Shewanella baltica OS185 uid58743

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|152998599|ref|YP_001364280.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MRAIIMQEYIEFFKAHSMLSLAWVGLFVVLVASIIKSSMSKIKSISHQELTIMVNRQDAKVVDVRSNDEFRKGHIVDAIN
    VTLADIKNNQISALEKYKASPIILV
    CNAGMTSSQAAQLLSKQGFENLYNLKGGMGEWQAANMPVSKSKR

    >gi|152998654|ref|YP_001364335.1| formate dehydrogenase, beta subunit [Shewanella baltica OS185]
    MASQDIIRRSGTSAVTPAAKGRNSSEKVAKLFDATKCNGCKACQVACSEWNDLREEVGTFQGSYQNPMSLSGQCWTLMEF
    HEVMESNKLRWQFTHSACMHCADPACLTACSTSGAIIQHANGVVDFDSDKCIGCGYCASACPFDVPKIDPKDNKAYKCTM
    CSDRLAVGLEPSCVKSCTTGALRFGTREDMLFYSQKRVEELKERGFAKAGLYNPEGVGGTGMMMILHDINQPESYNMPDN
    PQIPLSLTLWQDWVKPLGTMGILATAAVACLHKITVGRNIVEEDQPGYQPPEEEAKQEEEGDK

    >gi|152998660|ref|YP_001364341.1| putative inner membrane protein [Shewanella baltica OS185]
    MTWQQFKQEYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEFTRWGGHLMQFFGAEPETWGYFKVIGLQGSPLDRID
    GMMIIGMFGGCIAAALWANNVKLRMPQSRIRIAQALIGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGARFTLLPMFRIPVKLKKVNKATSIKQDENQARRRFRIGMLVFVGIVGWGLLTMFNAPKLGIAMLCGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVPPKIMWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHFWWVGLGNVLGSTLLAYYWDDLAQPLATNWDKVNLLTSFGDRGGLLLTYVLLGLSFGAMLLWEKRFFARKAKRDEQLL
    AEAA

    >gi|152998683|ref|YP_001364364.1| molybdopterin biosynthesis protein MoeB [Shewanella baltica OS185]
    MNVPDDILSDSELLRYSRQISIKAMDIDGQEHLKQAKVLMIGAGGLGCAASQYLTVAGIGELTLVDFDHVELSNLQRQVL
    HQDANVGQPKVESAKQSLSQLNPFIKINIINAVLDDHEIDALVANHNLVLDCTDNVSVREQLNLSCFKHKVPLVSAAAIR
    MEGMVTVFDYHSDTPCYHCFSALFGEQQLS
    CVESGILAPVVGMIGCLQAVEAIKVITGMGKTLAGRMLMIDAMTMEFREM
    KLPKHANCSVCGTQA

    >gi|152998726|ref|YP_001364407.1| selenide, water dikinase [Shewanella baltica OS185]
    MSDSPVTLPESIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQSRDDAAVYKLNDDIGIISTTDFFMPIV
    DDPFTFGRIAATNAISDIYAMGGTPIMAIAILGWPINKLPAEVAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVT
    GQIALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLQDEDSHIAVNAMCQLNTIGTTIAKISGVNALTDVTGFGLA
    GHLLEMCQGAKLTAKLKFDAVPLLPRALDYLALGCVPGGTHRNYDSYGEHLPELSEHQKAILCDPQTSGGLLVAVSAEAE
    AELIALLDAHHIAPICIGSLETPTTEANVVLY

    >gi|152998785|ref|YP_001364466.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella baltica OS185]
    MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQLERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYE
    HPFLVMLKRKNLLPIYGINYRDERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDQ
    RVWSETLYPMIQQLQAEAAKDGAS

    >gi|152998787|ref|YP_001364468.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MKHKVIAALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLINVLSKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMW
    ATW
    CPPCVRELPAIERLATKFKAEDFVLLPISIDAEGKQQVQPFLNSLGMPNFNSYYDQSQSLGDVFPLDTIPATFILDQ
    QGQLIAFVRSYVDWDDAKAVTLIQGFIDKGSKKPN

    >gi|152998872|ref|YP_001364553.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MFQSLLAKLSGSHSGEKCWQLIEQGARVIDVRSPEEFASGHLPQAINVPLPTLDQWLHQVDNKQHPLVLYCGAGIRAQKG
    CDILKANGFGCVVNGGSLKDLVCCQPS

    >gi|152999179|ref|YP_001364860.1| thiol:disulfide interchange protein precursor [Shewanella baltica OS185]
    MKKLLSLIFTSLLLLTPLAHSEGVFGNKFDFMKSEPELMPVDQAFAFDFKQEGNQVKLNWVIADGYYMYRDKLKFTVNGA
    ELGTVALPKGKPHEDEYFGEQEVYYTYVDIPVALKQADENATLTVTFMGCAEGKLCYPPTKRDVVLKAIAANEGLIAGAE
    ASESTAAAKPASTESASNEPNTADKANPQPITQQDTLSQMLSNDSLIWTLVIFFGLGVGLALTPCVFPMYPILSGIIVGQ
    GQKLSTAKAFTLSMAYVQGMAITYSILGLVVASAGLKYQAALQHPAVLVVLAILFFVLSLSMFGLYDLKLPSSWQEKMNS
    VSNNQKGGNLVGVFLMGVISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGAW
    MDIIKTVFGFLLIAVSIVMLGRIWTGVVSDVLWSLWGVSFTGYLMHQNKLSPFNWKQTVRSVLLTLTLLASFSYGFQAVM
    GHFGFNHNPVGTAATTEEAHGFKRIKSIEDLEQEIAAAAAQGKPVMLDLYADW
    CVACKEFEAITFKDADVLARMNKIVLL
    QADVTKSDKVDVALLEKYNVLGLPTLLMFNEQGEQREDLRVTGFMGPKDFAAHLDHLVK

