Shewanella baltica OS195 uid58261

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|160873174|ref|YP_001552490.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MRAIIMQEYIEFFKAHSMLSLAWVGLFVVLVASIIKSSMSKIKSISHQELTIMVNRQDAKVVDVRSNDEFRKGHIVDAIN
    VTLADIKNNQVSALEKYKASPIILV
    CNAGMTSSQAAQLLSKQGFENLYNLKGGMGEWQAANMPVSKSKR

    >gi|160873232|ref|YP_001552548.1| formate dehydrogenase, beta subunit [Shewanella baltica OS195]
    MASQDIIRRSGTSAVTPAAKGRNSSEKVAKLFDATKCNGCKACQVACSEWNDLREEVGTFQGSYQNPMSLSGQCWTLMEF
    HEVMESNKLRWQFTHSACMHCADPACLTACSTSGAIIQHANGVVDFDSDKCIGCGYCASACPFDVPKIDPKDNKAYKCTM
    CSDRLAVGLEPSCVKSCTTGALRFGTREDMLFYSQKRVEELKERGFAKAGLYNPEGVGGTGMMMILHDINQPEGYNMPDN
    PQIPLSLTLWQDWVKPLGTMGILATAAVACLHKITVGRNIVEEDQPGYQPPEEEVKQEEEGDK

    >gi|160873238|ref|YP_001552554.1| putative inner membrane protein [Shewanella baltica OS195]
    MTWQQFKQEYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEFTRWGGHLMQLFGAEPETWGYFKVIGLQGSPLDRID
    GMMIIGMFGGCIAAALWANNVKLRMPQSRIRIAQALIGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGARFTLLPMFRIPVKLKKVNKATSIKQDENQARRRFRIGMLVFVGIVGWGLLTMFNAPKLGIAMLCGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVPPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHFWWVGLGNVLGSTLLAYYWDDLAQPLATNWDKVNLLTSFGDRGGLLLTYVLLGLSFGAMLLWEKRFFARKAKRDEQLL
    AEAA

    >gi|160873261|ref|YP_001552577.1| molybdopterin biosynthesis protein MoeB [Shewanella baltica OS195]
    MNVPDDILSDSELLRYSRQISIKAMDIDGQEHLKQAKVLMIGAGGLGCAASQYLTVAGIGELTLVDFDHVELSNLQRQVL
    HQDANVGQPKVESAKQSLSQLNPFIKINIINAVLDDHEIDALVADHNLVLDCTDNVSVREQLNLSCFKHKVPLVSAAAIR
    MEGMVTVFDYHSDTPCYHCFSALFGEQQLS
    CVESGILAPVVGMIGCLQAVEAVKVITGMGKTLAGRMLMIDAMTMEFREM
    KLPKHSNCSVCGTQA

    >gi|160873303|ref|YP_001552619.1| selenide, water dikinase [Shewanella baltica OS195]
    MSDSPVTLPESIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQSRDDAAVYKLNDDIGIISTTDFFMPIV
    DDPFTFGRIAATNAISDIYAMGGTPIMAIAILGWPINKLPAEVAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVT
    GQIALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLQDEDSHIAVNAMCQLNTIGTTIAKISGVNALTDVTGFGLA
    GHLLEMCQGAKLTAKLKFDAVPLLPRALDYLALGCVPGGTHRNYDSYGEHLPELSEHQKAILCDPQTSGGLLVAVSAEAE
    AELIALLDAHHIAPICIGSLETPTTEANVVLY

    >gi|160873361|ref|YP_001552677.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella baltica OS195]
    MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQLERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYE
    HPFLVMLKRKNLLPIYGINYRDERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDQ
    RVWSETLYPMIQQLQAEAAKDGAS

    >gi|160873363|ref|YP_001552679.1| redoxin domain-containing protein [Shewanella baltica OS195]
    MKHKVIAALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLINVLSKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMW
    ATW
    CPPCVRELPAIERLATKFKAEDFVLLPISIDAEGKQQVQPFLNSLGMPNFNSYYDQSQSLGDVFPLDTIPATFILDQ
    QGQLIAFVRSYVDWDDAKAVTLIQGFIDKGSKKPN

    >gi|160873451|ref|YP_001552767.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MFQSLLAKLSGSQSGKKCWQLIEQGARVIDVRSPEEFASGHLPQAINVPLPTLDQWLHQVDNKQHPFVLYCGAGIRAQKG
    CDILKANGFGCVVNGGSLKDLVCCQPS

    >gi|160873785|ref|YP_001553101.1| thiol:disulfide interchange protein precursor [Shewanella baltica OS195]
    MKKLLSLIFTSLLLLTPLAHSEGVFGNKFDFMKSEPELMPVDQAFAFDFKQEGNQVKLNWVIADGYYMYRDKLKFSVNGA
    ELGTVALPKGKPHQDEYFGEQEVYYTYVDIPVALKQADENATLTVTFMGCAEGKLCYPPTKRDVVLKAIAANDGLIAGAE
    AGESTVAAEPASTESASIEPSTADKANPQPITQQDTLSQMLSNDSLIWTLVIFFGLGVGLALTPCVFPMYPILSGIIVGQ
    GQKLSTAKAFTLSMAYVQGMAITYSILGLVVASAGLKYQAALQHPAVLVVLAILFFVLSLSMFGLYDLKLPSSWQEKMNS
    VSNNQKGGNLVGVFLMGVISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGAW
    MDIIKTVFGFLLIAVSIVMLGRIWTGVVSDVLWSLWGVSFTGYLMHQNKLSPFNWKQTVRSVLLTLTLLASFSYGFQAVM
    GHFGFNHNPVGTAATTEEAHGFKRIKSIKDLEQEIAAAAAQGKPVMLDLYADW
    CVACKEFEAITFKDADVLARMNKIVLL
    QADVTKSDKVDVALLEKYNVLGLPTLLMFNEQGDQREDLRVTGFMGPKDFAAHLDHLVK

