Shewanella amazonensis SB2B uid58257

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119773203|ref|YP_925943.1| rhodanese-like protein [Shewanella amazonensis SB2B]
    MLSLAWLGLFLAVVITTVKSMTSKVKHISTQELVQLVNKQNAKVVDVRGKEEFRKGHIVDAMNISMSEIKNNQISALESA
    KKSPIILV
    CNAGMTSAQAAQLLVAQGFEQVYSLKGGMGDWQAANLPVKKR

    >gi|119773238|ref|YP_925978.1| glpE protein [Shewanella amazonensis SB2B]
    MSAFKHLSVNELIHMRTEQGTDVQIADIRDPQSFANGHIDGAVNLSNDNLARFIAESDMDKPLVVVCYHGISSQNAAAYL
    VEQGFDQVFSLDGGYSAWHMANL

    >gi|119773279|ref|YP_926019.1| molybdopterin biosynthesis protein MoeB [Shewanella amazonensis SB2B]
    MTDDILSDTELLRYSRQISIKSMDIEGQEKLKQARVLVIGAGGLGCAAAQYLGVAGVGAMTLVDFDTVELSNLQRQVLHR
    DNRIGMLKVESARLALNELNPHVQINPIGRVLDDPEMDALVADHSLVLDCTDNVAVRQQLNRACFAHKVPLVSAAAIRME
    GMITVFDYAGDSPCYQCFASLFGEQQLT
    CVESGILAPVVGLMGCLQAVEAIKLIAGMGKPLLGRLLMVDAMTMEMRQMIL
    PRQPNCPVCGGATV

    >gi|119773331|ref|YP_926071.1| selenide, water dikinase [Shewanella amazonensis SB2B]
    MSSQLSQPIKLTEYSHGAGCGCKISPKVLGTILESQLPSFVDPNLLVGNASRDDAAVYKLNDTTGIISTTDFFMPIVDDP
    FTFGRIAATNAISDIYAMGGTPMMAIAILGWPVNKLPAEVAQQVVDGGRQACMDAGIMLAGGHSIDAPEPIFGLAVTGQL
    PLERLKQNNTAKAGDKLYLTKPIGIGILTTAQKQKKLEDADAHIAPEAMCTLNKIGADIATLPGVSAMTDVTGFGLAGHL
    LEMCQGATVDAELNLEAVPLLERAEHYLDLGCIPGGTHRNFDSYGEHLPNVSEREKALLCDPQTSGGLLVAVCDEAEAAL
    CELLSSHGITPVCIGELKAGPGRLLLKSGGLA

    >gi|119773390|ref|YP_926130.1| thiol:disulfide interchange protein DsbE [Shewanella amazonensis SB2B]
    MKKLVLFIPLVLFLGMGIFLYKGLFLNPQKLESALEGKPIPAFQLEKLETPGEMITQEDLKGQVSLLNVWATWCPSCKYE
    HPFLMTLTRQKLVPIYGINYRDERAEAIRELRHQGDPYVLNIFDKDGRLGLDLGVYGAPETFLVDHKGIIRFRFAGPVDQ
    RVWSETLYPMVQQLQQEAAAEAAASGKATATGAAS

    >gi|119773392|ref|YP_926132.1| thioredoxin, putative [Shewanella amazonensis SB2B]
    MKRIVCALMLAASGAAIAYPGMQQQMVQPASSVDLIRQLPHPFAIDVVPFEDANGKAVDFSQYQGKVVMVNMWATWCPPC
    VREIPALERLKAKMDPKDFAFLPISIDAGGKAEVDAFLKAKGMEDFGSFFDAPQNLRQVFPLDTIPATFILNREGQLVAF
    VRSFVDWDDPKAEALLKGIIEAPLAAPAVKAAK

    >gi|119773518|ref|YP_926258.1| dihydrolipoamide dehydrogenase [Shewanella amazonensis SB2B]
    MSNQIKTQVVVLGAGPAGYSAAFRAADLGLETVIIERFSTLGGVCLNVGCIPSKALLHIAKVIEEAKTAAEHGVVFGEPS
    IDIDKLRGYKEKVIGQLTGGLGGMAKMRKVQVVNGLGKFTGPNSIEVTGADGAATVINFDNAIIAAGSRPIQLPFIPHED
    PRIWDSTDALELKEVPKKLLVMGGGIIGLEMGTVYHALGSDIDVVEMFDQVIPAADKDVVKVYTRKISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPTEPVRYDAVLVAIGRTPNGKLIDADKAGINVDERGFIKVDKQLRTNVPHIFAVGDIVGQPM
    LAHKGVHEGHVAAEVISGLKHFFDPKVIPSIAYTDPEVAWVGLTEKEAKEKGIAYETATFPWAASGRAIASDASDGMTKL
    IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVYEGSITDLPNPKAKKKK

    >gi|119773678|ref|YP_926418.1| thiol:disulfide interchange protein precursor [Shewanella amazonensis SB2B]
    MKKIITLLFSCLLLLAPSTHANDIFGKKFDFLKGEPELMPVNEAFVFDAVQDGNRVRVSFVIADGYYLYRDKLKFEADNA
    TLGEVALPPGKLHNDEYFGEQQVFYSYVEFTVALKEAMDQGTLTLTFMGCAEGKLCFPPTRVSKQLTAVAPNDGKLSGES
    AKPVSDGTVSGTSTSAPLTQQDSLAQMLTEGNLGWTLLIFFGLGIGLALTPCVFPMYPILSGIIVGQGEKLSTGRAFTLS
    MAYVQGMAITYSLLGLVVASAGMKYQAALQHPAVLIGLAILFFVLSLSMFGLYDLKLPSSWQEKMNGLSNNQKGGNLTGV
    FIMGVISGLVASPCTTAPLSGALVYVAQSGDLLMGFAALYVLSMGMGLPLLLMGTSGGKLLPRAGAWMEIIKTVFGFLLI
    AVSVMMIGRIWPGMVSDLLWALWGVALAGYLLHQNKKTEFNWKQTVRTVLLMLGLLAAFSYGFQAVMGGLGYQMPTNNTA
    QQSVKGVEFKRIKSVEDLNAELAIARFEGKFVMLDLYADW
    CVACKEFEHITFPDPEVKKRLDNMVLLQADVTKSDAIDVT
    LLETYDVLGLPTLLLFDPQSGLRDDLRVTGFMGPKDFAAHLDLLQVH