    >gi|152999198|ref|YP_001364879.1| thioredoxin domain-containing protein [Shewanella baltica OS185]
    MHTDIIMHIDSPEMLESMLTEHAAVLLLFGAPNCGVCQTLKPRIAEMLAQAFPQMRMAYIDCQAQGEIAASRNVFALPVV
    ECVFYGKTFGRFSKVFSLADIRGALARPYGLIVTE

    >gi|152999402|ref|YP_001365083.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella baltica OS185]
    MSDYDRIASAMAYLVDRAIDQPSLEEIAAHVHLSPYHFQRLFCRWAGTTPKRFLQVLTLERGKGLLDNSRSLLDVSHELG
    LSGSSRLHDHFVQLEAVTPGEYKNRGKDVQIEYGVHPTPLGPMFVAVTLRGVCRAAFMDFNSMEELLDDLHNDWPLSSIR
    ENLASTRHAIDAFFSSDTASGQGPLSLHVTGTNFQIAVWRALLKIPPGAVASYAEVARSLGAPRSARAVGNAIGANPVAL
    LIP
    CHRVIQQSGALGGYRWGPTKKLMVQTWEKMRDEPVAL

    >gi|152999477|ref|YP_001365158.1| DSBA oxidoreductase [Shewanella baltica OS185]
    MIKQLALAVTLAIAPLSSFAANFVEGTHYTQISAKAPSSEPKLTEFYSFYCHNCFNMETNYLPDIKANINKQISFDNKHV
    DFMNSDIGTEVMRSLAVIQSLDNKDALTHAMFTAIQGAEGANGHDHSAPGHQHEPQINSRDDIKKVFAQFGVDAAKYDEL
    ADSKSTDEKLALWRTQQNEFKIDSVPAFIVNDKYAVNLNSIKTLDELIGLINYLAVEKDAATAKTSSGGSLGWLFLVFAA
    AIGVTRQQRLS

    >gi|152999563|ref|YP_001365244.1| thiol:disulfide interchange protein, putative [Shewanella baltica OS185]
    MSTITLISIVILCLLIGAILLLIWQRQKGKTIPLAVIFVLGFFALGLGAIIGFVHKGEDYQAYQKLQWHTLAPEQIAPLV
    AQGYTVFVDITSDW
    CTICQTNKAEVTHREQIVNALMADNIILMQGNWSEANKTIESYMRHEGVPGTPYNKIYGPSAPNGI
    LLPSKLSMSDVLNGLAAAQTNRS

    >gi|152999694|ref|YP_001365375.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MEYPLVSTQWLEAHLTDPHLVLLDASMETVIGKEPLVYDEPICIPRSRRFDLENVFCDKTSTQIHALPTFEQFSQGIAQL
    GIEADSVIVIYDNQGIYSSPRAWWTFKVMGFNRVYVLDGGLPQWIEEDRITSSRYQAEGVDYGPTDIDTLADVLQYHPER
    VMDAEAVLSRIEDAGTAIVDARGAPRFLGQVSEPRPGVRSGHIPRSVNLPFAQVLDGNKIKTTSELQAIYQGLTADKSAR
    IFS
    CGSGITACILILASVAAGHTHPILYDGSWADWGSRTDLPIEC

    >gi|152999741|ref|YP_001365422.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica OS185]
    MTDQADTAMPIQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNDGDFTIEKQGVLLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|152999810|ref|YP_001365491.1| OsmC family protein [Shewanella baltica OS185]
    MGFNLTVNWQTSPAEEGEFCRDHSITFGSGQTIQASSAPEYKGNGQNVNPEESLLAALSSCHMLTFLAIAHLKRLPVTSY
    VDNATAELGKNEAGKLAVTKMVLNPKVMFAEGIEVSQETLEKIHEKAHAN
    CFIANSLATDIHIKF

    >gi|152999880|ref|YP_001365561.1| thiamine biosynthesis protein ThiI [Shewanella baltica OS185]
    MKFIVKLYPEIMMKSKPVRMRFTKMLETNIRNVLKKVDEDAKVQRQWDRIMVMVPKDKPELAQAFGERLACIPGIAHVVQ
    VDEYSFESVDDIYQQVLPVYRDQLAGKTFCVRVKRTGDHDFNSIEVERYVGGGLNQFTDALGVRLKNPDITVNLEIERDN
    LYMVTKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKKGARTHYCFFNLGGAQHEIGVKQVAYHLWKTYGESHKVK
    FISVPFEPVVAEILERIDNGQMGVVLKRMMMRTAARIADRMGIQALVTGESLGQVSSQTLTNLNVIDRCTELLILRPLIA
    MDKQDIINESRKIGTEDFAKSMPEYCGVISQKPTVKAVLAKVEAEEKKFSEDLIDQIIAQSVTIDIREIAEQMDTRITET
    ETVASIDTNQVVIDIRAPEEEESKPLQIEGIEIKRIPFFKLATQFADLDKQKTYLLY
    CERGVMSKLQALYLIEQGYTNVK
    VYRP

    >gi|152999900|ref|YP_001365581.1| glutathione peroxidase [Shewanella baltica OS185]
    MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQGLVILGFPCNQFGAQEKADE
    QGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAPGVLGTQGIKWNFTKFLVNRQGEAIERFASTTKPEALESKI
    AALLK