    >gi|160873810|ref|YP_001553126.1| thioredoxin domain-containing protein [Shewanella baltica OS195]
    MHTDIITQIDSPEMLESLLTEHAAVLLLFGAPDCGVCQTLKPRIAEMLAQAFPLMQMAYIDCQAQAEIAASHNVFTLPVV
    ECVFYGKTFGRFSKVFSLADIRGALARPYGLIVTE

    >gi|160874095|ref|YP_001553411.1| DSBA oxidoreductase [Shewanella baltica OS195]
    MIKQLALAVTLAIAPLSSFAANFVEGTHYTQISAKAPSSEPKLTEFYSFYCHNCFNMETNYLPDIKANLNKQISFDNKHV
    DFMNSDIGTEVMRSLAVIQSLDNKDALTHAMFTAIQGTEGANGHDHSAPGHQHEPQINNRDDIKKVFAQFGVDATKYDAL
    ADSKSTGEKLALWRTQQNEFKIDSVPAFIVNDKYAVNLNSIKTLDELIGLINYLAIEKDAAAAKTSSGGSIGWLFLVFAA
    AIGVTRQQRLS

    >gi|160874182|ref|YP_001553498.1| thiol:disulfide interchange protein, putative [Shewanella baltica OS195]
    MSTITLISIVILCLLIGAILLLIWQRQKGKTIPLAVIFVLGFFALGLGAIIGFVHKGEDYQAYQKLQWHTLAPEQIAPLV
    AQGYTVFVDITSDW
    CTICQTNKAEVTHREQIVNALMADNIILMQGNWSEANKTIESYMRHEGVPGTPYNKIYGPSAPNGI
    LLPSKLSMSDVLNGLAAAQTNRS

    >gi|160874312|ref|YP_001553628.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MEYPLVSTQWLEAHLTDPHLVLLDASMETVIGKEPLVYDEPICIPRSRRFDLENVFCDKTSTQIHALPTFEQFSQGIAQL
    GIEADSVIVIYDNQGIYSSPRAWWTFKVMGFNRVYVLDGGLPQWIEEDRITSSRYQAEGVDYGPTDIDTLADVLQYHPER
    VMDAEAVLSRIEDAETAIVDARGAPRFLGQVSEPRPGVRSGHIPRSVNLPFAQVLDGNKIKTTSELQVIYQGLAADKSAR
    IFS
    CGSGITACILILASVAAGHTNPILYDGSWADWGSRTDLPIEC

    >gi|160874360|ref|YP_001553676.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica OS195]
    MTDQADTAMPIQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNDGDFTIEKQGVLLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|160874505|ref|YP_001553821.1| thiamine biosynthesis protein ThiI [Shewanella baltica OS195]
    MKFIVKLYPEIMMKSKPVRMRFTKMLETNIRNVLKKVDEDAKVQRQWDRIMVMVPKDKPELAQAFGERLACIPGIAHVVQ
    VDEYSFESVDDIYQQVLPVYRDQLAGKTFCVRVKRTGDHDFNSIEVERYVGGGLNQFTDALGVRLKNPDITVNLEIERDN
    LYMVTKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKKGARTHYCFFNLGGAQHEIGVKQVAYHLWKTYGESHKVK
    FISVPFEPVVAEILERIDNGQMGVVLKRMMMRTAARIADRMGIQALVTGESLGQVSSQTLTNLNVIDRCTELLILRPLIA
    MDKQDIINESRKIGTEDFAKSMPEYCGVISQKPTVKAVLAKVEAEEKKFSEDLIDQIIAQSVTIDIREIAEQMDTRITET
    ETVASIDTNQVVIDIRAPEEEESKPLQIEGIEIKRIPFFKLATQFADLDKQKTYLLY
    CERGVMSKLQALYLIEQGYTNVK
    VYRP

    >gi|160874525|ref|YP_001553841.1| glutathione peroxidase [Shewanella baltica OS195]
    MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQGLVILGFPCNQFGAQEKADE
    QGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAPGVLGTQGIKWNFTKFLVNRRGEAIERFASTTKPEALESKI
    AALLK

