Shewanella baltica OS155 uid58259

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126090129|ref|YP_001041610.1| hypothetical protein Sbal_4492 [Shewanella baltica OS155]
    MTHPSCFHCQEPVLTGQQFVTRINDRDELMCCPGCQAVSQTIVDAGLLSYYKFRTEPGSKQNALVPEALTQFSAYDLPEV
    QQDFVHSEDNVESVSLSIDGIT
    CAACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPY
    QVDEQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLVNDN
    GQEEIPAKKLRLNDVILVKPGEMIAADGVVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQL
    VAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGTLSIGQTQCMADLTKTQALAIAAALETGSRHPIAAAFAVFADNA
    LVTEEVHHEVGFGVRGRIDGTDYLIGNAVFTGASIDTRDPTQKIWLARSCNEQLEVLASFEIQDNIRQDSKATVEMLKQQ
    GCRISIASGDSSGHVHQLAKELGIDDVHSGLTPADKLALVTRLQQHTRVAMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVSVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV

    >gi|126090147|ref|YP_001041628.1| hypothetical protein Sbal_4510 [Shewanella baltica OS155]
    MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVKKGKTGHAEVVQVEFDPALVSYEDLLDVFWKNHNPT
    SLNMQGGDIGTQYRSTIFFHDREQKAAAETSKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY

    >gi|126090182|ref|YP_001041663.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella baltica OS155]
    MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|126090187|ref|YP_001041668.1| SoxR-reducing system protein RsxE [Shewanella baltica OS155]
    MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDG
    ADQLLGPWAKSLTIHLWQVDTPFLLAMLPPGAFIVMGLLIALKNVIDKKVKDRQPQVAAEPSVTRARITKVG

    >gi|126172312|ref|YP_001048461.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNNENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCE
    QGFDDVYSLDGGYSAWHEANA

    >gi|126172376|ref|YP_001048525.1| glutathione-disulfide reductase [Shewanella baltica OS155]
    MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHVAEAMNLYAKDYGFDVTVNKFD
    WNTLVENREAYIGRIHDAYGRGFANNKVTLLNGYGRFVDGNTIEVDGEHYTADNILIATGGAPTIPDIPGAEYGIDSDGF
    FALREQPKRVAVVGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVEAMATEGPTLHTHSVPKAVVKNADD
    SLTLSLENGESITVDCLIWAIGRSPATGNIGLENTEVQLDSKGYVITDEQQNTTHKGIYCIGDIMAGGVELTPVAVKAGR
    LLSERLFNGMTDAKMDYSLIPTVVFSHPPIGTMGLTEPEARTHYGDDNVKVYTSTFTSMYTAVTAHRQACKMKLVCAGKD
    EKVVGIHGIGFGMDEILQGFGVAMKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|126172486|ref|YP_001048635.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Shewanella baltica OS155]
    MKKLVLFIPLVIFLAMGVFLYKGLFLNPQQLDSALEGKPIPAFQLERLETPAEIITNEQLKGKVSLLNVWATWCPSCKYE
    HPFLVMLKRKNLLPIYGINYRDERAPALEELKRQGDPYNVNIYDKDGRLGLDLGVYGAPESFVVDHNGIIRFRYAGPIDL
    RVWSETLYPMIQQLQAEAAKDGAS

    >gi|126172488|ref|YP_001048637.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MKHKVIKALLLSSLFSLLAGGVAHAYPGMQQATKPMESTVDLINVLPKTFPIEPVAFNDVDGKAIDFSQFKGKIIMVNMW
    ATW
    CPPCVRELPAIERLATKFKAEDFVLLPISIDAEGKQQVQPFLNSLGMPNFNSYYDQSQSLGDVFPLDTIPATFILDQ
    QGQLIAFVRSYVDWDDAKAVSLIQGFIDKGSKKPN

    >gi|126172575|ref|YP_001048724.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MFQSLLAKLSGSQSGEKCWQLIEQGARVIDVRSPEEFASGHLPQAINVPLPTLDQWLHQVDNKQHPFVLYCGAGIRAQKG
    CDILKANGFGCVVNGGSLKDLVCCQPS

    >gi|126172680|ref|YP_001048829.1| thioredoxin [Shewanella baltica OS155]
    MGEIIITQPLNNRPLTQYISRIDILFWSFAMIIACPHCDTLNRVPDERVNQQPTCGKCKLSVFTAAPIELTSANFANHAN
    KSELPLVVDFWASW
    CGPCKSFAPVFSAAAKTWEPQFRFGKINTEEQQALAAQFNIRSIPTLMIFKQGKILAQQAGALPQS
    ALNQWLKSHS

    >gi|126172698|ref|YP_001048847.1| redoxin domain-containing protein [Shewanella baltica OS155]
    MQVVYQFKENTMLLRQIIVMCLAVVSFATFAGDKAYQDIALKTYPEQQQVTLGSVAGNKPIYLKFWATWCQPCMEQMPHF
    EALQKKYQDKINIVAVNININEEQPKIADVIARFGLTMPVWLDNEGELGVALGLVGTPYSVLINRGGDVVYTSHESDANL
    DKFIDMLANGQELTAQTTEAPSAEQTAKLLKPWEQGEHLLFFTATW
    CDWYLAESRPEMSKECIAVQKGLNNLAQKVTNKA
    WHGVVNHLWTDDKALEDFKQLYQTKIDFSIDELGVLFNHFKIRNIPTLLWVKDGKVIQRITDFSQPEQLVKQLSAQ

    >gi|126172743|ref|YP_001048892.1| redox-active disulfide protein 2 [Shewanella baltica OS155]
    MKQVKVLGSGCAKCSKTAEMIADISEEMGVDAIVKKDTDPQTLLKFKVMKTPAVVIDGELIHCGSVPTRDEIEGWLRD