    >gi|119773755|ref|YP_926495.1| alkyl hydroperoxide reductase, C subunit [Shewanella amazonensis SB2B]
    MTQSIINSTIKPFKATAFHKGEFVPVTEQDLLGKWSVVFFYPADFTFVCPTELGDMADHYAKLQSMGVEVYSVSTDTHFT
    HKAWHDTSDTINKIEFPMVADPTGIISRNFGVMIEEEGLALRGTFVINPEGQVKVAEIHDLGIGRSASELVRKIQAAQYV
    ATHDGEVCPAKWQPGDETLAPSLDLVGKI

    >gi|119773756|ref|YP_926496.1| alkyl hydroperoxide reductase, F subunit [Shewanella amazonensis SB2B]
    MLNADLKQQLKTYLQNLRQDVRLVVSADDSKKSQELLDLANDISSLSPLVSVTQARLERTPEMQVTNAQGTDIRFAGLPM
    GHEFTSLVLALLHTGGHPLKLDMAVIEQIKALPQTLKFETFISLS
    CQNCPDVVQALNMMAALNPNVSSTMIDGALFQDEV
    ESRQIMAVPSVFLNGELFSQGRISLKEILAKVDTQAAAREADALSEKAPYEVLVVGAGPAGASAAIYSARKGLRTGLVAD
    RFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDVMENQKALKLTKDGLYQVELANGAVLSGKTVLIATGARWR
    EMNVPGEKEYRGRGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAAIDLANIVEHVTVLEFDSKLRADEVLVRKARSMGNIH
    IITQAQTTEVVGDGNKVTGLVYTDRATGDVHSVELAGIFVQIGLVPNSEWLKGTLELTPRGEIIVDERGQTSLPGVFAAG
    DVTNSAYKQIIIAMGSGATASLGAFDYLIRHSEADASAAA

    >gi|119773764|ref|YP_926504.1| hypothetical protein Sama_0626 [Shewanella amazonensis SB2B]
    MVRAILLSLLMLLSVPAFSATEDLSTSPVWHQTDADGKPVVKLYFFWSKTCPHCAEAHPFIDALPEQYPWISLESYMITA
    PGAREKWQTIAKATGTDTRSVPFFAICGKASVGYSSADVTGQYLVGRLKECYRSLGGTVGDDGPAIHTASTGEQPLFGTC
    DSSSEAGTCDLGAEVTASSDVQPVELPFIGVVTPDQLSLPLLTLVLAGVDAFNPCAFFVLLFLLSIMVNAKSRSRMLVVG
    GIFVFFSGFIYFLFMTAWLNMFELLGADGDGGNIILAAGLLALVAGTINVKDFFFEKGEVTLSMSAEKRTGLIKRMGKLS
    SASSMTAMILGTTVLAILANAYELLCTAGFPMIYTSVLAMHELPAAERYFYLVMYNIVYVIPLALIVLVFALTLGKRKLS
    EKEGQTLKLMSGIMMVGLGGMLVLDPTSLQNVVLAVALILGSIGITSVLIIGRKLLTARQG

    >gi|119773876|ref|YP_926616.1| thioredoxin 2 [Shewanella amazonensis SB2B]
    MILACPHCHGLNRVPDTRLSDAPSCGRCKSPLFTGAPMELTAENFDAHAVKSELPLVVDFWAAWCGPCQSFAPVFSAAAE
    EIEPGFRFGKLDTESQQALAARFGIRSIPTLMVIKGGKILGQQAGAMPKQAFIQWLKQFS

    >gi|119773944|ref|YP_926684.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella amazonensis SB2B]
    MKSIPALFRYLLSTRLTLSLLTCLLSAVLIQPAMANPIATDEVSVAPLMNGETIPDIQLTDSKGKSVSLKALSTEKPTVF
    FFYRGGW
    CPFCNNQLGQLKEIEPKLIELGYQLVGISPDSPEKLAAAAGERKLDYLLLSDANMEAAKAFGLAFFTSEKTTQ
    TYLSRMKLENPLFKTPEGDERLVLPVPAVYITDTQGLIHFQYVNPNFRVRPAPKLILTAAELARQQG

    >gi|119773980|ref|YP_926720.1| iron-sulfur cluster insertion protein ErpA [Shewanella amazonensis SB2B]
    MTEQTDVAMPISFTDAAAAKVKALLDEEQNDALKLRVYVTGGGCSGFQYGFTFDEKVNDGDFTVEKQGVQLVVDPMSLQY
    LMGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV

    >gi|119774217|ref|YP_926957.1| glutathione peroxidase [Shewanella amazonensis SB2B]
    MTDLYQFAATTIKGEQQPLANYRGKVLLIVNTASKCGFTPQYQGLESLYRKYHDQGLEILGFPCNQFGAQEQGSESDIQS
    FCELNFGVTFPLFAKVDVNGEQAHPLFTHLKQEAPGLLGSKAIKWNFTKFLVGRDGKVRDRFAPTTDPQKLEKDIEALLN
    EAAK