    >gi|152999925|ref|YP_001365606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella baltica OS185]
    MTKIVIVGGVAGGASAAARARRVSETAEIIMLERGEFISFANCGLPYHIGGEIESREALLLQTPESFKSRFNIEVRVFND
    VIAINRQTKQLSIRNLLTDEVYQESYDKLLLSPGASPIKPPISGINSHFVHSLRNIPDMDKVLANLLLHKPKHATVVGGG
    FIGLEMAEALRHRGLEVSLLELADQVMGPVDVEMANILHQKLVDNGVDLRLKTGLTAVHERPIQPAESDITDDYDTPVFP
    HYHLHLDLSDNSSLATDLVILAIGVKPETRLASECGLTLGKLGGIYVDASMRTSDPDIYAVGDAIETDDFVTGNPILIPL
    AGPANRQGRLAADNMLGGNKLYRATQGTAICKLFDMAIASTGLNEKSLLRQVIPFEKIYVHTASHASYYPRAHPITLKLL
    FCPDNGRILGAQAPLGLMASTNALMC

    >gi|152999926|ref|YP_001365607.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MTVYDLADLELTYAPPFGSARDVVNQAGMVAANVLLGDESICHSQELDHLTAEQVIIDVRNPSELTAVGAIVGAINIPLP
    VLRDRLNELPKDKELLVF
    CQVGLRGHVAYRMLVQHGFKVRNLSGGYKTYQMVNARF

    >gi|153000008|ref|YP_001365689.1| ferredoxin-type protein NapF [Shewanella baltica OS185]
    MTQSINHSRRNLFRRRKDNALRPPWVRDDIEFTDVCTRCSACVEVCETQIIIKGDGGFPEVSFKDNECTFCTLCAKACPE
    NIFDLTQTPWSYHAHIQQSCLTFQGIWCQSCKDACEPRAISFVFNIGQAPRPQIDLELCTGCGACVAPCPSKAIEITRPT


    >gi|153000031|ref|YP_001365712.1| copper-translocating P-type ATPase [Shewanella baltica OS185]
    MSMTRLYVANMNCAGCVAKIEKAFAAQAGVEARVNLADKQVTVEGKMSADTALTVMENAGYPAQVVVDAKVAAEEKRLED
    ATEYRLRMRQAIAALVVGVPMMLWGLLGGEMMINSPAMQLGWGIMGLVTLALLVTTGGHFYQGMWRALKAKTTNMDTLIV
    LGTSTAWAYSMLVVIMPSAFPMDTRHVYFEASVMILGLINLGHGLELKARGKTSEAVQRLLGLQSTTAIRITDKGDEKVE
    ISQLKLGDKLRLRPGDRVALDGEVETGQSLLDEAMLTGEPIPVLKNRGDSVSAGTVNGNGSLVYRVTAGQEDTKLAKIIA
    LVQQAQTSKLPIGRLADRISAVFVPTVVAIALLAAAIWYFVGPAPALSHALVVLTSVLIIACPCALGLATPMSIMVAVGR
    AAQMGVLVKNGEALQTASKVDCVVLDKTGTVTLGKPQVTDFNLVQTLSDADKETLLGEIASLEQHSEHPLAGAIVSYAKQ
    SLSQLPDTQAFTNHQGKGIEGKVDGVSLAIGNLALMTALDIVNSDGSALDPKATLSFAKQGKTPIYVAKAGKLVATIALA
    DPIKPDAKDAIAAMLQRGIRVVLLTGDNPQTAQAVADQVGITEVIAGVLPEQKQQHVLDLQKQGHVVAMVGDGINDAPAL
    VSADVGIAMGSGTEVAIESADITLLSQQLIVIANLLALSRATITNIKQNLFGAFVYNSLGIPVAAGVLYPLTGMLLSPVI
    AGAAMALSSLTVVTNANRLRRQKL

    >gi|153000200|ref|YP_001365881.1| glutaredoxin [Shewanella baltica OS185]
    MFIIRWILGRIILFLNFVFSPKKRQRPLAEQQQIDTQTQALALYQYPACPFCVKVRRAMRRQGLNIVTHDAKKAPHKDEL
    IAQGGKQQVPCLRIEENGQVQWLYESKEIINYLDQRFV

    >gi|153000259|ref|YP_001365940.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MSVLVGRQAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMNASTEGVAAYLSENASSL

    >gi|153000271|ref|YP_001365952.1| glutaredoxin 1 [Shewanella baltica OS185]
    MFVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVR
    ENNLLD

    >gi|153000294|ref|YP_001365975.1| disulphide bond formation protein DsbB [Shewanella baltica OS185]
    MELTLTVITRFAHSRSSWFILAGTALGLELSALYFQHIMNLDPCVMCIYQRLAVFGLLAAGLIGMTAPKYRIVRILAAIV
    WAVSATWGLKLALSLVDMQTNPSPFST
    CSFLPEFPAWMPLHEWFPSIMMPTGMCTDVPWVFMGVTMAEWMVVAFSGFLVA
    WLLFIVPILSGSNKPSLYK

    >gi|153000301|ref|YP_001365982.1| glutaredoxin-like protein [Shewanella baltica OS185]
    METVEKIKQQITENPIIVYMKGSPKLPSCGFSSQVAQIMINCGEQFAFVDILQHPDIRAELPKFANWPTFPQLWIEGELI
    GGCDIVVDMFQKGELQPLIKAAAAKIKTEE

    >gi|153000307|ref|YP_001365988.1| arsenate reductase [Shewanella baltica OS185]
    MTQATIYHNPRCSKSRETLALLEQQGCDITLVEYLKTPPTAEVIGDILAKLGISARELMRTKEAEYQALELADTSLTEQQ
    LIEAMVNTPKLIERPIVLANQRAAIGRPPENVLAIL