    >gi|126172892|ref|YP_001049041.1| hypothetical protein Sbal_0643 [Shewanella baltica OS155]
    MEIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCKARDIPTDNIRLSQNNIVDPE
    DRYNQIFQIQVELPEDISDKDREGILRSIDRCTVKKVVQTGPEFKIETVENLDADANAMLMGQPNGASSTFILGKDLPLE
    QTIANMTGMLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLNNNFFYNDQFFGTE
    IANSEFVHYPNEKWFALEEDDALPAGILDDYCLEIYNPDDELCGSHLIDTNSGNIKRGICAIPYTRKSDGETVYFPSNLI
    ENLFLSNGMSAGNNLQEAHVQCLSEIFERAVKRQIIEQEIVLPDVPMQVLEKYPSILAGINGLEEQGFPVVVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVSEPENFVEHFIDSTGVISWRF
    FSSKFDYEFCEWDFSGSSEEEASGLFGILEALGKEVYIAEFTDLGASACRILVPDYSEIYPVDDLIWDNTNKALAYREDI
    LNLHSLSTKQLVNLVNRLEESQLDNYTDIRTLIGIVFDENTVWGQLTIIELKILIYLALGAHEDAIELVGEFLQFNDNTV
    KRGLFYQAMNAVLEVTLDDELELDDFIHNFNRMFGKDVMDNVVGSVKGKVRFYGLTKTSMQLEGIEPHLRLIESYKKLHQ
    ARKAAKDAN

    >gi|126173003|ref|YP_001049152.1| NADH:ubiquinone oxidoreductase, subunit D [Shewanella baltica OS155]
    MSNTLSMRDMLTGPVFANNPVSMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPTSVRIIAQMTVIA
    SLVIIVDMVLQDVAYELSKQLSVFVGLIITN
    CIIMGRAEAFAMKYPPHLAVVDALGNATGYGLILISVAFVRELLGTGNL
    FGHSVFTTIENGGWYLPNEMFKLPPSAFFLIGVLIWTINVIQRKRG

    >gi|126173004|ref|YP_001049153.1| NADH:ubiquinone oxidoreductase, subunit E [Shewanella baltica OS155]
    MEHYINLFLQATFIDNMALSFFLGMCTFLAVSKKVSTAFGLGVAVIVVMTLAVPLNQIIYVKVLAPGALSWAGLPGIDLS
    YLQLITFIGVIAALVQILEMFLDKYIPSLYDSLGIFLPLLTVN
    CAIFAGVIFMANRDYNFGESVVFAMGSGLGWAVAIVL
    LAGLRERMKFNAIPEGLQGIGITFITTGLMALGFMSFSGISL

    >gi|126173089|ref|YP_001049238.1| thiol:disulfide interchange protein DsbC [Shewanella baltica OS155]
    MKLTRALSLIFALVVAPLANAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMTNRGVLYISRDGSKLFHGSLY
    DLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHVVTVFTDVS
    CGYCRKLHSQMADYNKLGITVRYLAFPRAGVP
    SANADEMQAIWCAKDPLKAMTDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
    Q

    >gi|126173093|ref|YP_001049242.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Shewanella baltica OS155]
    MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLAQDIVSLSSLVSLKETQGERTPAMTVINPQLNTQISFAGLP
    MGHEFTSLVLALLHTGGHPIKLSDDIIEQIRNLPGKYAFETYVSLT
    CQNCPDVVQALNMMAAINPNITNVMIDGALFQDE
    VASRNIMAVPSVYLNGEVFAAGRISIGEILNKLDTNTASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
    DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLSTDGLFELELASGAKLRSRTVLLATGARW
    REMNVPGEKEYRGKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNI
    KIITQAMTTEVTGDGTRVNGLNYTDRATGESHNVALAGIFVQIGLVPNTEWLKGVVELTPRGEIVVDTRGQTSIPGVFAA
    GDVTDTPFKQIIIAMGSGASASLGAFDYLIRHSDEEIAETKTTDTKAA

    >gi|126173094|ref|YP_001049243.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MSCYELKQSSTKWKHKMTQSIINSTIKPFKATAYHNGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADYYEQLK
    GMGVEVYSVSTDTHFTHKAWHDTSDTIKKINFPMLADPTGTISRNFGVMIEEDGLALRGTFVINPEGQIKVSEVHDLGIG
    RSAQELVRKIQAAQYVATHDGEVCPAKWQPGDDTLAPSLDLVGKI

    >gi|126173109|ref|YP_001049258.1| hypothetical protein Sbal_0864 [Shewanella baltica OS155]
    MTKYLSKISLFCSLLFLFAFSIPSWAETAPASSADQTWHYVNAQGELKIKLYFFWSKTCPHCAEAHPFIDSLPQKYPWIE
    LESHMVSDPGVQDIWQTIAAKTTTEARSVPYMASCEKAVVGYSSEAVTGEFLVNRLKNCYLSLGGKLSEADLPTKGVVST
    SASTETDAPLFGTCGTDTGEGTCDATSLGDATESSPAQSEVQPVELPLVGVVTPETMSLPLLTLVLAGVDAFNPCAFFVL
    LFLLSIMVNAKSRSRMLLVGGIFVFFSGFIYFLFMTAWLNIFQLLGAGSDGGMIILAAGCLALIAGVINIKDYFFTKGEV
    TLSMSAENRTSLIKRMGKLSNSSSLGALLIGSTVLAVLANAYELLCTAGFPMIYTSVLSMHNLPDIERYMYLVLYNIVYV
    IPLAIIVIVFSATLGKRKLTEKEGQALKLMSGVMMLGMGIALVIDPTALQNVALALGLILGSLGITAIIVIGRKLFSAKA
    K