    >gi|160874548|ref|YP_001553864.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella baltica OS195]
    MTKIVIVGGVAGGASAAARARRVSETAEIIMLERGEFISFANCGLPYHIGGEIESREALLLQTPESFKSRFNIEVRVFND
    VIAINRQTKQLSIRNLLTDEVYQESYDKLLLSPGASPIKPPISGINSHFVHSLRNIPDMDKVLANLLLHKPKHATVVGGG
    FIGLEMAEALRHRGLEVSLLELADQVMGPVDVEMANILHQKLVDNGVDLRLKTGLTAVHERPIQPAESDITDDYDTPVFP
    HYHLHLDLSDNSSLATDLVILAIGVKPETRLASECGLTLGKLGGIYVDASMRTSDPDIYAVGDAIETDDFVTGNPILIPL
    AGPANRQGRLAADNMLGGNKLYRATQGTAICKLFDMAIASTGLNEKSLLRQVIPFEKIYVHTASHASYYPRAHPITLKLL
    FCPDNGRILGAQAAGIDGVDKRIDVLAVAQRAGMTVYDLADLELTYAPPFGSARDVVNQAGMVAANVLLGDESICHSQEL
    DHLTAEQVIIDVRNPSELTAVGAIVGAINIPLPVLRDRLNELPKDKELLVF
    CQVGLRGHVAYRMLVQHGFKVRNLSGGYK
    TYQMVNARF

    >gi|160874652|ref|YP_001553968.1| copper-translocating P-type ATPase [Shewanella baltica OS195]
    MSMTRLYVANMNCAGCVAKIEKAFGAQAGVEARVNLADKQVTVEGKMSADTALTVMEKAGYPAQVVVDAKVAAEEKRLED
    ATEYRLRMRQAIAALVVGVPMMLWGLLGGEMMINSPAMQLGWGIMGLVTLALLVTTGGHFYQGMWRALKAKTTNMDTLIV
    LGTSTAWAYSMLVVIMPSAFPMDTRHVYFEASVMILGLINLGHGLELKARGKTSEAVQRLLGLQSTTAIRITDKGDEKVE
    ISHLKLGDKLRLRPGDRVALDGEVETGQSLLDEAMLTGEPIPVLKNRGDSLSAGTVNGNGSLVYRVTAGQEDTKLAKIIA
    LVQQAQTSKLPIGRLADRISAVFVPTVVAIALLAAAIWYFVGPAPALSHALVVLTSVLIIACPCALGLATPMSIMVAVGR
    AAQMGVLVKNGEALQTASKVDCVVLDKTGTVTLGKPQVTDFNLVQTLSDADKETLLGEIASLEQHSEHPLAGAIVNYAKE
    SLSQLPDTQAFTNHQGKGIEGKVDGVSLAIGNLALMTALDIVNSDGSALDPKATLSFANQGKTPIYIAKAGKLVATIALA
    DPIKPDAKDAIAAMLQRGIRVVLLTGDNPQTAQAVADQVAITEVIAGVLPEQKQQHVLDLQKQGHVVAMVGDGINDAPAL
    MSADVGIAMGSGTEVAIESADITLLSQQLIVIANLLVLSRATITNIKQNLFGAFVYNSLGIPVAAGVLYPLTGMLLSPVI
    AGAAMALSSLTVVTNANRLRRQKL

    >gi|160874827|ref|YP_001554143.1| glutaredoxin [Shewanella baltica OS195]
    MFIIRWILGRIILFLNFVFSPKKRQRPLAEQQQIDTQTQALALYQYPACPFCVKVRRAMRRQGLNIVTHDAKKAPHKDEL
    IAQGGKQQVPCLRIEENGQVQWLYESKEIINYLDQRFA

    >gi|160874892|ref|YP_001554208.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195]
    MSVLVGRQAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMNASTEGVAAYLSENASSL

    >gi|160874904|ref|YP_001554220.1| glutaredoxin 1 [Shewanella baltica OS195]
    MFVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVR
    ENNLLD

    >gi|160874928|ref|YP_001554244.1| disulphide bond formation protein DsbB [Shewanella baltica OS195]
    MELTLTVITRFAHSRSSWFILAGTALGLELSALYFQHIMKLDPCVMCIYQRLAVFGILAAGLIGMTAPKYRIVRILAAIV
    WAISATWGLKLALSLVDMQTNPSPFST
    CSFLPEFPAWMPLHEWFPSIMMPTGMCTDVPWVFMGVTMAEWMVVAFSGFLVA
    WLLFIVPILSGSNKPSLYK

    >gi|160874935|ref|YP_001554251.1| glutaredoxin-like protein [Shewanella baltica OS195]
    METVEKIKQQITENPIIVYMKGSPKLPSCGFSSQVAQIMINCGEQFAFVDILQHPDIRAELPKFANWPTFPQLWVEGELI
    GGCDIVVDMFQKGELQPLIKAAAAKIKTEE

    >gi|160874941|ref|YP_001554257.1| arsenate reductase [Shewanella baltica OS195]
    MTQATIYHNPRCSKSRETLALLEQQGCDITLVEYLKTPPTAEVIGDILAKLGISARELMRTKEAEYQALELADTSLTEQQ
    LIEAMVNTPKLIERPIVLANQRAAIGRPPENVLAIL

    >gi|160875006|ref|YP_001554322.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella baltica OS195]
    MNKLTDFERYVIEEKGTERPFSGEYYDHDAKGLYLCKKCHAPLYRSEHKFNAHCGWPAFDDEIAGAVTRHVDADGRRTEI
    VCSQCGGHLGHVFEGEMLTPNNIRH
    CVNSVSMVFKGMDDAVEPASNSFATFGAGCFWCVEAIFQSLKGVVNVTSGYAGGD
    GHDADYKSVCSGQTGHAEVVHIEFSPEEIDFTTLLQVFFESHDPTTLNRQGNDKGPQYRSVVFAHNAEQIEQTTAMLTQL
    AAAKVFDAPIVTQVSAFETFYPAENYHNDYFALHGEQPYCQMVVRPKVEKVKALFARLQKPN