    >gi|153000409|ref|YP_001366090.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella baltica OS185]
    MNKLTDFERYVIEEKGTERPFSGEYYDHDAKGLYLCKKCHAPLYRSEHKFNAHCGWPAFDDEIAGAVTRHVDADCRRTEI
    VCSQCGGHLGHVFEGEMLTPNNIRH
    CVNSVSMVFKGMDDAVEPASNSFATFGAGCFWCVEAIFQSLKGVVNVTSGYAGGD
    AHDADYKSVCSGQTGHAEVVHVEFSPEEIDFTTLLQVFFESHDPTTLNRQGNDKGPQYRSVVFAHNAEQIEQTTAMLTQL
    AAAKVFDAPIVTQVSAFETFYPAENYHNDYFALHGEQPYCQMVVRPKVDKVKALFARLQKA

    >gi|153000441|ref|YP_001366122.1| redoxin domain-containing protein [Shewanella baltica OS185]
    MKKILLLLSLMAAGVQAAPSLDHQVFNAQNQAVSLSEFKGKVVYVDFWASWCGPCRKSFPWMNEIQKKYQDQGLAVVAIN
    LDTDNELAQEFLKQVPANFSVRFNPEGDVARSFDLLGMPSSFMFNRQGQLVQHHVGFYADKAAEYEQELVSLLKE

    >gi|153000584|ref|YP_001366265.1| SoxR-reducing system protein RsxE [Shewanella baltica OS185]
    MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDG
    ADQLLGPWAKSLTIHLWQVDTPFLLAMLPPGAFIVMGLLIALKNVIDKKVKERQPQVAAEPSVTRARITKVG

    >gi|153000589|ref|YP_001366270.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS185]
    MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|153000671|ref|YP_001366352.1| peptide methionine sulfoxide reductase [Shewanella baltica OS185]
    MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVKKGKTGHAEVVQVEFDPALVSYEDLLDVFWKNHNPT
    SLNMQGGDIGTQYRSTIFFHDREQKAAAEASKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY

    >gi|153000689|ref|YP_001366370.1| heavy metal translocating P-type ATPase [Shewanella baltica OS185]
    MTHPSCFHCQEPVLTGQQFVTRINDRDELMCCPGCQAVSQAIVDAGLLSYYKFRTEPGSKQNALVPEALTQFSAYDLPEV
    QQDFVHSEDNIESVSLSIDGIT
    CAACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPY
    QVDEQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMLFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLMNDN
    GQEEIPAKKLRLNDVILVKPGEMIAADGVVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQL
    VAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGTLSIGQTQCMADLTNTQALAIAAALEAGSRHPIAAAFAMFADNA
    LVAEEVHHEVGFGVRGRIDGTDYFIGNAVFTGESIDTRDPTQKIWLARSCNEQLEVLASFEIQDNIRQDSKATVEMLKQQ
    GCRISIASGDSSGHVHQLAKELGIDDVHSGLTPADKLALVTRLQQHTRVAMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVSVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV

    >gi|153000739|ref|YP_001366420.1| thioredoxin reductase [Shewanella baltica OS185]
    MSQVRHCNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASARYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVANGNIILHLDQTMDEVVGDAMGVNGLKMKSTKDGSITDLAVAGVF
    VAIGHSPNTGIFEGQLEMNHGYLKVQSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|153000841|ref|YP_001366522.1| UBA/THIF-type NAD/FAD binding protein [Shewanella baltica OS185]
    MQSMSKKTPLSHAEVLCGHIHSDNEHCGHALSDADFIRYSRQVLLPEVGEAGQLQLADASVVIIGLGGLGQLAAQYLACA
    GIGRLTLIDRDKVEVSNLPRQLLFNDADIGLNKAQIAKQKLNRIAPHCTVTAHETAFNAATSAHHLADILQIKQQGKRVL
    VLDCTDNFATRQAINRSCIEAALTLVSASIAAFSGQLFAVDQMQFPSGGCYHCIFPAQTRVSQS
    CSTQGVLGPSVGVMAS
    MQSLVAMQLLLNMDRCDESKNVLLGRFWRFDAKSLSWTAAILTRDPHCDVCGPKEVHSSSDKPSKL

    >gi|153000851|ref|YP_001366532.1| alkylhydroperoxidase [Shewanella baltica OS185]
    MSERIPRQQIYQLQPALANALLSLDKAAGDSHFSPLLVHLVKLRASQLNGCAFCQRRHAEEARNDGEEQLRLDLLAAWHE
    VDGIFNERERAALLWTEILTQVATAPVHDSQYAALAEHYSEKEIVDLTSLIIAINGWNRIAIAFHLQPI

    >gi|153000873|ref|YP_001366554.1| arsenate reductase and related [Shewanella baltica OS185]
    MLTLSQRHILLVTCGAQCHNASKINACQPSVHPHWSIILTLYGIKNCDTVRKARKWIENHQLPVHFHDFRDDGLRQEDLE
    FWCNTSGWETVFNKRSTSFRALSDADKTDIDQAKAIQLMLAQPTLIKRPVLVVGEHVLIGFDEAAYKRVFSL

    >gi|153000886|ref|YP_001366567.1| hypothetical protein Shew185_2366 [Shewanella baltica OS185]
    MTKVVVCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLLWLNSQNGLDNIVHKLSFDD
    EMPFYRTKVKLKNEIVTMGVEGIDPLKVVGTYVKPQDWNALISDPDVILVDTRNDYEVQIGTFKNAVNPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVKAEESLWEGECFVFDNRVAVNHDLKKGQ
    YDQCNACRMPITEAEKQSPAYVQGVSCPHCIDKISDEQRKRFVERERQVNLAKARNEAHIGSDVNQVIEARREKKEAQRR
    LAAEKNNAKKSQVL