    >gi|119774432|ref|YP_927172.1| HesB/YadR/YfhF family protein [Shewanella amazonensis SB2B]
    MAISMTPAANERVKAFLANRGKGVGLRLGLKTSGCSGMAYVLEFVDDLNDDDEVYEIDGVNIIIDAKSFIYLQGIELDFV
    KEGLNEGFKFNNPNAKGECGCGESFTV

    >gi|119774643|ref|YP_927383.1| cysteine desulfurase [Shewanella amazonensis SB2B]
    MSQSKPLIYLDANATTPVLPAAAKAAMDAMEHIYGNPSSSHITGLQAKALMEQTRAAARKQLGSGTGKLVFTSGATEGIQ
    TAILSALVAARDTGVPAGACLLYGATEHKAVPESLKHWNKVLGINADVLAIPVDTQGRLDMAFIRDKAPNALLICTMAVN
    NETGVYQDLDALSRCIRQANPTVFWMVDCVQALGKLAIDLASSGIDYAPFSGHKLYAPKGIGMLYIRDGAPFTPFIAGGG
    QEGGLRSGTENLPAMAALKVVLDMLNGDAQERFESKETLKGYRLKLLAALEQAFGEVTLNHSLENTVPTTLNFSIAGFSS
    KEIMDLFDAAGLRVSSGSACSSKVTRSFVLDAMGLPRWQSESAIRLSFGPAMTAAELEAACERIVTAASSLTHSCLLTRD
    SRSTDADREPLQGLVQFKDDGACCWVYTDKDSRETLIVDPLPALKHRLLNLVRCQELKVLAVLDTHGHGDHQSIRSELIC
    ELGLTDACDHLGWPLSSKGQMWRGEQVKSLSVGNKTLVSLPSPGHTDDSHSFIMLDDTQAPQFAFVGDTVLPGSIGRSNF
    PSSSSVALFHTLKRLHSLLGDQSLLLSSHDYHNDFFTNFGVELKQSALLNDVLTGAMDEATFVARKDAMDATLKDVQGET
    IMCGAYGQCQQAKGVEEYSADTLEQLLHSNPEALVLDIREPHEYQLSHRESRCVNVPLTRLAGFVAREPGARSKPLVLI
    C
    RSGSRSLVAAKALERFGFSAVAHVAGGYALSQC

    >gi|119774658|ref|YP_927398.1| DsbA family thiol:disulfide interchange protein [Shewanella amazonensis SB2B]
    MSLSAMAATFVEGKDYVRVEGFSESHTPVLREFFSYNCPHCFRMDHTIEEAVGLVAKEVRFERTPVGAGRNPWQMSQLAY
    YLAQKFNVTDQTHGAIFKQVQEVAPFQSEADVRQFFVSQGLKADELDKAIASSDRKLAMMTFDTEAQLSGIRGVPSLLVN
    GKYMLNIQGRSSAEIAELVQYLVKQ

    >gi|119774784|ref|YP_927524.1| hypothetical protein Sama_1648 [Shewanella amazonensis SB2B]
    MTLFGIKNCDTVKKARKWLEANGHNVPFHDFRVDGLPAEQLNDWVARIGFEPLLNKKSTSFRALTDEQKQDIDTAKAIAL
    MLEYPTLIKRPVLVKGDTVYTGFNDKLYSEVFGQ

    >gi|119774816|ref|YP_927556.1| thioredoxin family protein [Shewanella amazonensis SB2B]
    MNLVMPANRLPTTLSLFLCAALLFLGLPFSSYATPSLEHSIVDESGTAFSLSDYRGKVVYVDFWASWCGPCRKSFPWMNE
    MHRRYQEKGLAVIAINLDTDSQDAKPFLDDLKPQFIIGYDSQGEVARRFDLLGMPSSFVFDRSGKLVATHVGFFTEKAAE
    YEAELVTLLEQPE

    >gi|119774843|ref|YP_927583.1| protein-methionine-S-oxide reductase [Shewanella amazonensis SB2B]
    MSQSNSSFATFGAGCFWGVEYFFRQIPGVINATCGYMGGNDKYSRYEDVKKGITGHAEVVQVEFDPSQVSFDDLLQVFWK
    NHNPTSLNQQGGDIGTQYRSTIFFHDKTQKEQAEASKLALARSGRWGTRHIVTEIVPLQTFHVAEEYHQNYIDKNNLPSC
    HIEY

    >gi|119774904|ref|YP_927644.1| thioredoxin reductase [Shewanella amazonensis SB2B]
    MSQAKHSQLLILGSGPAGYTAAVYAARANLNPVMITGLQQGGQLTTTTEVENWPGDAEGLTGPGLMARMQEHAEKFNTEI
    IFDHINEVTLTERPFRLKGDNGEYTCDALIIATGASAKYLGLPSEDAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRSEKILIDRLMDKVANGNIILHLDKTLDEVVGDNMGVTGVKLKSTKDDSTEAFDVAGVF
    VAIGHSPNTGIFEGQLEMNNGYIKVQSGLNGNATQTSIEGVFAAGDVMDQHYRQAITSAGTGCMAALDAERYLDAKH