    >gi|160875038|ref|YP_001554354.1| redoxin domain-containing protein [Shewanella baltica OS195]
    MKKILLLLSLMAAGVQAAPSLDHQVFNAQNQAVSLSEFKGKVVYVDFWASWCGPCRKSFPWMNEIQKKYQDQGLAVVAIN
    LDTDNELAQEFLKQVPANFSVRFNPEGDVARSFDLLGMPSSFMFNRQGQLVQHHVGFYADKTAEYEQELVSLLKE

    >gi|160875220|ref|YP_001554536.1| SoxR-reducing system protein RsxE [Shewanella baltica OS195]
    MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDG
    ADQLLGPWAKSLTIHLWQVDTPFLLAMLPPGAFIVMGLLIALKNVIDKKVKERQPQVAAEPSVTRARITKVG

    >gi|160875225|ref|YP_001554541.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS195]
    MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|160875310|ref|YP_001554626.1| peptide methionine sulfoxide reductase [Shewanella baltica OS195]
    MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVKKGKTGHAEVVQVEFDPALVSYEALLEVFWKNHNPT
    NLNMQGGDIGTQYRSTIFFHDSEQKAAAEASKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY

    >gi|160875328|ref|YP_001554644.1| heavy metal translocating P-type ATPase [Shewanella baltica OS195]
    MTHPSCFHCQEPVLTGQQFVTRINDRDELMCCPGCQAVSQAIVDAGLLSYYKFRTEPGSKQNALVPEALTQFSAYDLPEV
    QQDFVHSEDNIESVSLSIDGIT
    CAACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPY
    QVDEQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMLFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLMNDN
    GQEEIPAKKLRLNDVILVKPGEMIAADGVVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQL
    VAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGTLSIGQTQCMADLTNTQALAIAAALEAGSRHPIAAAFAMFADNA
    LVAEEVHHEVGFGVRGRIDGTDYFIGNAVFTGASIDSRDPTQKIWLARSANNQLEVLASFEIQDNIRQDSKATIEMLKQQ
    GCRISIASGDSSGHVHQLAKELGIDDVHSGLTPADKLALVTRLQQHTRVAMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVSVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV

    >gi|160875438|ref|YP_001554754.1| thioredoxin reductase [Shewanella baltica OS195]
    MSQVRHCNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNSEYTCDALIIATGASARYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVANGNIILHLDQTMDEVVGDAMGVNGLKMKSTKDGSITDLAVAGVF
    VAIGHSPNTGIFEGQLEMNHGYLKVQSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|160875549|ref|YP_001554865.1| UBA/THIF-type NAD/FAD binding protein [Shewanella baltica OS195]
    MQSMSKKTPLSHAEVLCGHIHSDNEHCGHALSDADFIRYSRQVLLPEVGEAGQLQLADASVVIIGLGGLGQLAAQYLACA
    GIGRLTLIDRDKVEVSNLPRQLLFNDADIGLNKAQIAKQKLNRIAPHCTVTAHETAFNAATSAHHLADILQIKQQGKRVL
    VLDCTDNFATRQAINRSCIEAALTLVSASIAAFSGQLFAVDQMQFPSGGCYHCIFPAQTRVSQS
    CSTQGVLGPSVGVMAS
    MQSLVAMQLLLNVDSCDEPKSALLGRFWRFDAKSLSWTAAILTRDPHCDVCGPKEVHSLSDKPSKL

    >gi|160875560|ref|YP_001554876.1| alkylhydroperoxidase [Shewanella baltica OS195]
    MSERIPRQQIYQLQPALANALLSLDKAAGDSHFAPLLVHLVKLRASQLNGCAFCQRRHAEEARSDGEEQLRLDLLAAWHE
    VDGIFNERERAALLWTEILTQVATAPVHDSQYAALAEHYSEKEIVDLTSLIIAINGWNRIAIAFHLQPI

    >gi|160875581|ref|YP_001554897.1| arsenate reductase and related [Shewanella baltica OS195]
    MLTLSQQNIPLVTCGAQCHNACKINACKPSVHPHWSIILTLYGIKNCDTVRKARKWIENHQLPVHFHDFRDDGLRQEDLE
    FWCNTSGWETVFNKRSTSFRALSDADKTDIVQAKAIQLMLAQPTLIKRPVLVVGEHVLIGFDEAAYKRVFSL

    >gi|160875593|ref|YP_001554909.1| hypothetical protein Sbal195_2481 [Shewanella baltica OS195]
    MTKVVVCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNSQNGLDNIVHKLSFDD
    EMPFYRTKVKLKNEIVTMGVEGIDPLKVVGTYVKPQDWNALISDPDVILVDTRNDYEVQIGTFKNAVNPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVKAEESLWEGECFVFDNRVAVNHDLKKGQ
    YDQCNACRMPITEAEKQSPAYVQGVSCPHCIDKISDEQRKRFVERERQVNLAKARNEAHIGSDVNQVIEARREKKEAQRR
    LAAEKNNAKKSQVL