    >gi|153000887|ref|YP_001366568.1| glutathione S-transferase domain-containing protein [Shewanella baltica OS185]
    MALAVLYTFRRCPYAMRARLGLLLAQCNVEVREITLKAKPAQMLAASPKGTVPVLVLANGEVIAESIEIMRWALTQADPL
    DLLCQQSPVIEDKMAQLITQNDQQFKPWLDRYKYADRYPEQTPSDYYQQASHFLTQLEACLGQHFFLVADTPRLADYAIV
    PFIRQFAAVDLKRALSDDFPRLAAWLENLISSEIFIRAMEKYVIWDASHSPTCLLGDM

    >gi|153000904|ref|YP_001366585.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica OS185]
    MAITMTPAAADRVRSFLVNRGKGVGLRLGLRTSGCSGMAYVLEFVDSLNDDDEVFDIEDVKIIIDAKSLIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|153001109|ref|YP_001366790.1| thioredoxin-dependent thiol peroxidase [Shewanella baltica OS185]
    MNTLTAGAKAPQFTLQDQHGTSVSLADSLKQGPVLVYFYPKAATPGCTVQACGLRDSKAALDSHNVTVFGISPDPVAKLA
    KFAEKQALNFTLLSDEDHSVADAFGVWGEKKFMGKTYDGIHRLSFLINTDGTIAHVFDKFKTKDHHEVVLAQIAG

    >gi|153001192|ref|YP_001366873.1| DSBA oxidoreductase [Shewanella baltica OS185]
    MSVFNRVRPIAALACGLMLSASFALQAASFEEGKDYVTVAGITEAQKPVLREFFSYNCPHCYKQEPLMDLTVQLLGKDVA
    FERTPVGAGRPAWELSQLAYYVAQKLKMTKQTHGAIFKQIHEKGEQFTAPEQVKAFFVAQGAKVGDVDAAMNSVDAKFTL
    MNYDSQAELAGIKGVPSLLVNGRYMLTSTAHTPEELAALVKFLAAK

    >gi|153001259|ref|YP_001366940.1| DSBA oxidoreductase [Shewanella baltica OS185]
    MDKTIIIDYYTDILCVWAWIAQKRVDELNKQLGNNIELQYHYLDVFGDVPTKITTQWQSKGGFMGFAEHIQQSVSAFEYA
    DINPKVWTQVRPTTSANAHLMLKAVEITYDKKKSIDMALTFRTAFFVDGLDIGNLGVLCDLVNANGLDLNAINTSIRDGS
    AMASLMSDYQQSKRQNINGSPSFVLDGGRQTLYGNVGFDVILANIEALLKHSTDEASWC

    >gi|153001313|ref|YP_001366994.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MTHNLVIRGQSLMRLALLSLQSLVLMPLLLMPMMASATNQDPVIAWDKIAAGAMVLDVRTPEEFAEGHLANAVNIPFEQV
    AEEFAKRGIAKDAPVVLY
    CRSGRRSSVATEALVAAGYTQTYNGGGYSTLVEAQKTPAK

    >gi|153001318|ref|YP_001366999.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MPHPSAFSALVDAILPNITEVTIEAYQADDSWHLVDVREDREWLQDHLPQAKHLSRGILERDIEARFPDKHTPILLYCAG
    GARSALAAHNLQLMGYTRVASLIGGYKGWVQRQLPVVQD

    >gi|153001335|ref|YP_001367016.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella baltica OS185]
    MKHAIRQLSQAPSIAEYQPCAVGTFISPAGILQLNANAYGLSHLTVVGSDRTEIALAKASEDALNQAKAHIRETQAQLAD
    YFAGERVEFDLKLAPKGTEFQRDVWQALLNLDYGQSCSYGQIAEQIGRPKAVRAVGAANGANPIAIIVP
    CHRVIGKNGKL
    TGYAYGLAMKQQLLTLETDKHCLDI

    >gi|153001542|ref|YP_001367223.1| redoxin domain-containing protein [Shewanella baltica OS185]
    MQKYVSFLAASCIYGLVLISPNVLASEKTQVLMGEKTVTLEGKLPKLSQMAPGFKVVDDHFSPVMLSDFKGKTVLISAVP
    SLDTGV
    CALQTKRFNSEVGHFSDDVVMLTISADLPFAQKRFCKVENVDKIKVLSDSVWRDFGEKYGLLIQDYGLLARAIF
    IIDAEGKLQYQELVPNITEHPNYDAALEALKTIQAQQ

    >gi|153001550|ref|YP_001367231.1| glutathione peroxidase [Shewanella baltica OS185]
    MGCFLLVSLDFRSAQSVLLHRYAVVNHSFYFLIQYDLYLVRLRNVPVKEKAMKKLPMIFAMTASLMSVGAMAATCPEYLN
    LEVRKLHSEETVNLCELTQGKPVLIVNTASN
    CGYTPQFKALEALHENYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYIN
    YGVTFTMLSTSAVRGSDANSVFKYLAEKTGAPKWNFYKYVVSGDGAVVQQFNSKVKPDSEELKQAIESVL

    >gi|153001585|ref|YP_001367266.1| heavy metal transport/detoxification protein [Shewanella baltica OS185]
    MKLVLFLALSLCSASSWAANVLVTLNVKGMTCPLCVTVVNKALRKTDGVIKAKASLKTEQAIVTVPEDFNLDNLLKAVDE
    TGYKGSINKIEKQA

