]
    MGEIIITQPLNNRPLAQYISRIDVLFWSFAMIIACPHCDTLNRVPDERVNQQPTCGKCKLSVFTAATIELTSANFANHAN
    KSELPLVVDFWASW
    CGPCKSFAPVFSAAAKTWEPQFRFGKINTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQS
    ALNQWLKSHS

    >gi|217975003|ref|YP_002359754.1| dihydrolipoamide dehydrogenase [Shewanella baltica OS223]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETIIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPT
    IDLDKLRGFKEKVINQLTGGLGGMSKMRKVNVVNGLGKFTGPNTLEVTAEDGTVTVVKFEQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYASLGSQIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAREDGIYVSMEGKSAPTEAVRYDAVLVAIGRAPNGKSLDAEKAGVNVDERGFIKVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDASEGMTKL
    IFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKK

    >gi|217975021|ref|YP_002359772.1| hypothetical protein Sbal223_3874 [Shewanella baltica OS223]
    MHNNVKAFLATTALFFSCQVLANGGCGFEEQQQGLIATCSEEKQEVILTGIVEAQHLVTDLNEFAEGYKSYQVDTAAITP
    LKSVTEPTEIIVIIGTW
    CPDCHRETPRFIRIMEEVANPNIKVTYIGVDRTKKDPEGLAAKYDFTRIPTFIVLQQGKEVGR
    IVERPTVSLEKDLADLLK

    >gi|217975024|ref|YP_002359775.1| thioredoxin [Shewanella baltica OS223]
    MSDKIIYLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKNGELAATKVGALSKTQLKEFIDAQI

    >gi|217975103|ref|YP_002359854.1| DSBA oxidoreductase [Shewanella baltica OS223]
    MKKVLLMAAALLLAPLAVSAVEYQEGVHYTVINDGPATAKPEITEFFSFYCPHCFNFSKTVVPKILAEKPEGVAFNQAHV
    DFIGKEMGVEMSRAFAVAHQLNVDDKMDAALFSAIHEKKEHFTSLADIRALFVANGVDGKTFDAAAESFMVKAQMAKMKR
    DTENAKLTGVPALVVNGKYRVETGAIKSYDELLDIAFYLAKK

    >gi|217975106|ref|YP_002359857.1| protein of unknown function UPF0061 [Shewanella baltica OS223]
    MKFKQDFFTQLPEFYSQVYPQGITKPEWLAWSDDAAQLIGLSQPTDELLLGLSGNAAVDGATYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGAWDVALKGGGPTPYSRRGDGRAVMRSAVREFLVSEALHHLHVPTTRALAVIGSDLPVWRESQET
    AAITVRLARSHIRFGHFEFFCHSERGRADKLIQLLNFTITQHYPHLSCDAAGYKAWFLQVVQDTAKMIAHWQAVGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPEGRYAFGQQPGVGLWNLQRLAQALTPVIPSDDLIAILNQYQEALV
    QPYLRLMRAKLGLSAVDVPSVEQDKQDLDLIGRFTVLMEKNQLDYTQTWRQLGKLDPTSKHSALRDDFIDVSQFDTWYQA
    YQQRLGAVADIPAWQTERNSVNPKYILRNYLAQEAIIAVEEGNLAPLHLLQKILTQPFAEHAEHEDLAKRPPDWGQGLIM
    S
    CSS

    >gi|217975109|ref|YP_002359860.1| DsrE family protein [Shewanella baltica OS223]
    MQSILIVAHASPYGTEKLFNSLRIALALKDQDEQAVDLKLFLMSDAVFGALKNQITPDLSYNLQQMFEILSAQQVPILLC
    KTCAQARGVTAEMIIEGAHIGTLQDLTRWTLAADKVMHI

    >gi|217975163|ref|YP_002359914.1| Redoxin domain protein [Shewanella baltica OS223]
    MKHKVITALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLINVLPKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMW
    ATW
    CPPCVRELPAIERLATKFKAEDFVLLPISIDAEGKQQVQPFLSSLGMPNFNSYYDQPQSLGDVFPLDTIPATFILDQ
    QGQLIAFVRSYVDWDDAKAVSLIQGFIDKGSKKPN

    >gi|217975165|ref|YP_002359916.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Shewanella baltica OS223]
    MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQLERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYE
    HPFLVMLKRKNLLPIYGINYRDERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDQ
    RVWSETLYPMIQQLQAEAAKDGAS

    >gi|217975225|ref|YP_002359976.1| selenophosphate synthetase [Shewanella baltica OS223]
    MSDSPVTLPESIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQSRDDAAVYKLNDDIGIISTTDFFMPIV
    DDPFTFGRIAATNAISDIYAMGGTPIMAIAILGWPINKLPAEVAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVT
    GQIALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLQDEDSHIAVNAMCQLNTIGTTIAKISGVNALTDVTGFGLA
    GHLLEMCQGTKLTAKLKFDAVPLLPRALDYLALGCVPGGTHRNYDSYGEHLPELSEHQKAILCDPQTSGGLLVAVSAEAE
    AELIALLDAHHIAPICIGSLETPTTEANVVLY