    >gi|160875594|ref|YP_001554910.1| glutathione S-transferase domain-containing protein [Shewanella baltica OS195]
    MALAVLYTFRRCPYAMRARLGLLLAQCNVEVREITLKAKPAQMLAASPKGTVPVLVLANGEVIAESLEIMRWALTQADPL
    DLLCQQSSVIADKMAQLITQNDQQFKPWLDRYKYADRYPEQTQADYYQQASHFLTQLEACLGQHSFLVADTPRLADYAIV
    PFVRQFAAVELKRALSDDFPRLAAWLENLISSEIFIRAMEKYVIWDASHSPTCLLGDM

    >gi|160875612|ref|YP_001554928.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica OS195]
    MAITMTPAAADRVRSFLVNRGKGVGLRLGLRTSGCSGMAYVLEFVDSLNDDDEVFDIEDVKIIIDAKSLIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|160875781|ref|YP_001555097.1| thioredoxin-dependent thiol peroxidase [Shewanella baltica OS195]
    MNTLTAGAKAPQFTLQDQHGNSVSLADSLKQGPVLVYFYPKAATPGCTVQACGLRDSKAALDSHNVTVFGISPDPVAKLA
    KFAEKQALNFTLLSDEDHSVADAFGVWGEKKFMGKTYDGIHRLSFLINTDGTIAHVFDKFKTKDHHEVVLAQIAG

    >gi|160875865|ref|YP_001555181.1| DSBA oxidoreductase [Shewanella baltica OS195]
    MSVFNRVRPIAALACGLMLSASFALQAASFEEGKDYVTVAGITEAQKPVLREFFSYNCPHCYKQEPLMDLTVQLLGKDVA
    FERTPVGAGRPAWELSQLAYYVAQKLKMTKQTHGAIFKQIHEKGEQFTAPEQVKAFFVAQGAKVGDVDAAMNSVDAKFTL
    MNYDSQAELAGIKGVPSLLVNGRYMLTSTAHTPEELAALVKFLAAK

    >gi|160875982|ref|YP_001555298.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MTHNLVIRGQSLMRLALLSLQSLVLMPLLLMPLLLMPMMASATNQDPVIAWDKIAAGAMVLDVRTPEEFAEGHLANAVNI
    PFEQVAEEFAKRGIAKDAPVVLY
    CRSGRRSSVATEALVAAGYTQTYNGGGYSTLVEAQKTPAK

    >gi|160875987|ref|YP_001555303.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MPHPSAFSALVDAILPNITEVTIEAYQADDSWHLVDVREDREWLQDHLPQAKHLSRGILERDIEARFPDKHTPILLYCAG
    GARSALAAHNLQLMGYTRVASLIGGYKGWVQRQLPVVQD

    >gi|160876049|ref|YP_001555365.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella baltica OS195]
    MKHAIRQLSQAPSIAEYQPCAVDTFISPAGILQLNANAYGLSHLTVVGSDRAEIALAKVSEDALNHAKAHIRETQAQLAD
    YFAGERVEFDLKLAPKGTEFQRDVWQALLNLDYGQSCSYGQIAEQIGRPKAVRAVGAANGANPIAIIVP
    CHRVIGKNGKL
    TGYAYGLAMKQQLLTLETDKHCLDI

    >gi|160876278|ref|YP_001555594.1| redoxin domain-containing protein [Shewanella baltica OS195]
    MQKYVSFLAASCIYGLVLMSPNVLASEKNQVLMGEKTVTLEGKLPKLSQMAPGFKVVDDHFAPVMLSDFKGKTVLISAVP
    SLDTGV
    CALQTKRFNSEVGHFSDDVVMLTISADLPFAQKRFCKVENVDKIKVLSDSVWRDFGEKYGLLIQDYGLLARAIF
    IIDAEGKLQYQELVPNITEHPNYDAALEALKTIQAQQ

    >gi|160876286|ref|YP_001555602.1| glutathione peroxidase [Shewanella baltica OS195]
    MKKLPMIFAMTASLMSVSAMAATCPEYLNLEVRKLHSEETVNLCELTQGKPVLIVNTASNCGYTPQFKALEALHENYKDK
    GLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLSTSAVRGSDANSVFKYLAEKTGAPKWNFYKYVVSGDGAVVQQF
    NSKVKPDSEELKQAIESVL

    >gi|160876321|ref|YP_001555637.1| heavy metal transport/detoxification protein [Shewanella baltica OS195]
    MKLVLFLALSLCSASSWAANVLVTLDVKGMTCPLCVTVVNKALRKTDGVIKAKASLKTEQAIVTVPEDFNLDNLLKAVDE
    TGYKGSINKIEKQA

    >gi|160876322|ref|YP_001555638.1| mercuric transport protein MerT, putative [Shewanella baltica OS195]
    MAAAVIAAVASSLCCIAPLIYLVFGVSAASLSGIEQLSWLQVPMLILSTGLILMGFWRLYFAKKPLCTATLSRTQMVWLY
    WLTVPVVLAFQLYPFVLPWLLEVFE

    >gi|160876351|ref|YP_001555667.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195]
    MSTILKTLCLAGTLLLTSFTTLAQPIARDEFSISPLLNGQQIPKVNLQDIKGKTVDLAELTQQKPTIFFFYRGGWCPFCN
    NQMGQLKAIEPELLKMGFQLVGISPDTPAQLKASAAKNELKYLLLSDEKMLAAQAFGLAFYTSEKVTEIYTSRLHVDNPM
    WTTPEGAKRLVLPVPAIYISDDKGLIHFQYVNPNYKVRPAPKLILTAASLVGSQE