    >gi|153001586|ref|YP_001367267.1| mercuric transport protein MerT, putative [Shewanella baltica OS185]
    MTTSQPNNAKGLLATMAAAVIAAVASSLCCIAPLIYLVFGVSAASLSGIEQLSWLQVPMLILSTGLILMGFWRLYFAKKL
    LCTATLSRTQMVWLYWLTVPVVLAFQLYPFVLPWLLEVFE

    >gi|153001615|ref|YP_001367296.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MSTILKTLCLAGTLLLTSFTTLAQPIARDEFSISPLLNGQQIPKVNLQDIKGKTVDLAELTQQKPTIFFFYRGGWCPFCN
    NQMGQLKAIEPELLKMGFQLVGISPDTPAQLKASAAKNELKYLLLSDEKMLAAQAFGLAFYTSEKVTEIYTSRLHVDNPM
    WTTPEGAKRLVLPVPAIYISDDKGLIHFQYVNPNYKVRPAPKLILTAASLVGSQE

    >gi|153001943|ref|YP_001367624.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS185]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPANQVIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYKLGESVVFGFGSGVGWALAIVL
    MAGIREKLKYADVPNGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|153001944|ref|YP_001367625.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS185]
    MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQLLQAYAYQISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSL
    FGVEILHKISDGGWYQPNGLLLLPPSAFFLIGVLIWIIRTYKPEQVEAKG

    >gi|153002008|ref|YP_001367689.1| OsmC family protein [Shewanella baltica OS185]
    MKTLYETRATAKAGRQGQVSTDDGLLDVALAYPKAMGGSGLATNPEQLFAAGYAACFSNAVLHVAKIGKVDITEAPVSAV
    VGIGANDAGGFALAVALEVSLDLPQEAAEALVRHAHQV
    CPYSNATRNNIDVKLSVNGVALG

    >gi|153002009|ref|YP_001367690.1| hypothetical protein Shew185_3500 [Shewanella baltica OS185]
    MTKYLSKISLFCSLLFLFAFSIPSWAETAPASSADQTWHYVNAQGELKIKLYFFWSKTCPHCAEAHPFIDSLPQKYPWIE
    LESHMVSAPGVQDIWQTIAAKTTTEARSVPYMASCEKAVVGYSSEAVTGEFLVNRLKNCYLSLGGKLSEADLPTKGVVST
    SASTETDAPLFGTCGTDTGEGTCDATSLGDATKASPVQSEVQPVELPLVGVVTPETMSLPLLTLVLAGVDAFNPCAFFVL
    LFLLSIMVNAKSRSRMLLVGGIFVFFSGFIYFLFMTAWLNIFQLLGAGSDGGMIILAAGCLALIAGVINIKDYFFTKGEV
    TLSMSAENRTSLIKRMGKLSNSSSLGALLIGSTVLAVLANAYELLCTAGFPMIYTSVLSMHNLPDIERYMYLVLYNIVYV
    IPLAIIVIVFSATLGKRKLTEKEGQALKLMSGVMMLGMGIALVIDPTALQNVALALGLILGSLGITAIIVIGRKLFSAKA
    K

    >gi|153002026|ref|YP_001367707.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MTQSIINSTIKPFKATAYHNGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADYYEQLKGMGVEVYSVSTDTHFT
    HKAWHDTSDTIKKINFPMLADPTGTISRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIGRSAQELVRKIQAAQYV
    ATHDGEVCPAKWQPGDDTLAPSLDLVGKI

    >gi|153002027|ref|YP_001367708.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella baltica OS185]
    MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERTPAMTVINPQLNTQISFAGLP
    MGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFETYVSLT
    CQNCPDVVQALNMMAAINPNITNVMIDGALFQDE
    VASRNIMAVPSVYLNGEVFAAGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELELASGAKLRSRTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNI
    KIITQAMTTEVTGDGTRVNGLNYTDRATGESHHVALAGIFVQIGLVPNTEWLKGVVELTPRGEIIVDARGQTSIPGVFAA
    GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA

    >gi|153002032|ref|YP_001367713.1| thiol:disulfide interchange protein DsbC [Shewanella baltica OS185]
    MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMTNRGVLYISRDGSKLFHGSLY
    DLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHVVTVFTDVS
    CGYCRKLHSQMADYNKLGITVRYLAFPRAGVP
    SANADEMQAIWCAKDPLKAMTDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
    Q

    >gi|153002068|ref|YP_001367749.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS185]
    MEHYINLFLQATFIDNMALSFFLGMCTFLAVSKKVSTAFGLGVAVIVVMTLAVPLNQIIYVKVLAPGALSWAGLPGIDLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFGESVVFAMGSGLGWAVAIVL
    LAGLRERMKFNAIPEGLQGIGITFITTGLMALGFMSFSGISL

    >gi|153002069|ref|YP_001367750.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella baltica OS185]
    MSNTLSMRDMLTGPVFANNPVAMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPTSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVGLIITN
    CIIMGRAEAFAMKYPPHLAVVDALGNATGYGLILISVAFVRELLGTGNL
    FGHSVFTTIENGGWYLPNEMFKLPPSAFFLIGVLIWTINVIQRKRG

    >gi|153002171|ref|YP_001367852.1| hypothetical protein Shew185_3664 [Shewanella baltica OS185]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISDKDREGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPNGASSTFILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFALEEDDALPAGILDDYCLEIYNPDDELCGSHLIDTNSGNVKRGICAIPYTRKSNGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMSVLEKYPSILAGIKGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRF
    FSSKFDYEFCEWDFSGTSEEEADGLFGILEALGKEVYIAEFTDLGASACRILVPDYSEIYPVDDLIWDNTNKALAYREDI
    LNLHSLSTKQLANLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHEDAIELVGEFLQFNDNTV
    KRGLFYQAMNAVLEVTLDDELELDDFIHNFNRMFGKEVMDNVVGSVTGKVRFYGLTKTSMQLEGIEPHLRLIESYKKLHQ
    ARKAAKDLN