    >gi|119774921|ref|YP_927661.1| copper-translocating P-type ATPase [Shewanella amazonensis SB2B]
    MSTTMHIAVKGMTCVSCASRIEKALLKVNGVVNATVNLATETATIEGVASTGDIKSAIINAGYDVELESRQFEVKGMTCA
    SCAGRVEKALMKISGVGSANVNLATEQVSISLLENITNDTLVAAVRDAGYELITADEPAQSEPKQDKRLAFYQKDSWPVI
    GSAILTLPLVLPMIGMLFGADWMLPAFWQWLLATPVQFYFGSRFYKAGWSALKAGSGNMDLLVAIGTSAAYGLSLYLWYS
    FDGHHGAPHLYFESSAAVLTLVLLGKLLEKRAKRRTTDALHALENLKPTTATVLRDAQWQSMPAAQLVSGDVVKVLPGDR
    IPVDGLVIKGSSHVDEALISGESIPLHKSLDQKVTGGSVNLDGVLEIKATAVGSESTLSKIIRLVEQAQGAKAPVQALVD
    KISSIFVPVVLLIATITVLTWGLYFGDWSQGILHAVAVLVIACPCALGLATPAAIMAGTGTAARHGILVKDAIALEQATK
    IDYVVFDKTGTLTEGKPELVQITAFDDAENVLLEHAYGLQQHSEHPLAKAVISYAIRHQVSLPEVTQFTVVAGKGVKGEI
    HGRKLMFGSSHWMRELGLSLPTDKIQIKGASISWLAELTDAGVILAGLFCFADKAKPESKQAVKALQQRGIKVAMLTGDS
    NDSAAQIAAELNLDNYQAEVLPQGKAEAVAQYQQQGFKVAMVGDGINDAPALAQSDLGIAMATGTEVAVSAAAITLMRGN
    PELVASSLNLASATYRNIQQNLFWAFAFNTVGIPLAAMGYLNPVIAGAAMACSSVLVISNALRLQRKSF

    >gi|119774931|ref|YP_927671.1| cation transporter E1-E2 family ATPase [Shewanella amazonensis SB2B]
    MSKQPCFHCNEPVLTGSQFITQIDGVDQVMCCPGCQAVSQAIVDAGLLSYYKYRTEPGSRQTALIPESLNHFSAYDLPEV
    QQDFVQERDGREEVTLSIDGIT
    CAACAWLIEHKLQKLDGVERIQVNSTTQRAFIRWQPALVKLSYILSAIGSIGYNAAPF
    QLDDQEVISKRNSRRFLLRLGLAGFATMQVMMFALALYAGYFTDLETEFRDYFRWVSMIFAAPVVFYSAQPFYFSAIRAI
    LSGKLNMDVSVSIAICGAYIASCVATIQGTGEVYFESVSMFTFFLLLGRYFEQNARQKASVSSSNLHKLVPLTASLVTAQ
    GIEEVPAKKLQVGDIILVSPGDVVAADGKIVEGISGINESMLTGEQLPISKAPGAEVFAGTINLEQPIRVEVTAIGQDQL
    VAEIIRLQELASNAKPAIALTADKLARYFSATILTIAAMTYVVWRQFAPEDAFWVTLSVLVATCPCALALATPTAVTCAT
    GLFTRLGIISRNGSVFEKLPKIKTVVFDKTGTLTCGSFSFGDIKLFEGLEKSRALAIASALEQGSLHPIARLFARIPTKL
    EVTRQHHLVGAGVEGIIEGIRYLIGSAEYLKVPSEMIFPGQWVYLGTRNNVLAAFEIQDKLRDDAKETVAALKAKHIELQ
    IASGDTSAHLQQVASTLGITKVNGGLKPKGKLELVESLRSNNTLVAMFGDGINDAPVLAGADLSVAMGSGSAIAKNSADL
    ILLGDHLHRFVEAMNIAVKTNQIIRQNLAWALGYNMLILPLAVTGHVVPYIAAIGMSASSLIVVGNSLRLLRLKP

    >gi|119774965|ref|YP_927705.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella amazonensis SB2B]
    MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSGKLESAIGMSMATTFVLTLASVLSFLVNQYLLAPFDLTYLRTMSFILV
    IAVVVQFTEMLVQKTSASLHRALGIYLPLITTN
    CAVLGVALLNVNEQHDFLESAIYGFGAAVGFSLVLILFSAMRERLAA
    ADVPMPFRGGAIAMITAGLMSLAFMGFTGLVK

    >gi|119774970|ref|YP_927710.1| SoxR-reducing system protein RsxE [Shewanella amazonensis SB2B]
    MSNYKEIAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATVAVLIGSNVLVSLVREFVPKEIRIPVFVMIIAALV
    TVVQLVINAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASRNSVGAAAFDGLMMGTGFTAVLAVLGAVREILGQGTLFDG
    ADQLLGDWAASLRIELWHVDNSFLLAMLPPGAFIAMGLLIAGKNVIDKRLEAKKPTPEAAPAITRARITKVG

    >gi|119774993|ref|YP_927733.1| thiF protein, putative [Shewanella amazonensis SB2B]
    MLADKDFIRYSRQILLPECGEAGQLRLRNSHVAIVGVGGLGCQAAMLLAASGVGHLSLFDADSVELSNLPRQMLFCDLDL
    GKTKAGVAAARLQAREPGLKVSVYGELNSETLTQLDGAGLVLDCTDNFTARHLISAYCAKHGKTLISGAIAGFDGLLFVQ
    RPGEGGCYQCLFPPGTTSAQN
    CAAVGVMGPAVAIVASMQAQLCLNELLQLPCEAGRLQRFDFRHFRWHEARVPADPLCPV
    CGKGKERKAC

    >gi|119775045|ref|YP_927785.1| thioredoxin-dependent thiol peroxidase [Shewanella amazonensis SB2B]
    MNTLKAGDKAPHFTLPNQNGEMISLAECLKNGPVLVYFYPKALTPGCTDQACGLRDSKPQLDAKGVTVFGISPDPVAKLK
    KFEEKHGLNFHLLSDEDHAVADAFGVWGEKKFMGKVYDGIHRLSFIVGTDGTITQDLTKFKTKTHHETVLEALG

    >gi|119775049|ref|YP_927789.1| arsenate reductase [Shewanella amazonensis SB2B]
    MKKAIILHNPRCSKSRETLALLGEQGVEIEVVEYLKDTPDAAEIARILSLLGIGARELMRTKEEEYKALGLDNPALDETA
    LIDAMVANPKLIERPVVLANGKAAIGRPPANVLEIL