    >gi|160876665|ref|YP_001555981.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS195]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPANQVIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYKLGESVVFGFGSGVGWALAIVL
    MAGIREKLKYADVPNGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|160876666|ref|YP_001555982.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS195]
    MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQLLQAYAYQISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSL
    FGVEILHKISDGGWYQPNGLLLLPPSAFFLIGVLIWIIRTYKPEQVEAKG

    >gi|160876728|ref|YP_001556044.1| OsmC family protein [Shewanella baltica OS195]
    MKTLYETRATAKAGRQGQVSTDDGLLDVALAYPKAMGGSGLATNPEQLFAAGYAACFSNAVLHVAKIGKVDITEAPVSAV
    VGIGANDAGGFALAVALEVSLDLPQEAAEALVRHAHQV
    CPYSNATRNNIDVKLSVNGVALG

    >gi|160876729|ref|YP_001556045.1| hypothetical protein Sbal195_3623 [Shewanella baltica OS195]
    MTKYLSKISLFCSLLFLFAFSIPSWAETAPASSADQTWHYVNAQGELKIKLYFFWSKTCPHCAEAHPFIDSLPQKYPWIE
    LESHMVSAPGVQDIWQTIAAKTTTEARSVPYMASCEKAVVGYSSEAVTGEFLVNRLKNCYLSLGGKLSEADLPTKGVVST
    SASTETDAPLFGTCGTDTGEGTCDATSLGDATEPSSVQSEVQPVELPLVGVVTPETMSLPLLTLVLAGVDAFNPCAFFVL
    LFLLSIMVNAKSRSRMLLVGGIFVFFSGFIYFLFMTAWLNIFQLLGAGSDGGMIILAAGCLALIAGVINIKDYFFTKGEV
    TLSMSAENRTSLIKRMGKLSNSSSLGALLIGSTVLAVLANAYELLCTAGFPMIYTSVLSMHNLPDIERYMYLVLYNIVYV
    IPLAIIVIVFSATLGKRKLTEKEGQALKLMSGVMMLGMGIALVIDPTALQNVALALGLILGSLGITAIIVIGRKLFSAKA
    K

    >gi|160876744|ref|YP_001556060.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195]
    MTQSIINSTIKPFKATAYHNGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADYYEQLKGMGVEVYSVSTDTHFT
    HKAWHDTSDTIKKINFPMLADPTGTISRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIGRSAQELVRKIQAAQYV
    ATHDGEVCPAKWQPGDDTLAPSLDLVGKI

    >gi|160876745|ref|YP_001556061.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella baltica OS195]
    MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERTPAMTVINPQLNTQISFAGLP
    MGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFETYVSLT
    CQNCPDVVQALNMMAAINPNITNVMIDGALFQDE
    VANRNIMAVPSVYLNGEVFAAGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELELASGAKLRSRTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNI
    KIITQAMTTEVTGDGTRVNGLNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIIVDARGQTSIPGVFAA
    GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA

    >gi|160876748|ref|YP_001556064.1| thiol:disulfide interchange protein DsbC [Shewanella baltica OS195]
    MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMTNRGVLYISRDGSKLFHGSLY
    DLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHVVTVFTDVS
    CGYCRKLHSQMADYNKLGITVRYLAFPRAGVP
    SANADEMQAIWCAKDPLKAMTDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
    Q

    >gi|160876786|ref|YP_001556102.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS195]
    MEHYINLFLQATFIDNMALSFFLGMCTFLAVSKKVSTAFGLGVAVIVVMTLAVPLNQIIYVKVLAPGALSWAGLPGIDLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFGESVVFAMGSGLGWAVAIVL
    LAGLRERMKFNAIPEGLQGIGITFITTGLMALGFMSFSGISL

    >gi|160876787|ref|YP_001556103.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS195]
    MSNTLSMRDMLTGPVFANNPVAMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPTSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVGLIITN
    CIIMGRAEAFAMKYPPHLAVVDALGNATGYGLILISVAFVRELLGTGNL
    FGHSVFTTIENGGWYLPNEMFKLPPSAFFLIGVLIWTINVIQRKRG

    >gi|160876891|ref|YP_001556207.1| hypothetical protein Sbal195_3787 [Shewanella baltica OS195]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISDKDREGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPNGASSTFILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFALEEDDALPAGILDDYCLEIYNPDDELCGSHLIDTNSGNLKRGICAIPYARKSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRF
    FSSKFDYEFCEWDFSGTSEEEASGLFGILEALGKEVYIAEFTDLGASACRILVPDYSEIYPVDDLIWDNTNKALAYREDI
    LNLHSLSTKQLVNLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHEDAIELVGEFLQFNDNTV
    KRGLFYQAMNAVLEVTLDDELELDDFIHNFNRMFGKEVMDNVVGSVTGKVRFYGLTKTSMQLEGIEPHLRLIESYKKLHQ
    ARKAAKALN