    >gi|126173110|ref|YP_001049259.1| OsmC family protein [Shewanella baltica OS155]
    MKTLYETRATAKAGRQGQVSTDDGLLDVALAYPKAMGGSGLATNPEQLFAAGYAAGFSNAVLHVAKIGKVDITEAPVSAV
    VGIGANDAGGFALAVALEVSLDLPQEAAEALVRHAHQV
    CPYSNATRNNIDVKLSVNGVALG

    >gi|126173172|ref|YP_001049321.1| NADH:ubiquinone oxidoreductase, subunit D [Shewanella baltica OS155]
    MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIA
    SLVIVVDQLLQAYAYQISKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSL
    FGVEILHKISDGGWYQPNGLLLLPPSAFFLIGVLIWIIRTYKPEQVEAKG

    >gi|126173173|ref|YP_001049322.1| NADH:ubiquinone oxidoreductase, subunit E [Shewanella baltica OS155]
    MEHYISLLIRSVFIENMALAFFLGMCTFLAVSKKVTTAMGLGIAVVVVLTISVPANQVIYQGLLAPGALAWAGAPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYKLGESVVFGFGSGVGWALAIVL
    MAGIREKLKYADVPNGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|126173204|ref|YP_001049353.1| thiol:disulfide interchange protein, putative [Shewanella baltica OS155]
    MSTITLISIIILCLLIGAILLLIWQRQKGKIIPLAVIFVLGFFALGLGAIIGFVHKGEDYQAYQKLQWHTLAPEQIAPLV
    AQGYTVFVDITSDW
    CTICQTNKAEVTHREQIVNALMADNIILMQGNWSEANKTIESYMRHEGVPGTPYNKIYGPSAPNGI
    LLPSKLSMSDVLNGLAAAQTNRS

    >gi|126173342|ref|YP_001049491.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MLQYHPERVMDAEAVLSRIEDAETAIVDARGAPRFLGQVSEPRPGVRSGHIPRSVNLPFAQVLDGNKIKTTSELQAIYQG
    LAADKSARIFS
    CGSGITACILILASVAAGHTHPILYDGSWADWGSRTDLPIEC

    >gi|126173402|ref|YP_001049551.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica OS155]
    MTDQADTAMPIQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNDGDFTIEKQGVLLVVDPMSLQY
    LVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|126173472|ref|YP_001049621.1| OsmC family protein [Shewanella baltica OS155]
    MGFNLTVNWQTSPAEEGEFCRDHSITFGSGQTIQASSAPEYKGNGQNVNPEESLLAALSSCHMLTFLAIAHLKRLPVTSY
    VDNATAELGKNEAGKLAVTKMVLNPKVMFAEGIEVSQETLEKIHEKAHAN
    CFIANSLATDIHIKF

    >gi|126173600|ref|YP_001049749.1| thiamine biosynthesis/tRNA modification protein ThiI [Shewanella baltica OS155]
    MKFIVKLYPEIMMKSKPVRMRFTKMLETNIRNVLKKVDEDAKVQRQWDRIMVMVPKDKPELAQAFGERLACIPGIAHVVQ
    VDEYSFESVDDIYQQVLPVYRDQLAGKTFCVRVKRTGDHDFNSIEVERYVGGGLNQFTDALGVRLKNPDITVNLEIERDN
    LYMVTKRIEGLGGFPMATQEDVLSLISGGFDSGVSSYQFIKKGARTHYCFFNLGGAQHEIGVKQVAYHLWKTYGESHKVK
    FISVPFEPVVAEILERIDNGQMGVVLKRMMMRTAARIADRMGIQALVTGESLGQVSSQTLTNLNVIDRCTELLILRPLIA
    MDKQDIINESRKIGTEDFAKSMPEYCGVISQKPTVKAVLAKVEAEEKKFSEDLIDQIIAQSVTIDIREIAEQMDTRITET
    ETVASIDTNQVVIDIRAPEEEESKPLQIEGIEIKRIPFFKLATQFADLDKQKTYLLY
    CERGVMSKLQALYLIEQGYTNVK
    VYRP

    >gi|126173622|ref|YP_001049771.1| glutathione peroxidase [Shewanella baltica OS155]
    MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKGQGLVILGFPCNQFGAQEKADE
    QGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKATPGVLGTQGIKWNFTKFLVNRQGEAIERFASTTKPEALESKI
    AALLK

    >gi|126173719|ref|YP_001049868.1| ferredoxin-type protein NapF [Shewanella baltica OS155]
    MTQSINHSRRNLFRRRKDNALRPPWVRDDIEFTDVCTRCSACVEVCETQIIIKGDGGFPEVSFKDNECTFCMLCAKACPE
    HIFDLAQTPWSYQAHIQQSCLTFQGIWCQSCKDACEPRAISFVFNIGQAPRPQIDLELCTGCGACVAPCPSKAIEITRPT