    >gi|119775054|ref|YP_927794.1| glutaredoxin-related protein [Shewanella amazonensis SB2B]
    METVERIKQQIAENPIIVYMKGSPKLPSCGFSARVAEMMINIGEQFAYVDILQHPDIRAELPKYANWPTFPQLWVEGELI
    GGCDILTEMFQKGELQPLIKEVAAKYKTEE

    >gi|119775061|ref|YP_927801.1| disulfide bond formation protein b [Shewanella amazonensis SB2B]
    MQSLISFAHSRLSWGILALSALALESAALYFQHIMKLDPCVMCIYQRVAVFGLLGAGLFGFMAPANRVIRALGALLWGIS
    AAWGLKLALELVDMQNNPNPFST
    CSFLPEFPSWLQLHEWLPSVFMPTGMCTDIPWEFAGVTMGEWMIVAFSVYLLAWLAF
    IVPMLKKSA

    >gi|119775126|ref|YP_927866.1| bifunctional methionine sulfoxide reductase B/A protein [Shewanella amazonensis SB2B]
    MRTLNEFERYVIEEKGTERPFSGEYYLHNAQGVYCCRKCDAPLYLSEHKFHAHCGWPAFDDEIPGAVARHTDADGHRVEI
    VCASCGGHLGHVFEGEYLTEKNLRH
    CVNSVSMVFKSHEEMEQGQKTISEAGPTANAFATFGAGCFWCVEAIFLALKGVVS
    VKPGYAGGPAADANYKRVCDGDTGHAEVVHIEYKPDEVSFETLIEVFFQSHDPTTLNRQGNDVGTQYRSVIFAHNEPQAE
    AAAKAIEALTKSGAFDNPIVTEVVAFDEFYPAEDYHHDYFARNGEQRYCALVVKPKVDKFKKAFASLLK

    >gi|119775216|ref|YP_927956.1| glutaredoxin 1 [Shewanella amazonensis SB2B]
    MYVVIFGRPGCPYCVRAEQLCEQLAEKREDFRFRYVDIHAEGISKEDLSKTVGKPVETVPQIFVDKTHVGGCTDFEAYVR
    EHNLLA

    >gi|119775229|ref|YP_927969.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Shewanella amazonensis SB2B]
    MSVLVGRKAPDFTAAAVLGSGEIVDNFNLTAAIKGKAAVVFFYPLDFTFVCPSELIAFDHRMEEFTKRGVEVIGVSIDSQ
    FSHNAWRNTPVDKGGIGPVKYTLVADVKHEICQAYDVEHPEAGVAFRGSFLIDKEGMVRHQVVNDLPLGRNVDEMLRMID
    ALQFHEEHGEVCPAGWEKGKKGMSASPDGVAAYLSENADDL

    >gi|119775319|ref|YP_928059.1| phage shock protein E [Shewanella amazonensis SB2B]
    MNPLAKVGQLALIGLMLILTSTLAIGQDKDAATAWKLIEQGAMLVDVRTPEEYAAGHIEGAINIPYEEVAAEFAKRAIDK
    NTSVVLY
    CRSGRRSGVANEALNAAGFTQVYNGGGYETLAQSGKSGQSQK

    >gi|119775323|ref|YP_928063.1| rhodanese-like protein [Shewanella amazonensis SB2B]
    MQHNPGFVALVESILPKVTEITVEEYQADDSWQLLDVREDHEWLKDRLPGARHLGRGILERDVETRFPDKSTPLLLYCGG
    GYRSALAAYNLQLMGYTKVASLVGGYKAWVARQLPLVTD

    >gi|119775331|ref|YP_928071.1| thioredoxin, putative [Shewanella amazonensis SB2B]
    MNDAPAPRSKTKRLLVEALIAIGLFYGISAYFQKDMLKDTAPVIAAKGVNGTSLSLPSATGKPTLVYFFASWCGACKLTS
    PAVDNIAGDYPVLAIAADSGSDTDVIAFLKEKGYGFDAINDKGTLTTHFGVSGFPSLYVVDARGEVRFVTRGVSTEPALR
    ARLFLTELLQ

    >gi|119775339|ref|YP_928079.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Shewanella amazonensis SB2B]
    MMRIANNSCKLHAPAPMAATCTLESPVGTLWLGASENGLMTLKAAPFNDVPVYHSEQAVTRAKGHLQAACSQLAEFFEGK
    RHQFDLALAPKGTEFQRAVWQALLTLPWGETASYSDIALQIARPKAVRAVGAANGANPVAIIIP
    CHRVIGKGGALTGYAW
    GLKMKASLLKLESAIPSLR

    >gi|119775548|ref|YP_928288.1| OsmC family protein [Shewanella amazonensis SB2B]
    MSFRLQTRWQASDTPEGEFSRDHHITFGSGQTIEASSAPEYKGNPAMVNPEESLLAALSSCHMLTFLAIAHLKRLPVKSY
    EDCASAELGKRDSGKLAVTYMQLNPTVEFMDGVEVSRDTLEKMHEKAHAN
    CFIANSLDCEVEIRF