    >gi|160877061|ref|YP_001556377.1| redox-active disulfide protein 2 [Shewanella baltica OS195]
    MKQVKVLGSGCAKCSKTAEMIADISEEMGVDAIVKKDTDPQTLLKFKVMKTPAVVIDGELIHSGSVPTRDEIEGWLRD

    >gi|160877105|ref|YP_001556421.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MNKVIRQSLTHTLIVLALGAVALPVLAGGGSEISEAPYNEIQLNPISMMEAETLVAQSGVYFFDVNTLEIWAEGFIPGAV
    FFNVQNWRELLPKNKDAVMVFYCANRL
    CTASNMAARETMKLGYTGVRHMADGIYGWRLSGRVTEKP

    >gi|160877109|ref|YP_001556425.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195]
    MKRYSLRLILLCSFVLLNNAVQAHSLQNKLYDTGEAIPKPRVMTGFVEMQHARGVPEVPFIDEAGKTQTLKQHQGKLVLV
    NLWATW
    CAPCLREIPELQHLKKDYQGKNIAIVPISIDEDPKDVRPFLTQHNFSDYQTWFDPTQNIEQIIPANVVPATYFF
    DAKGNLVGFVRGYLDWGDKDVAPYLDQLIAKYGQ

    >gi|160877113|ref|YP_001556429.1| redoxin domain-containing protein [Shewanella baltica OS195]
    MYFLCKWLQITGPIVRMRVVYQFKENTMLLRQIIVMCLAVVSFATFAGDKAYQDIALKTYPDQQQVTLGSVAGDKPIYLK
    FWATW
    CQPCMEQMPHFEALQKKYQDKINIVAVNININEEQPKIADVIARFGLTMPVWLDNEGELGVALGLVGTPYSVLIN
    RAGDVVYTSHESDANLDKFIDMLANGQELTAQTTEAPSAEQTAKLLKPWEQGEHLLFFTATW
    CDWYLAESRPEMSKECIA
    VQKGLNNLAQKVPNKAWHGVVNHLWTDDKALEDFKQLYQTKIDFSIDELGVLFNHFKIRNIPTLLWVKDGKVVQRITDFS
    QPEQLVKQLSAQ

    >gi|160877133|ref|YP_001556449.1| thioredoxin [Shewanella baltica OS195]
    MGEIIITQPLNNRPLAQYISRIDILFWSFAMIIACPHCDTLNRVPDERVNQQPTCGKCKLSVFTAAPIELTSANFANHAK
    KSELPLVVDFWASW
    CGPCKSFAPVFSAAAKTWEPQFRFGKINTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQS
    ALNQWLKSHS

    >gi|160877156|ref|YP_001556472.1| dihydrolipoamide dehydrogenase [Shewanella baltica OS195]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETIIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPT
    IDLDKLRGFKEKVIGQLTGGLGGMSKMRKVNVVNGFGKFTGPNTLEVTAEDGTVKVVQFEQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYASLGSEIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAREDGIYVSMEGKSAPTEAVRYDAVLVAIGRAPNGKSLDAEKAGVNVDERGFIKVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDASEGMTKL
    IFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKK

    >gi|160877171|ref|YP_001556487.1| hypothetical protein Sbal195_4067 [Shewanella baltica OS195]
    MHNNVKAFLATTALFFSCQVLANGGCGFEEQQQGLIATCSEEKQEVILTGIVEAQHLVTDLNEFAEGYKSYQVDTAAITP
    LKSVTEPTEIIVIIGTW
    CPDCHRETPRFIRIMEEVANPNIKVTYIGVDRTKKDPEGLAAKYDFTRIPTFIVLQQGKEVGR
    IVERPTVSLEKDLADLLK

    >gi|160877174|ref|YP_001556490.1| thioredoxin [Shewanella baltica OS195]
    MSDKIIYLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKNGELAATKVGALSKTQLKEFIDAQI

    >gi|160877256|ref|YP_001556572.1| DSBA oxidoreductase [Shewanella baltica OS195]
    MKKVLLMAAALLLAPLAVSAVEYQEGVHYTVINDGPATAKPEITEFFSFYCPHCFNFSKTVVPKILAEKPEGVAFNQAHV
    DFIGKEMGVEMSRAFAVAHQLNVDDKMDAALFSAIHEKKEHFTSLADIRALFVANGVDGKTFDAAAESFMVKAQMAKMKR
    DTENAKLTGVPALVVNGKYRVETGAIKSYDELLDIAFYLAKK

    >gi|160877259|ref|YP_001556575.1| hypothetical protein Sbal195_4156 [Shewanella baltica OS195]
    MKFKQDFFTQLPEFYSQVYPQGITKPEWLAWSDDAAQLIGLSQPTDELLLGLSGNTAVDGATYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGVWDVALKGGGPTPYSRRGDGRAVMRSAVREFLVSEALHHLHVPTTRALAVIGSDLPVWRESQET
    AAITVRLARSHIRFGHFEFFCHSERGRADKLIQLLNFTITQHYPHLSCDAAGYKAWFLQVVQDTAKMIAHWQAVGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPEGRYAFGQQPGVGLWNLQRLAQALTPVIPSDDLIAILNQYQEALV
    QPYLRLMRAKLGLSAVDVPSVEQDKQDLDLIGRFTVLMEKNQLDYTQTWRQLGKLDPTSKHSALRDDFIDVSQFDTWYQA
    YQLRLGAVADIPAWQTERNSVNPKYILRNYLAQEAIIAVEEGNLAPLHLLQKILTQPFAEHADHEDLAKRPPDWGQGLIM
    S
    CSS