    >gi|126173743|ref|YP_001049892.1| copper-translocating P-type ATPase [Shewanella baltica OS155]
    MSMTRLYVANMNCAGCVAKIEKAFAAQAGVEARVNLADKQVTVEGKMSADTALTVMENAGYPAQVVVDAKVAAEEKRLED
    ATEYRLRMRQAIAALVVGVPMMLWGLLGGEMMINSPAMQLGWGIMGLVTLALLVTTGGHFYQGMWRALKAKTTNMDTLIV
    LGTSTAWAYSMLVVIMPSAFPMDTRHVYFEASVMILGLINLGHGLELKARGKTSEAVQRLLGLQSTTAIRITDKGDEKVE
    ISQLKLGDKLRLRPGDRVALDGEVETGQSLLDEAMLTGEPIPVLKNRGDSVSAGTVNGNGSLVYRVTAGQEDTKLAKIIA
    LVQQAQTSKLPIGRLADRISAVFVPTVVAIALLAAAIWYFVGPAPALSHALVVLTSVLIIACPCALGLATPMSIMVAVGR
    AAQMGVLVKNGEALQTASKVDCVVLDKTGTVTLGKPQVTDFNLVQTLNDADKETLLGEIASLEQHSEHPLAGAIVSYAKE
    SLSQLPDTQAFTNHQGKGIEGKVDGVSLAIGNLALMTALDIVNSDCSALDPKATLSFANQGKTPIYIAKAGKLVATIALA
    DPIKPDAKDAIAAMLQRGIRVVLLTGDNPQTAQAVADQVAITEVIAGVLPEQKQQHVLDLQKQGHVVAMVGDGINDAPAL
    MSADVGIAMGSGTEVAIESADITLLSQQLIVIANLLALSRATITNIKQNLFGAFVYNSLGIPVAAGVLYPLTGMLLSPVI
    AGAAMALSSLTVVTNANRLRRQKL

    >gi|126173919|ref|YP_001050068.1| glutaredoxin [Shewanella baltica OS155]
    MFIIRWILGRIILFLNFVFSPKKRQRPLAEQQQIDTQTQALALYQYPACPFCVKVRRAMRRQGLNIVTHDAKKAPHKDEL
    VAQGGKQQVPCLRIEENGQVQWLYESKEIINYLDQRFA

    >gi|126173967|ref|YP_001050116.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MSVLVGRQAPDFTAAAVLGSGEIVDSFNLTAAIKGKPAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGQVKYTLVADVKHEICKAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGDVCPAGWEKGDKGMNASTEGVAAYLSENASSL

    >gi|126173979|ref|YP_001050128.1| glutaredoxin, GrxA family [Shewanella baltica OS155]
    MFVVIFGRPGCPYCVRAVQLSEQLVEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFVDEKHVGGCTDFEQYVR
    ENNLLD

    >gi|126174003|ref|YP_001050152.1| disulphide bond formation protein DsbB [Shewanella baltica OS155]
    MELTLTVITRFAHSRSSWFLLAGTALGLELSALYFQHIMKLDPCVMCIYQRLAVFGILAAGLIGMTAPKYRIVRILAAIV
    WAVSATWGLKLALSLVDMQTNPSPFST
    CSFLPEFPAWMPLHEWFPSIMMPTGMCTDVPWVFMGVTMAEWMVVAFSGFLVA
    WLLFIVPILSGSNKPSLYK

    >gi|126174010|ref|YP_001050159.1| glutaredoxin-like protein [Shewanella baltica OS155]
    METVEKIKQQITENPIIVYMKGSPKLPSCGFSSQVAQIMINCGEQFAFVDILQHPDIRAELPKFANWPTFPQLWIEGELI
    GGCDIVVDMFQKGELQPLIKAAAAKIKTEE

    >gi|126174016|ref|YP_001050165.1| arsenate reductase [Shewanella baltica OS155]
    MTQATIYHNPRCSKSRETLALLEQQGCDITLVEYLKTPPTAEVIGDILAKLGISARQLMRTKEAEYQALELADTSLTEQQ
    LIEAMVNTPKLIERPIVLANQRAAIGRPPENVLAIL

    >gi|126174083|ref|YP_001050232.1| peptide methionine sulfoxide reductase [Shewanella baltica OS155]
    MNKLTDFERYVIEEKGTERPFSGEYYDHDAKGLYLCKKCHAPLYRSEHKFNAHCGWPAFDDEIAGAVTRHVDADGRRTEI
    VCSQCGGHLGHVFEGEMLTPNNIRH
    CVNSVSMVFKGMDDAVEPASNSFATFGAGCFWCVEAIFQSLKGVVNVTSGYAGGD
    AHDADYKSVCSGQTGHAEVVHIEFNPEEIDFTTLLQVFFESHDPTTLNRQGNDKGPQYRSVVFAHNAEQIEQTTAMLTQL
    AAAKVFDAPIVTQVSAFETFYPAENYHNDYFALHGEQPYCQMVVRPKVEKVKALFARLQKA

    >gi|126174116|ref|YP_001050265.1| redoxin domain-containing protein [Shewanella baltica OS155]
    MKKILLLLSLMAAGVQAAPSLDHQVFNAQNQAVSLSEFKGKVVYVDFWASWCGPCRKSFPWMNEIQKKYQDQGLAVVAIN
    LDTDNELAQEFLKQVPANFSVRFNPEGDVARSFDLLGMPSSFMFNRQGQLVQHHVGFYADKAAEYEQELVSLLKE

    >gi|126174246|ref|YP_001050395.1| UBA/THIF-type NAD/FAD binding protein [Shewanella baltica OS155]
    MSWMQSMSKNPPLAHAEVLCGHIHSDNEHCGHTLSDADFIRYSRQVLLPEVGEAGQLQLAEAGVAIIGLGGLGQLAAQYL
    ACAGIGRLTLIDRDKVEVSNLPRQLLFNDADIGLNKARVAKQKLKGLAPQCTVTAYETAFNPATSAHHLADILQIKQQGK
    RVLVLDCTDNFATRQAINRRCIEAALPLVSASIAAFSGQLFAVDQMRFPSGGCYHCIFSAQTRVSQS
    CSTQGVLGPSVGV
    MASMQSLVAMQLLLNMDRCDESKNVLLGRFWRFDAKSLSWTAAILTRDPHCDVCGPKEVHSSSDKPRKL