    >gi|119775565|ref|YP_928305.1| thiamine biosynthesis protein ThiI [Shewanella amazonensis SB2B]
    MKFIVKLYPEIMIKSKPVRMRFTKMLESNIRNVLKKIDEDAKVQRQWDKIMVKVPKDKPELTELFAERLAHIPGIHHVLQ
    VAEYDFETVDDIYQLALPVYRDMLKDKTFCVRVKRAGQHDFNSIEVERYVGGGLNQFTEAKGVQLKNPDVTIQLEIDRDK
    LYMVSQRIEGLGGFPIAAQEDVLSLISGGFDSGVASFQFIKKGSRTHYCFFNLGGAQHEIGVKQVAYHLWKTYGESHKVK
    FVSVPFEEVVTEILERIENGQMGVVLKRMMMRAATRVAERMGIQALVTGESLGQVSSQTLTNLNVIDRSTDLLILRPLIS
    MDKPDIIREARRIGTEDFAASMPEYCGVISQRPTVKAVLSKVEAEEQKFSEDLLDRVLAKAEVIDIRDIAVATSERVTET
    ETVSSAAGNEVIIDIRAPEEEESRPLDVDGVEVKVIPFFKLATAFAELDKDKTYLLY
    CERGVMSKLQALYLQEQGYNNVK
    VYRP

    >gi|119775598|ref|YP_928338.1| anti-oxidant AhpCTSA family protein [Shewanella amazonensis SB2B]
    MFKKALCIGLALVAAQGMAQDRDSVTMGGKQVMLSGTLPQVGETAPGFRVVDASFKPVALSDFKGKTVLISAVPSLDTGV
    CALQTKRFNDEVGKFDGKSVVMLTLSTDLPFAQKRFCKTEGVENIQVLSDSVWRNFAEEYGLLIEDRGLLARSIFIVDAE
    GTLRYKELVGEVSHHPDYDAALAALKDISQQ

    >gi|119775607|ref|YP_928347.1| glutathione peroxidase, putative [Shewanella amazonensis SB2B]
    MAETVETQNAAEHTAGTQVACPAYLNHEFRKLHSSESVNLCDIAAGKPVLFINTASNCGFTPQFKALELLNKEYGPKGLV
    LVGFPSDDFFQEENDEKDTAKVCYLNYGVTFTMLATSAVRGGDANPVFEYLGEKAGSPKWNFYKYLVSADGKEVTAFNSR
    VKPDSLELKAAIEAALPKAL

    >gi|119775667|ref|YP_928407.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella amazonensis SB2B]
    MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVKTAMGLGVAVIVVLAISVPANQIIYQGILAPGALAWAGVPEADLS
    FLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMVERDYNLPESLVYGVGSGIGWALAIVL
    LAGIREKMKYADVPDGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|119775668|ref|YP_928408.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella amazonensis SB2B]
    MANELKKVLTGPIINNNPIALQILGVCSALAVTSKLETALVMTLALTAVTAFSNLFISMIRNHIPSSVRIIVQMAIIASL
    VIVVDQILQAYAYDVAKQLSVFVGLIITN
    CIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVGFVRELFGNGSLFG
    VEILSKISDGGWYQPNGLLLLPPSAFFLIGVLIWIIRTYKPEQVEAKG

    >gi|119775681|ref|YP_928421.1| glutaredoxin 2 [Shewanella amazonensis SB2B]
    MGRPSLKENPMKLFVFEHCPYCVRAMMIVGYKGIALEKVILQNDDVDSRIRMVGANMVPILQKDDGSYMAESLDIVAFLD
    ALCGEALLEPAKHEQHIAAWLDKAGYYSSRLLHPRNVRMGLPEYGSEAAIRWYTEKKTAVIGMSFEEAFAASGEYIAALE
    PLFTELDLIPLPSERNNQLGYDDVLLFPVLRNLTAVKGLNVGKRVRSYIDEVAALTKVALFDTTAI

    >gi|119775815|ref|YP_928555.1| electron transport protein SCO1/SenC [Shewanella amazonensis SB2B]
    MTNKHTQSAIFIGKSLSILALLLAFAGFQVQAQMPVLKGIGGDFSMQSSKGTQVNLSDFRGKVVMMFFGYTNCADICPTT
    MAHISQLMQKMPAEERARIQVLFVSIDSDYDTPKHLNKYLSYFDPSFIGLVDERAKIDEVAAMYHADYSKLADDKVTTEY
    KKLSLERQGSAGKGYLYSHTAKIFVLDPEGRVRGFFYTGTPLDEMQADISSLLNTQAKS

    >gi|119775820|ref|YP_928560.1| hypothetical protein Sama_2688 [Shewanella amazonensis SB2B]
    MSHVEFPLAPELAVSAWLNTPTPLSLEDFRGKPLLIYVFQMLCPACISHGLPQLARVANTFGDDIAIMGLHSVFEHHGVM
    GPEALQAFVHEYRLRFPIAIDRPAGRIPETMARWGFQGTPTLVLLDADGRVRMQHLGVLEDMKLGKAIGTLLLQDALLAG
    EVNRPETSDSGLSAGSGPDLCDDRHCQQ

    >gi|119775845|ref|YP_928585.1| thiol:disulfide interchange protein [Shewanella amazonensis SB2B]
    MKIITFWFHILVGCILLACLPAMASDGPDQKIAASLLLESNTPASGTQTSLAVRMSPEAGWHGYWLNPGDAGFPLQLQWQ
    LPEGVTVGELQYPAPESLLISGMMNYIYHGDYALLAPLQIADDIAAGTAIDVAVELRYLVCSPTLCLPEQQRLETHFIVG
    DKGAPKTQQAAFNVWRQAIPKPVAASADFTVRDGLFVLSLPLPETASVTDNLHFYPEVNGALSNTAPQSFVQKGDRLFMQ
    TQAGEGDVSDFHGVLTLDKGLAIRVKATGQAGGALMFPTEAGLPAAQEGSLLSLSVVAVLGAVLGGLLLNLMPCVFPILS
    LKVLSLTHMGDERLARRGAVAYTLGAVLVCVMLGALILVLRQFGLQVGWAFQLQRPEIIVALILLMMAIGLNLAGLFEMG
    TLSSGSRLQQQQGPAGDFWTGVLAAFVATPCTGPFMATALGAALVLPAYVGLMVFAGLGLGMALPFLLVGFVPALRQRMP
    KPGAWMVTAKRIFAVPMLLTALGLVWVLMQQTDRQYVFVALLLAMLLGLALWLMGLLQHGGRERPWWPALLAVIIVAGTL
    LSVSPGAETQISKAGAETNRPLTFNEKDLSALIMEQDVFVYFSADW
    CLTCKVNETTAIERQDTQAAFERAGMAVMLGDWT
    NGDPQITEFLAKHQRSGVPLYLWYKKGNLQPEVLPQILTSSLLIERAGG