    >gi|160877262|ref|YP_001556578.1| DsrE family protein [Shewanella baltica OS195]
    MQSILIVAHASPYGTEKLFNSLRIALALKDQDEQVVDLKLFLMSDAVFGALKNQTTPDLSYNLQQMFEILSAQQVPILLC
    KTCAQARGVTAEMIIEGAHIGTLQDLTRWTLAADKVMHI

    >gi|160877443|ref|YP_001556759.1| redoxin domain-containing protein [Shewanella baltica OS195]
    MIAQGQTLPAATLGQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKGVDLIACVAVNDAF
    VMKAWGEAQNASELMMLADGDASFTKALGLEMDTAGFGGVRSQRYAMIIDNGVVTLLNVEEPKAFEASKAEVVLAAL

    >gi|160877457|ref|YP_001556773.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS195]
    MSAEQVSISLPKRILGWIKQLALLLLIVIIVTSVMDIWRGKDIPRDNLPQLQGTTLAGEMLDIATLSQDQAVLVYFWGTW
    CPVCNFVSPAVNQMSAYYPVVTVAMNSGEDEKLRKYLQHQDYGFDTINDSDSKIARDWSLQATPTIMIFKDGELKHYTTG
    FTSLPGMWWRMMFT

    >gi|160877458|ref|YP_001556774.1| DSBA oxidoreductase [Shewanella baltica OS195]
    MKQTIEAQNITESMQNTQVIGGTKMSKFSSLFKHRKLQMFAVSGVAMAMLVVSLPSVSTMAYAKDSSLSAAQQQEVRAIL
    KDALINDPDLMREAIIAWQAREQEGANTAMQTSLVTHHKAMYETKSDPWKGAATPEIEMVYFTDFN
    CPYCKKIEPSLNQL
    IEEFPQLKIIVKMVPLQGEGSKMAVDFAQTVWLNEPEKYLKVKDMLMSSPRGLDAAAIAKVAKLTATERWVGNTDERVAK
    MVDDNVNLMNELGIGGTPSMIVADTLIPGLVPYEVLKEQLEAAIAAKDKTQKSS

    >gi|160877459|ref|YP_001556775.1| cytochrome c biogenesis protein transmembrane region [Shewanella baltica OS195]
    MSTLKSMLTRFWILALIVTSPSLLAASTGWLVNDNHPPAKVRFMLTGEVDPTTNTLPAVLEVQLEGDWKTYWRSPGEGGI
    APTIKWDGSHNLQQVDWRWPAPEEFSLLGLQTFGYKGNTTFPLTLKVDDIAAPTQLRGKVTLSTCTTICVLTDYQISLDF
    TPNALQADTDAMLAYNKAVSLVPQKVLSQEGQNPAMTMGWDAAKGQLEVRLNDANWQQPTVIIDGEPDTTFKLVSLKPSE
    SDANGKQLVGIFSGKSWLGESEVLGKSLNMTVADSERALEYSAEVKPVVITQASTSIFGMILLALIGGLILNVMPCVLPV
    LGMKLSSVVAAPDLKRNQIRQQFIASALGILASFWLLAGFILMLKLTGQAIGWGVQFQNPWFIGFMALVTTVFAFNMLGV
    FEINLPSNVQTKLATTGGNNNSGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSLFAIFTALAVGMAFPWLIVAAFP
    QVAGYFPKPGRWMNTVKVFFSGMLLITSLWLISLLASFIDVLYLWPLAGVITLIFMVFMAKKYGAIAIVSCLGIGILLSA
    IIAFMTASQWAKPLPADLAWTPLDQALINQQVVQGKTVFVDVTADW
    CITCKANKVGVILQDPVYSLLQQPHILPMKGDWT
    TPSEPITHYLQSHNRFGVPFNVVYGPGAPQGIELPEILSTDLVLAAIEQASASPEKSSIAAGK

    >gi|160877497|ref|YP_001556813.1| glutathione reductase [Shewanella baltica OS195]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFD
    WNTLVENREAYIGRIHDAYGRGFANNKVTLLNGYGRFVDGNTIEVDGEHYTADHILIATGGAPTIPNIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAMATEGPTLHTHSVPKAVVKNADD
    SLTLSLENGESITVDCLIWAIGRSPATGNIGLENTEVQLDSKGYVITDEQQNTTHKGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSLIPTVVFSHPPIGTMGLTEPEARTQYGDDNVKVYTSTFTSMYTAVTAHRQACKMKLVCAGKD
    EKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMKG

    >gi|160877583|ref|YP_001556899.1| rhodanese domain-containing protein [Shewanella baltica OS195]
    MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNNENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCE
    QGFDDVYSLDGGYSAWHEANA

    >gi|160874430|ref|YP_001553746.1| OsmC family protein [Shewanella baltica OS195]
    MGFNLTVNWQTSPAEEGEFCRDHSITFGSGQTIQASSAPEYKGNGQNVNPEESLLATLSSCHMLTFLAIAHLKRLPVTSY
    VDNATAELGKNEAGKLAVTKMVLNPKVIFAEGIEVSQETLEKIHEKAHVN
    CFIANSLATDIHIKF