    >gi|126174369|ref|YP_001050518.1| thioredoxin reductase [Shewanella baltica OS155]
    MSQVRHCNLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTEVENWPGDADDLTGPALMERMQKHAEKFDTEI
    LFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASARYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVANGNIILHLDQTMDEVVGDAMGVNGLKMKSTKDGSITDLAVAGVF
    VAIGHSPNTGIFEGQLEMNHGYLKVQSGLQGNATQTSIEGVYACGDVMDQHYRQAITSAGTGCMAALDAERYLDAKK

    >gi|126174422|ref|YP_001050571.1| heavy metal translocating P-type ATPase [Shewanella baltica OS155]
    MTHPSCFHCQEPVLTGQQFVTRINDRDELMCCPGCQAVSQTIVDAGLLSYYKFRTEPGSKQNALVPEALTQFSAYDLPEV
    QQDFVHSEDNVESVSLSIDGIT
    CAACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPY
    QVDEQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFATPVVLYSAQPFYFSAIRTL
    LSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMFTFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLVNDN
    GQEEIPAKKLRLNDVILVKPGEMIAADGVVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQL
    VAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    AIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGTLSIGQTQCMADLTKTQALAIAAALETGSRHPIAAAFAVFADNA
    LVTEEVHHEVGFGVRGRIDGTDYLIGNAVFTGASIDTRDPTQKIWLARSCNEQLEVLASFEIQDNIRQDSKATVEMLKQQ
    GCRISIASGDSSGHVHQLAKELGIDDVHSGLTPADKLALVTRLQQHTRVAMFGDGINDAPVLAGADLSVAMGSGSAIAKN
    SADLILLGDHLSRFTQAVSVAKLTTQIIRQNLAWALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV

    >gi|126174440|ref|YP_001050589.1| peptide methionine sulfoxide reductase [Shewanella baltica OS155]
    MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVKKGKTGHAEVVQVEFDPALVSYEDLLDVFWKNHNPT
    SLNMQGGDIGTQYRSTIFFHDREQKAAAETSKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY

    >gi|126174475|ref|YP_001050624.1| electron transport complex, RnfABCDGE type, A subunit [Shewanella baltica OS155]
    MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILV
    IAVVVQFTEMVVQKTSAALHRALGIYLPLITTN
    CAVLGVALLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAA
    ADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK

    >gi|126174480|ref|YP_001050629.1| electron transport complex, RnfABCDGE type, E subunit [Shewanella baltica OS155]
    MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALV
    TTVQLLINAYAYGLYLSLGIFLPLIVTN
    CIIIGRAEAFASRNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDG
    ADQLLGPWAKSLTIHLWQVDTPFLLAMLPPGAFIVMGLLIALKNVIDKKVKDRQPQVAAEPSVTRARITKVG

    >gi|126174544|ref|YP_001050693.1| alkylhydroperoxidase [Shewanella baltica OS155]
    MSERIPRQQIYQLQPALANALLSLDKAAGDSHFAPLLVHLVKLRASQLNGCAFCQRRHAEEARSDGEEQLRLDLLAAWQE
    VDGLFNERERAALLWTEILTQVATAPVHDSQYAAIAEHYSEKEIVDLTSLIIAINGWNRIAIAFHLQPI

    >gi|126174579|ref|YP_001050728.1| arsenate reductase and related [Shewanella baltica OS155]
    MLTLSQRHIPLVTCGAQCHNASKINACQPSVHPHWSIILTLYGIKNCDTVRKARKWIENHQLPVHFHDFRDDGLRQEDLE
    FWCKASGWETVFNKRSTSFRALSDADKTDIDQAKAIQLMQAQPTLIKRPVLVVGEHVLIGFDEAAYKRVFSL

    >gi|126174591|ref|YP_001050740.1| rhodanese domain protein [Shewanella baltica OS155]
    MTKVVVCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNSQNGLDNIVHKLSFDD
    EMPFYRTKVKLKNEIVTMGVEGIDPLKVVGTYVKPQDWNALISDPDVILVDTRNDYEVQIGTFKNAVNPVTETFREFPEY
    VKQNLDPAKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVKAEESLWEGECFVFDNRVAVNHDLKKGQ
    YDQCNACRMPITEVEKQSPAYVQGVSCPHCIDKISDEQRKRFVERERQVNLAKARNEAHIGSDVNQVIEARREKKEAQRR
    LAAEKNNAKKSQVL

    >gi|126174592|ref|YP_001050741.1| glutathione S-transferase domain-containing protein [Shewanella baltica OS155]
    MALAVLYTFRRCPYAMRARLGLLLAQCNVEVREITLKAKPAQMLAASPKGTVPVLVLANGEVIAESLEIMRWALTQADPL
    DLLCQQSPVIEDKMAQLITQNDQQFKPWLDRYKYADRYPEQTQADYYQQASHFLTQLEACLGQHSFLVAETPRLADYAIV
    PFIRQFAAVDLKRALSDDFPRLAAWLENLISSEIFIRAMEKYVIWDASHSPTCLLGDM

    >gi|126174608|ref|YP_001050757.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica OS155]
    MAITMTPAAADRVRSFLVNRGKGVGLRLGLRTSGCSGMAYVLEFVDSLNDDDEVFDIEDVKIIIDAKSLIYLQGIELDFV
    KEGLNEGFQFNNPNAKGECGCGESFTV

    >gi|126174767|ref|YP_001050916.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MNTLTAGAKAPQFTLQDQHGRSVSLADSLKQGPVLVYFYPKAATPGCTVQACGLRDSKAALDSHNVTVFGISPDPVAKLA
    KFAEKQALNFTLLSDEDHSVADAFGVWGEKKFMGKTYDGIHRLSFLINTDGTIAHVFDKFKTKDHHEVVLVQIAG