    >gi|153002240|ref|YP_001367921.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Shewanella baltica OS185]
    MDKSKRQFLGKMASVSVGAALIPVVQVYAQDDKRSPQVHSASEGQVGKRYGMVIDLRRCVGCQACTVACTIENQPPLGQF
    RTTVQQYEVSQQEDTTPPAFLMLPRLCNHCENPPCIPVCPTGATFQRKDGIVVVNNEWCVGCGYCVQACPYDARFINHDT
    NTADKCTFCAHRLDAGLLPACVETCVGEARVIGDLNDPHSQISQLLATNKTDIKVLKPTANTSPRVFYIGMSSAFVDKIS
    GQAPVRTLLTDTGEEIHHGH

    >gi|153002337|ref|YP_001368018.1| redox-active disulfide protein 2 [Shewanella baltica OS185]
    MKQVKVLGSGCAKCSKTAEMIADISEEMGVDAIVKKDTDPQTLLKFKVMKTPAVVIDGELIHSGSVPTRDEIEGWLRD

    >gi|153002382|ref|YP_001368063.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MMNNVIRQSLIGGLMALSLGGISLPAIAGGGSDISEAPYNEIQLNPISMREAETLVGKQEVYFFDVNTLEIWAEGFVPGA
    VFFNVQNWRELLPKNKDAVMVFYCANRL
    CTASNMAARETMKLGYTGVRHMADGIFGWRMSGRATEKP

    >gi|153002386|ref|YP_001368067.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MKLCSMRLILLCSFVLLNNSVQAHSLQNKLYDTGEAIPKPRVMTGFVEMQHARGVPDVPFIDEAGKTQTLKQHQGKLVLV
    NLWATW
    CAPCLREIPELQHLKQEYQGKNIAIVPISIDEEPKDVRPFLTQHNFSDYQTWFDPTQNIEQIIPANVVPATYFF
    DAKGNLVGFVRGYLDWGDKDVIPYLDKLITKYGQ

    >gi|153002393|ref|YP_001368074.1| redoxin domain-containing protein [Shewanella baltica OS185]
    MQVVYQFKENTMLLRQIIVMCLAVVSFATFAGDKAYQDIALKTYPEQQQVTLGSVAGDKPIYLKFWATWCQPCMEQMPHF
    EALQKKYQDKINIVALNININEEQPKIADVIARFGLTMPVWLDNEGELGVALGLVGTPYSVLINRAGDVVYTSHESDANF
    DKFIDMLANGQELTAQTTEAPSAAQTAKLLKPWEQGEHLLFFTATW
    CDWYLAESRPEMSKECIAVQKGLNNLAQKVPNKA
    WHGVVNHLWTDDKALEDFKQLYQTKIDFSIDELGVLFNHFKIRNIPTLLWVKDGKIVQRITDFSQPEQLVKQLSAQ

    >gi|153002412|ref|YP_001368093.1| thioredoxin [Shewanella baltica OS185]
    MGEIIITQPLNNRPLAQYISRIDILFWSFAMIIACPHCDTLNRVPDERVNQQPTCGKCKLSVFTAAPIELTSANFANHAK
    KSELPLVVDFWASW
    CGPCKSFAPVFSAAAKTWEPQFRFGKINTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQS
    ALNQWLKSHS

    >gi|153002436|ref|YP_001368117.1| dihydrolipoamide dehydrogenase [Shewanella baltica OS185]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETIIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPT
    IDLDKLRGFKEKVIGQLTGGLGGMSKMRKVNVVNGFGKFTGPNTLEVTAEDGTVKVVQFEQAIIAAGSRPIKVPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYASLGSEIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAREDGIYVSMEGKSAPTEAVRYDAVLVAIGRAPNGKSLDAEKAGVNVDERGFIKVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDASEGMTKL
    IFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKK

    >gi|153002452|ref|YP_001368133.1| thioredoxin domain-containing protein [Shewanella baltica OS185]
    MHNNVKAFLATTALFFSCQVLANGGCGFEEQQQGLIATCSEEKQEVILTGIVEAQHLVTDLNEFAEGYKSYQVDTAAITP
    LKSVTEPTEIVVIIGTW
    CPDCHRETPRFIRIMEEVANSNIKVTYIGVDRTKKDPKGLAAKYDFTRIPTFIVLQQGKEVGR
    IVERPTVSLEKDLADLLK

    >gi|153002455|ref|YP_001368136.1| thioredoxin [Shewanella baltica OS185]
    MSDKIIYLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKNGELAATKVGALSKTQLKEFIDAQI

    >gi|153002535|ref|YP_001368216.1| DSBA oxidoreductase [Shewanella baltica OS185]
    MKKVLLMAAALLLAPLAVSAVEYQEGVHYTVINDGPATAKPEITEFFSFYCPHCFNFSKTVVPKILAEKPEGVAFNQAHV
    DFIGKEMGVEMSRAFAVAHQLNVDDKMDAALFSAIHEKKEHFTSLADIRALFVANGVDGKTFDAAAESFMVKAQMAKMKR
    DTENAKLTGVPALVVNGKYRVETGAIKSYDELLDIAFYLAKK