    >gi|119775846|ref|YP_928586.1| thiol-disulfide isomerase and thioredoxin [Shewanella amazonensis SB2B]
    MTQIPPKLSRLLIMSLSTLLLSSAFVGPSVASDDFAAEGERRAKVAGNELIGAPAPELTVTTLAGDSLNLGEIYGKKPVY
    IKFWATW
    CVPCRQQMPGFEDIYQQYGDELQVIAVNTGISDDNNSVTAFVKKAGLTMPMTIDDGSLARAFNLRVTPQHFLI
    DTSGHIAYVGHQDDEAFHQALKEVVAGAAAKPELSESQTNAVAKKAQVIERGDELSSLTLTALDKTDYPLPSTATPGKAT
    GLVFFAPW
    CEWYLAESEPATAKACQQVREMVEQHAANSKAQWLHVSGNLWSSEADLAEYQTNYAPRLPIVFDEQGSLFGQ
    FGVSQLPTVVYIDEHGKVTEKVSPKAPDFSERLNALLTGDVAE

    >gi|119775870|ref|YP_928610.1| thiol:disulfide interchange protein DsbC [Shewanella amazonensis SB2B]
    MKLTRTLTLLGSLALAPLVMAAPATPNDMLKQKIQSTLGLEVNSITASPVEGLYQAITNRGVLYITADGSKLIHGNIYDL
    NNQMNNLTEKALAGPRLDMLKEFESKMLVYKAKDEKHVVTVFTDIT
    CGYCRKLHREMKDYNDLGITVRYLAYPRQGVPSP
    NADEMEAVWCAKDPHKAMDDAKAGKNISLAKCDADIAGQYNLGGSFGVNGTPAIVLEDGSMIPGYQPASALFDVLEQRAV
    KQ

    >gi|119775968|ref|YP_928708.1| thiol:disulfide interchange protein, putative [Shewanella amazonensis SB2B]
    MILTLSTLMTLLLVAAVVALLIARSKGKPIPLAVIPVIGMMALMVGSATYFVHRASEQQDYRELLWQPLAADKIPMLVQG
    GYTVFVDLHSDW
    CMACQTNRVGILHRPEVVSTLLSGKVVLMQANWSQESERIAPHYGKVAAPGSPFNKVYGPGLPRGQIL
    PAELSASDVITAIRSAKGS

    >gi|119776066|ref|YP_928806.1| DsbA family thiol:disulfide interchange protein [Shewanella amazonensis SB2B]
    MHKRLTLAATLAALPFCGFAADFVEGKHYVQVSDQAPSKSPKVTEFFSFYCHNCFNMEVMYLPAIKQGLKDGISFDTKHV
    DFMNSDIGTEVMRALAVIHGSEKQSELTHAMFAAIQGADGGQGHHDHSAPGHSHEPQINSRDDIKAVFAQFGIDGAAYDK
    LADSKETDAKLTLWRQQQQAFEVQSVPSFVVNDKYRVNLQEIRTLEELSALINYLATEKDAAKDEGGSLGWAVLAMLALA
    AIGRRRLV

    >gi|119776109|ref|YP_928849.1| Na(+)-translocating NADH-quinone reductase subunit E [Shewanella amazonensis SB2B]
    MEHYINLFIQASFIDNMALSFFLGMCTFLAVSKKVSTSLGLGIAVIVVMVLAVPLNQLIYVAVLKPGALAWAGFPELDLS
    YLQLITFIGVIAALVQILEMVLDRFMPVLYQTLGIFLPLLTVN
    CAIFAGVIFMANRDYTLTESAVFAAGAGTGWAVAIVL
    LAGIRERLKFNAIPEGLQGIGITFITTGLMALGFMSFAGISL

    >gi|119776110|ref|YP_928850.1| Na(+)-translocating NADH-quinone reductase subunit D [Shewanella amazonensis SB2B]
    MSAVLSNRELLMRPVFANNPVAMQVLGVCSALAVSNSMQTALVMTLAVTFVLVCSNFFISLIRAFIPNSVRIIAQMTIIA
    SLVIVVDMVLQDVAPDLSKQLSVFVSLIITN
    CIVMGRAEAFAMKEPPHLSVMDAIGNAAGYGFILLSVAFVRELLGSGTL
    FGHSILKTIEQGGWYLPNEMFKLPPSAFFLIGVIIWVVNIAQRKRAKA

    >gi|119776237|ref|YP_928977.1| hypothetical protein Sama_3105 [Shewanella amazonensis SB2B]
    MTDSALLYSFRRCPYAMRARMALILCQLPVRVREVALKDKPAELLALNPRGTVPVLVSGDTLLTESLDIMLWATAQSSHP
    YASRLKQQVPAALALITVNDEGFKPWLDKYKYFDRYPQFDQSYYRDNACEFIADLDNRLRHSSMLLGEEPSLADVAIFPF
    VRQFAGVEPGWLAARYPKVARWLDKHLASKAFSACMYKYPLYQQQGNTLPLVLAQD