    >gi|126174853|ref|YP_001051002.1| DSBA oxidoreductase [Shewanella baltica OS155]
    MSVFNRVRPIAALACGLMLSASFALQAASFEEGKDYVTVAGITEAQKPVLREFFSYNCPHCYKQEPLMDLTVQLLGKDVA
    FERTPVGAGRPAWELSQLAYYVAQKLKMTKQTHGAIFKQIHEKGEQFTAPEQVKAFFVAQGAKVDDVDAAMNSVDAKFTL
    MNYDSQAELAGIKGVPSLLVNGRYMLTSTAHTPEELAALVKFLAAK

    >gi|126174933|ref|YP_001051082.1| DSBA oxidoreductase [Shewanella baltica OS155]
    MDKTIIIDYYTDILCVWAWIAQKRVDELNKQLGNNIELQYHYLDVFGDVPTKITTQWQSKGGFMGFAEHIQQSVSAFEYA
    DINPKVWTQVRPSTSANAHLMLKAVEITYDKKKSIDMALTFRTAFFIDGLDIGNFDVLCDLVNANGLDLNAINTSIRDGS
    AMATLMSDYQQSKRQNINGSPSFVLDGGRQTLYGNVGFDVILANIEALLKHSTDEASWC

    >gi|126174984|ref|YP_001051133.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MTHNLVIRGQSLMRLALLSLQSLVLMPLLLMPMIANAADQDPAVAWDKIAAGAMVLDVRTPEEFAEGHLANAVNISFEQV
    EEEFAKRGIAKDAPVVLY
    CRSGRRSSIATEALVAAGYTQTYNGGGYSTLVEAQKTPAK

    >gi|126174989|ref|YP_001051138.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MPHPSAFSALVDAILPNITEVTIEAYQADDSWHLVDVREDREWLQDHLPQAKHLSRGILERDIEARFPDKHTPILLYCAG
    GARSALAAHNLQLMGYTRVASLIGGYKGWVQRQLPVVQD

    >gi|126175006|ref|YP_001051155.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella baltica OS155]
    MKHAIRQLSQAPSIAEYQPCAVGTFISPVGILQLNANAYGLSHLTVVGSDRTEITLAKASEDALNHAKAHIRETQAQLAD
    YFAGERVEFDLKLAPKGTEFQRDVWQALLNLDYGQSCSYGQIAEQIGRPKAVRAVGAANGANPIAIIVP
    CHRVIGKNGKL
    TGYAYGLAMKQQLLTLETDKHCLDI

    >gi|126175216|ref|YP_001051365.1| redoxin domain-containing protein [Shewanella baltica OS155]
    MQKYVSFLAASCIYGLVLISPNVLASEKTQVLMGEKTVTLEGKLPKLSQMAPGFKVVDDHFSPVMLSDFKGKTVLISAVP
    SLDTGV
    CALQTKRFNSEVGHFSDDVVMLTISADLPFAQKRFCKVENVDKIKVLSDSVWRDFGEKYGLLIQDYGLLARAIF
    IIDAEGKLQYQELVPNITEHPNYDAALEALKTIQAQQ

    >gi|126175224|ref|YP_001051373.1| glutathione peroxidase [Shewanella baltica OS155]
    MGCFLLVSLDFRSAQSVLLHRYAVVNHSFYFLIQYDLYLVRLRNVPVKEKAMKKLSMIFAMTASLMSVGAMAATCPEYLN
    LEVRKLHSEETVNLCELTQGKPVLIVNTASN
    CGYTPQFKALEALHENYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYIN
    YGVTFTMLSTSAVRGSDANSVFKYLAEKTGAPKWNFYKYVVSGDGAVVQQFNSKVKPDSEELKQAIESVL

    >gi|126175260|ref|YP_001051409.1| heavy metal transport/detoxification protein [Shewanella baltica OS155]
    MKLVLFFALSLCSASSWAANVLVTLDVKGMTCPLCVTVVNKALRKTDGVIKAKASLKTEQAIVTVPEDFNLDNLLRAVDE
    TGYKGSINKIEKQA

    >gi|126175261|ref|YP_001051410.1| mercuric transport protein MerT, putative [Shewanella baltica OS155]
    MAAAVIAAVASSLCCIAPLIYLVFGVSAASLSGIEQLSWLQVPMLVLSTGLILMGFWRLYFAKKPLCTATLSRTQMVWLY
    WLTVPVVLAFQLYPFVLPWLLEVFE

    >gi|126175293|ref|YP_001051442.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MSTILKTLCLVGTLLLTSFTTLAQPIARDEFSISPLLNGQQIPKVNLQDIKGKTVDLAELTQQKPTIFFFYRGGWCPFCN
    NQMGQLKAIEPELLKMGFQLVGISPDTPAQLKASAAKNELKYLLLSDEKMLAAQAFGLAFYTSEKVTEIYTSRLHVDNPM
    WTTPEGAKRLVLPVPAIYISDDKGLIHFQYVNPNYKVRPAPKLILTAASLVGSQE

    >gi|126175595|ref|YP_001051744.1| DSBA oxidoreductase [Shewanella baltica OS155]
    MIKQLALAVTLAIAPLSTFAANFVEGTHYTQISAKTPSSEPKLTEFYSFYCHNCFNMETNYLPDIKANLNKQISFDNKHV
    DFMNSDIGTEVMRSLAVIQSLDNKDALTHAMFTAIQGTEGANGHDHSAPGHQHEPQINSRDDIKKVFAQFGVDAAKYDEL
    ADSKSTDEKLALWRTQQNEFKIDSVPAFIVNDKYAVNLNSIKTLDELIGLINYLAVEKDAAAAKTSSGGSLGWLFLVFAA
    AIGVTRLQRLS