    >gi|217975280|ref|YP_002360031.1| Redoxin domain protein [Shewanella baltica OS223]
    MIAQGQTLPAATLGQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKGVDLIACVAVNDAF
    VMKAWGEAQNASELMMLADGDASFTKALGLEMDTAGFGGVRSQRYAMIIDNGVVTLLNVEEPKAFEASKAEVVLAAL

    >gi|217975294|ref|YP_002360045.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS223]
    MSAEQVSISLPKRILGWIKQLALLLLIVIIVTSVMDIWRGKDIPRDNLPQLQGTTLAGDSLDIATLSQDQAVLVYFWGTW
    CPVCNFVSPAVNQMSAYYPVVTIAMSSGEDEKLRKYLQHQDYGFDTINDSDSKIARDWSLQSTPTIMIFKDGELKHYTTG
    FTSLPGMWWRMMFT

    >gi|217975295|ref|YP_002360046.1| DSBA oxidoreductase [Shewanella baltica OS223]
    MSKFSSLFKHRKLQMFAVSGVAMAMLVVSLPSVSTMAYAKDSSLSAAQQQEVRAILKDALINDPDLMREAIIAWQAREQE
    GANTAMQTNLVTHHKAMYETKSDPWKGAATPEIEMVYFTDFN
    CPYCKKIEPSLNQLIEEFPQLKIIVKMVPLQGEGSKMA
    VDFAQTVWLNEPEKYLKVKDMLMSSPRGLDAAAIAKVAKLTATERWVGNTDERVAKMVDDNVNLMNELGIGGTPSMIVAD
    TLIPGLVPYEVLKEQLEAAIAAKDKMQKSS

    >gi|217975296|ref|YP_002360047.1| cytochrome c biogenesis protein transmembrane region [Shewanella baltica OS223]
    MSTLKSMLTRFWILALIVTSPSLLAASTGWLVNYYHPPAKVRFMLTGEVDPTTNTLPAVLEVQLEGDWKTYWRSPGEGGI
    APTIKWDGSHNLQQVDWRWPAPEEFSLLGLQTFGYKGNTTFPLTLKVDDIAAPTQLRGKVTLSTCTTICVLTDYQISLDF
    TPNALQADTDAMLAYNKAVSLVPQKVLSQEGQNPAMTMGWDAAKGQLEVRLNDANWQQPTVIIDGEPDTTFKLVSLKPSE
    SDANGKQLVGIFSGKSWLGEPEVLGKSLNMTVADSERALEYSAEVKPVVITQASTSIFGMILLALIGGLILNVMPCVLPV
    LGMKLSSVVAAPDLKRNQIRQQFIASALGILASFWLLAGFILMLKLTGQAIGWGVQFQNPWFIGFMALVTTVFAFNMLGV
    FEINLPSNVQTKLATTGGNNNSGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSLFAIFTALAVGMAFPWLIVAAFP
    QVAGYFPKPGRWMNTVKVFFSGMLLITSLWLISLLASFIDVLYLWPLAGVITLIFMVFMAKKYGAIAIVSCLGIGILLSA
    VIAFMTANQWAKPLPADLAWTPLDQALINQQVAQGKTVFVDVTADW
    CITCKANKVGVILQDPVYSLLQQSHILPMKGDWT
    TPSEPITHYLQSHNRFGVPFNVVYGPGAPQGIELPEILSTDLVLAAIEQASASPEKSSVAAGK

    >gi|217975358|ref|YP_002360109.1| glutathione reductase [Shewanella baltica OS223]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFD
    WNTLVENREAYIGRIHDAYGRGFANNKVTLLNGYGRFVDGNTIEVDGEHYTADNILIATGGAPTIPDIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAMATEGPTLHTHSVPKAVVKNADD
    SLTLSLENGESITVDCLIWAIGRSPATGNIGLENTEVQVDSKGYVITDEQQNTTHKGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSLIPTVVFSHPPIGTMGLTEPEARTQYGDDNVKVYTSTFTSMYTAVTAHRQACKMKLVCAGKD
    EKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMRG

    >gi|217975425|ref|YP_002360176.1| Rhodanese domain protein [Shewanella baltica OS223]
    MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNNENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCE
    QGFDDVYSLDGGYSAWHEANA

    >gi|217974236|ref|YP_002358987.1| OsmC family protein [Shewanella baltica OS223]
    MGFNLTVNWQTSPAEEGEFCRDHSITFGSGQTIQASSAPEYKGNGQNVNPEESLLAALSSCHMLTFLAIAHLKRLPVTSY
    VDNATAELGKNETGKLAVTKMVLNPKVMFAEGIEVSQETLEKIHEKAHVN
    CFIANSLATDIHIKF