    >gi|153002538|ref|YP_001368219.1| hypothetical protein Shew185_4038 [Shewanella baltica OS185]
    MKFKQDFFTQLPEFYSQVYPQGITKPEWLAWSDDAAQLIGLSQPTDELLLGLSGNAAVDGATYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGAWDVALKGGGPTPYSRRGDGRAVMRSAVREFLVSEALHHLHVPTTRALAVIGSDLPVWRESQET
    AAITVRLARSHIRFGHFEFFCHSERGRADKLIQLLNFTITQHYPHLSCDAAGYKAWFLQVVQDTAKMIAHWQAVGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPEGRYAFGQQPGVGLWNLQRLAQALTPVIPSDDLIAILNQYQEALV
    QTYLRLMRAKLGLSAVDVPSVEQDKQDLDLIGRFTVLMEKNQLDYTQTWRQLGKLDPTSKHSALRDDFIDVSQFDAWYQS
    YQQRLGAVADIPTWQTERNSVNPKYILRNYLAQEAIIAVEEGNLAPLHLLQKILTQPFAEHAEHEDLAKRPPDWGQGLIM
    S
    CSS

    >gi|153002541|ref|YP_001368222.1| DsrE family protein [Shewanella baltica OS185]
    MQSILIVAHASPYGTEKLFNSLRIALALKDQDEQAVDLKLFLMSDAVFGALKNQTTPDLSYNLQQMFEILSAQQVPILLC
    KTCAQARGVTAEMIIEGAHIGTLQDLTRWTLAADKVMHI

    >gi|153002707|ref|YP_001368388.1| redoxin domain-containing protein [Shewanella baltica OS185]
    MIAQGQTLPAATLGQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKGVDLIACVAVNDAF
    VMKAWGEAQNASELMMLADGDASFTKALGLEMDTAGFGGVRSQRYAMIIDNGVVTLLNVEEPKAFEASKAEVVLAAL

    >gi|153002721|ref|YP_001368402.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS185]
    MSAEQVSTSLPKRILGWIKQLALWLLIALIVTSVMDIWRGKDIPRDNLPQLQGTTLAGDTLDIATLSQDQAVLVYFWGTW
    CPVCNFVSPAVNQMSAYYPVVTVAMSSGEDEKLRKYLQHQDYGFDTINDSDSKIARDWSLQATPTIMIFKDGELKHYTTG
    FTSLPGMWWRMMFT

    >gi|153002722|ref|YP_001368403.1| DSBA oxidoreductase [Shewanella baltica OS185]
    MKQTIEAQNITESMQNTQVIGGTKMSKFSSLFKHRKLQMFAVSGVAMAMLVVSLPSVSTMAYAKDNSLSAAQQQEVRAIL
    KDALINDPDLMREAIIAWQAREQEGANTAMQTSLVTHHKAMYETKSDPWKGSATPEIEMVYFTDFN
    CPYCKKIEPSLNQL
    IEEFPQLKIIVKMVPLQGEGSKMAVDFAQTVWLNEPEKYLKVKDMLMSSPRGLDAAAIAKVAKLTVTERWVGNTDARVAK
    MVDDNVNLMNELGIGGTPSMIVADTLIPGLVPYEVLKEQLEAAIAAKDKTQKSS

    >gi|153002723|ref|YP_001368404.1| cytochrome c biogenesis protein transmembrane region [Shewanella baltica OS185]
    MSTLKSMLTRFWILALIVTSPSLLAASTGWLVNDNHPPAKVRFMLTGEVDSATNTLPAVLEVQLEGDWKTYWRSPGEGGI
    APTIKWDGSHNLQQVDWRWPAPEEFSLLGLQTFGYKGNTTFPLTLKVDDIAAPTQLRGKVTLSTCTTICVLTDYQISLDF
    TPNALQADTDAMLAYNKAVSLVPQKVLSQESQNPAMTMGWDVAKGQLEVRLNDANWQQPTVIIDGEPDTTFKLVSLKPIE
    SDANGKQLVGIFSGKSWLGEPEVLGKSLNITVADSERALEYSAEVKPVVITQASTSIFGMILLALIGGLILNVMPCVLPV
    LGMKLSSVVAAPDLKRNQIRQQFIASALGILASFWLLAGFILMLKLTGQAIGWGVQFQNPWFIGFMALVTTVFAFNMLGV
    FEINLPSNVQTKLATTGGNNNSGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSLFAIFTALAVGMAFPWLIVAAFP
    QVAGYFPKPGRWMNTVKVFFSGMLLITSLWLISLLASFIDVIYLWPLAGVITLIFMVFMAKKYGAIAIVSCLGVGILLSA
    VIAFMTANQWAKPLPADLAWTPLDQALINQQVAQGKTVFVDVTADW
    CITCKANKVGVILQDPVYSLLQQPHILPMKGDWT
    TPSEPITHYLQSHNRFGVPFNVVYGPGAPQGIELPEILSTDLVLAAIEQASASPEKSSVAAGK

    >gi|153002757|ref|YP_001368438.1| glutathione reductase [Shewanella baltica OS185]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFD
    WNTLVENREAYIGRIHDAYGRGFANNKVTLLNGYGRFVDGNTIEVDGEHYTADHILVATGGAPTIPNIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAMATEGPTLHTHSVPKAVVKNADD
    SLTLSLENGESITVDCLIWAIGRSPATGNIGLENTEVQLDSKGYVITDEQQNTTHKGIYCVGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSLIPTVVFSHPPIGTMGLTEPEARTHYGDDNVKVYTSTFTSMYTAVTAHRQACKMKLVCAGKD
    EKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFATMKG

    >gi|153002838|ref|YP_001368519.1| rhodanese domain-containing protein [Shewanella baltica OS185]
    MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNNENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCE
    QGFDDVYSLDGGYSAWHEANA