    >gi|126175667|ref|YP_001051816.1| methylated-DNA--protein-cysteine methyltransferase [Shewanella baltica OS155]
    MSDYDRIASAMAYLVDRAIDQPSLEEIAAHVHLSPYHFQRLFCRWAGTTPKRFLQVLTLERGKGLLNNSRSLLDVSHELG
    LSGSSRLHDHFVQLEAVTPGEYKNRGKDVQIEYGVHPTPLGPMFVAVTLRGVCRAAFMDFNSMEELLNDLYNDWPLSSIR
    ENLASTRHAIDAFFSSETASGQGPLSLHVTGTNFQIAVWRALLKIPPGAVASYAEVARSLGAPRSARAVGNAIGANPVAL
    LIP
    CHRVIQQSGALGGYRWGPTKKLMVQTWEKMRDEPVAL

    >gi|126175920|ref|YP_001052069.1| protein-disulfide reductase [Shewanella baltica OS155]
    MKKLLSLIFTSLLLLTPLAHSEGVFGNKFDFMKSEPELMPVDQAFAFDFKQEGNQVKLNWVIADGYYMYRDKLKFTVNGA
    ELGTVALPKGKPHEDEYFGEQEVYYTYVDIPVALKQADENATLTVTFMGCAEGKLCYPPTKRDVVLKAIAANDGLIAGAE
    ASESTAAAKPASTESASIEPSTADKANTQPITQQDTLSQMLSNDSLIWTLLIFFGLGVGLALTPCVFPMYPILSGIIVGQ
    GQKLSTAKAFTLSMAYVQGMAITYSILGLVVASAGLKYQAALQHPAVLVVLAILFFVLSLSMFGLYDLKLPSSWQEKMNS
    VSNNQKGGNLVGVFLMGVISGLVASPCTTAPLSGALVYVAQTGDLLQGFLALYVLSMGMGLPLLIIGTSGGKLLPRAGAW
    MDIIKTVFGFLLIAVSIVMLGRIWTGVVSDVLWSLWGVSFTGYLMHQNKLSPFNWKQTVRSVLLTLTLLASFSYGFQAVM
    GHFGFNHNPVGTAATTEEAHGFKRIKSIKDLDQEIAAAAAQGKPVMLDLYADW
    CVACKEFEAITFKDADVLARMNKIVLL
    QADVTKSDKVDVALLEKYNVLGLPTLLMFNEQGEQREDLRVTGFMGPKDFAAHLDHLVK

    >gi|126176101|ref|YP_001052250.1| dihydrolipoamide dehydrogenase [Shewanella baltica OS155]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETIIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPT
    IDLDKLRGFKDKVIGQLTGGLGGMSKMRKVNVVNGFGKFTGPNTLEVTAEDGTVKVVQFEQAIIAAGSRPIKLPFIPHED
    PRIWDSTDALELKEVPGKLLVMGGGIIGLEMGTVYASLGSEIDVVEMFDQVIPAADKDVVRVFTKQIKKKFNLILETKVT
    AVEAREDGIYVSMEGKSAPTEAVRYDAVLVAIGRAPNGKSLDAEKAGVNVDERGFIKVDKQLRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDASEGMTKL
    IFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEMYEGSITDLPNPKAKKK

    >gi|126176116|ref|YP_001052265.1| hypothetical protein Sbal_3926 [Shewanella baltica OS155]
    MHNNVKAFLATTALFFSCQVLANGGCGFEEQQQGLIATCSEEKQEVILTGIVEAQHLVTDLNEFAEGYKSYQVDTAAITP
    LKSVTEPTEIIVIIGTW
    CPDCHRETPRFIRIMEEVANPNIKVTYIGVDRTKKDPEGLAAKYDFTRIPTFIVLQQGKEVGR
    IVERPTVSLEKDLADLLK

    >gi|126176119|ref|YP_001052268.1| thioredoxin [Shewanella baltica OS155]
    MSDKIIYLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDDVSEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLL
    LFKNGELAATKVGALSKTQLKEFIDAQI

    >gi|126176246|ref|YP_001052395.1| DSBA oxidoreductase [Shewanella baltica OS155]
    MKKVLLMAAALLLAPLAVSAVEYQEGVHYTVINDGPATAKPEITEFFSFYCPHCFNFSKTVVPKILAEKPEGVAFNQAHV
    DFIGKEMGVEMSRAFAVAHQLNVDDKMDAALFSAIHEKKEHFTSLADIRALFVANGVDGKTFDAAAESFMVKAQMAKMKR
    DTENAKLTGVPALVVNGKYRVETGAIKSYDELLDIAFYLAKK

    >gi|126176249|ref|YP_001052398.1| hypothetical protein Sbal_4063 [Shewanella baltica OS155]
    MKFKQDFFTQLPEFYSQVYPQGITKPEWLAWSDDAAQLIGLSQPTDELLLGLSGNAAVDGATYYAQVYSGHQFGGYTPRL
    GDGRSIILGEAIGPNGAWDVALKGGGPTPYSRRGDGRAVMRSAVREFLVSEALHHLHVPTTRALAVIGSDLPVWRESQET
    AAITVRLARSHIRFGHFEFFCHSERGRADKLIQLLNFTITQHYPHLSCDAAGYKAWFLQVVQDTAKMIAHWQAVGFAHGV
    MNTDNMSILGDSFDFGPFAFLDTFQEDFICNHSDPEGRYAFGQQPGIGLWNLQRLAQALTPVIPSDDLIAILNQYQEALV
    QPYLRLMRAKLGLSAVDVPSVEQDKQDLDLIGRFTVLMEKNQLDYTQTWRQLGKLDPTSKHSALRDDFIDVSQFDTWYQA
    YQQRLGAVADIPAWQTERNSVNPKYILRNYLAQEAIIAVEEGNLAPLHLLQKILTQPFAEHAEHEDLAKRPPDWGQGLIM
    S
    CSS

    >gi|126176252|ref|YP_001052401.1| DsrE family protein [Shewanella baltica OS155]
    MQSILIVAHASPYGTEKLFNSLRIALALKDQDEQAVDLKLFLMSDAVFGALKNQTTPDLSYNLQQMFEILSAQQVPILLC
    KTCAQARGVTAEMIIEGAHIGTLQDLTRWTLAADKVMHI

    >gi|126176260|ref|YP_001052409.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Shewanella baltica OS155]
    MTTGFNTLLKTPLIALLCLFTLAQVAHGADDDYSAEGERRAKAAGESLVGTPAPQMKMTTIDGKAIDLADLYGKKPVYIK
    FWATW
    CVPCREQMPSFEDIYKKYGDKVEVIAVNTGISDNIKSVTEFSQKMGLTMPITIDDGKLARAFHLRVTPQHLLIDK
    NGKFAYFGHKDDKEFHQALDRVVAEKATGKPLHNPTFVAKDSGYNLGDTVPDLAFSTIDEKPLNIQFNTASSKKVVAVFF
    GPW
    CEWYLETTEPKTSQACTRVRELLEKKSQASTVQWVTVSTNLWSSVAELKDYRKSYGTTMPIVFDRDGELFKQFGVNQ
    VPSISLIDADGKVILKSSIQDDDFDAVLHTISALK

    >gi|126176261|ref|YP_001052410.1| cytochrome c biogenesis protein, transmembrane region [Shewanella baltica OS155]
    MKRLAQFITGFIILICSLQVMANELSQSQRLISISMMMESDKPAAGTHELAITMTPQKGWHGYWQNPGDAGFPTRFDWQL
    PEDVTIGEVQYPAPSQLVTSDIMNYIYHGEYTLLAPITIDSSIAVGTSLPIKLDISYLVCNPTTCLPEQQTIEQDFIVGD
    GKVEQNHQRQFSQWRQMLPRPLDAKGQFAVENNTLTLSLPLPGSVDSRNAHIYPIINNTLVNNAQQILNHEGDVLSMQTQ
    VGDELADLFQGVLVLENGTALRFDAHKTDHVAFIVPPINEDNTSNQNIWLIGITAFVGAILGGLLLNIMPCVFPILSLKI
    LSLSHQGSEKAARMGSVAYTLGAVLVCICLGGAILGLRALGHQVGWAFQLQSPAVIAALILLMSAIGFNLAGLFEIGTLT
    SGSKLQDQKGPMGDFWTGVLAAFIATPCTGPFMATALGAALVLPTTVALVIFAGLGFGMALPFLLVGFIPALRTRLPKPG
    AWMVTARRILSLPMFITVLGLVWILMRQSNDNYVLSVLAATMLSTFGLWLTGLWQHSQHKGQWWPSLLLTLLPLLALLYW
    VPQAESHVQGEQKEVAEALVFSQEQLNILGAQQDVFVYFTADW
    CLTCKVNEKTSIERQEVKAAFKQHNVATMIGDWTNGD
    NQITEFLSQHGRSGVPLYLWYKKGVNKPIVLPQILSQTILIEQAKG

    >gi|126176367|ref|YP_001052516.1| selenide, water dikinase [Shewanella baltica OS155]
    MSDSPVTLPESIKLTEYSHGAGCGCKISPKVLSTILASQLPVFTDPNLLVGNQSRDDAAVYKLNDDIGIISTTDFFMPIV
    DDPFTFGRIAATNAISDIYAMGGTPIMAIAILGWPINKLPAEVAQQVVDGGRQACMEAGIMLAGGHSIDAPEPIFGLAVT
    GQIALTDLKQNDTAKAGDRLYLTKPIGIGILTTAQKQKKLQDEDSHIAVNAMCQLNTIGTTIAKISGVNALTDVTGFGLA
    GHLLEMCQGAKLTAKLKFDAVPLLPRALDYLALGCVPGGTHRNYDSYGEHLPELSEHQKAILCDPQTSGGLLVAVSAEAE
    AELIDLLDAHHIAPICIGSLETPTTEVNVVLC

    >gi|126176409|ref|YP_001052558.1| molybdopterin synthase sulfurylase MoeB [Shewanella baltica OS155]
    MNVPDDILSDSELLRYSRQISIKAMDIDGQEHLKQAKVLMIGAGGLGCAASQYLTVAGIGELTLVDFDHVELSNLQRQVL
    HQDANVGQPKVESAKQSLSQLNPFIKINIINAVLDDHEIDALVANHNLVLDCTDNVSVREQLNLSCFKHKVPLVSAAAIR
    MEGMVTVFDYHSETPCYHCFSALFGEQQLS
    CVESGILAPVVGMIGCLQAVEAIKVITGMGKTLAGRILMIDAMTMEFREM
    KLSKHANCSVCGTQA

    >gi|126176512|ref|YP_001052661.1| rhodanese domain-containing protein [Shewanella baltica OS155]
    MRAIIMQEYIEFFKAHSMLSLAWVGLFVVLVASIIKSSMSKIKSISHQELTIMVNRQDAKVVDVRSNDEFRKGHIVDAIN
    VTLADIKNNQISALEKFKASPIILV
    CNAGMTSSQAAQLLSQQGFENLYNLKGGMGEWQAANMPVSKSKR