    >gi|119776344|ref|YP_929084.1| hypothetical protein Sama_3212 [Shewanella amazonensis SB2B]
    MHNNIKALLATTALFFTAPLLADSGCGFESKSGGVFATCSEEKQEVILTGIVEAQRLVTELPEFTEGYKTYEVDTPALGP
    IKAETEATEIVVIIGTW
    CPDCHRETPRFIRIMEEVGNPNIKVTYIGVDRAKADPEGLAAKYEFKRIPTFIVLQKGEEIGR
    IVERPTESLEKDLANILK

    >gi|119776348|ref|YP_929088.1| thioredoxin [Shewanella amazonensis SB2B]
    MSDKIVTLSDDSFENDVLKSELPVLVDFWAEWCGPCKMIAPILDDVAAEYEGKVTVAKLNVDHNNASPAKYGVRGIPTLL
    MFKGGELVATKVGALSKTQLKEFIDAQL

    >gi|119776453|ref|YP_929193.1| thiol:disulfide interchange protein DsbA [Shewanella amazonensis SB2B]
    MKKALLMAAALLVAPLMSMAADFKEGVHYEVINEGPGSAKPEITEFFSFYCPHCYNFSKTVVPMIEAKKPEGVAFNQAHV
    DFIGREMGPEMSRAFAVAHQLKVEKKMEKALFAAIHDKKQHFTTRDDVRALFVANGVDGKDFDSAANSFMVNAQMSKMKR
    DTENAKLSGVPSLVVNGKYKVLTDSIKSYEEMLDIAFYLATKKD

    >gi|119776475|ref|YP_929215.1| methionine sulfoxide reductase A [Shewanella amazonensis SB2B]
    MMHSCRTTKLPHSAADGATNLAGITLGGGCHWCTEAVFQRLSGVIEVEQGWARSNPPADEWSEAVTVHFNPEQISLTELV
    RVHLYTHSATKAHSLRGKYRSALYSCNESQQQQLTEILATLADEFLQPLVTLILPLEGFKASPAEYQNYYQTDPDRPFCQ
    VYIAPKLEKLARLLEDDKS

    >gi|119776529|ref|YP_929269.1| phage shock protein E [Shewanella amazonensis SB2B]
    MLHSMLARLSGSAQPAECWQLVKHGATLVDVRSPAEFAQGHLPQALNIPLDTLEHWQSAQADKAVPLVLYCGAGIRAQKG
    CDILRAKGFSSVINGGAIKDLLAGA

    >gi|119776645|ref|YP_929385.1| anti-oxidant AhpCTSA family protein [Shewanella amazonensis SB2B]
    MITTGQSLPVGQLAELTADGMVNHDVQSLFAGKKAVVFAVPGAFTPTCSAAHLPGYVVLADEIKAKGVDFIACISVNDAF
    VMKAWGDAQNAAEIKMLADGDGQFTQALGLTMDTGAFGGVRSQRYAMVVDNGVVTLLNVEAPKAFEVSKAEVVLAAL

    >gi|119776675|ref|YP_929415.1| glutathione reductase [Shewanella amazonensis SB2B]
    MAQHYDYICLGAGSGGIASANRAAIRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAQVAEAMHLYAKDYGFDVDVKNFD
    WNTLVASREAYIDRVHAAYGRGFASNGVTLVEGYGKFKNNNTIEVNGEEYTADHILIATGGRPSIPNIPGAEHGIDSNGF
    FALSEQPKRVVVVGAGYIAVEIAGVLHALGSETHLCVRKHSPLRSFDPMLSQALTDAMAENGPTLHTNAVPKAVEKNADG
    SLTLQLENGESITVDCLIWAIGREPATDKIGLENTDVTLDDKGYVIVDEWQQTSAKGIYCVGDIMAGGIELTPVAVKAGR
    FLSERLFGGQPNAKMDYSLVPTVVFSHPPIGTMGLSEPDAKAQYGEDQVKVYTSTFTSMYTAVTAHRQPCKMKLVCAGPD
    EKVVGIHGIGFGMDEILQGFGVAIKMGATKADFDAVVAIHPTGAEEFVTMR

    >gi|119776701|ref|YP_929441.1| hypothetical protein Sama_3569 [Shewanella amazonensis SB2B]
    MEIKVNFLDNLRLEAKFDDFTVVADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCVSRDIPTEGIRLSQNNIVDPE
    NRYNQQFKIQVELPESISDKDREGILRSIDRCTVKKVVQTGPEFVIETVENLDEDAQAMLMVTPDADHSTFIVGKDLPLE
    QTIANMTAKLAELGMKIEISSWRNLVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLSCNFFYNDQYFGEE
    IANAEFVHYPNEKWFPLEEDDSLPAGLLDEYCLDIYDNDGELCGSHLVDTNSGNYERGICAIPYIRHSDGETVYFPSNLI
    ENLFLSNGMSAGNNLAEAKVQCLSEIFERAVKRQIIEEEIALPDVPKDVLAKYPSIVAGIDALEAQGFPVVVKDASLGGQ
    FPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDVQKPTFNSMAVQEPENFVEHFIDSTGVISWRF
    FSAKHDYEFVEWDFSGTNEEESTALFGILEDLGLEAYIAEFTALGSACRILVPGYSEVYPVTDLIWDNTNKALDFREDIL
    NLHRLSDDELADLVERLEESELDNYTDIITLIGIEFDENTVWGQLTILELKLLCYLALGELEAAQELTETFLQYNDNTVK
    RGLFYQAMSAVLEISLDDELALEDYRHNLTRMFGEETMDAVIGSVEGSVRFYGLTPTSMKLEGLDRHQRLIESYKKLHAA
    RAKLAGL

    >gi|119776715|ref|YP_929455.1| thioredoxin domain-containing protein [Shewanella amazonensis SB2B]
    MLTLETPQQLAEALAQHPGLLLLIGGKDCGVCQVLKPKIASLLVTEFPAMTLAYIDCQASGEVLCGQIGVFSLPVVRVFF
    HGDSFGELTRVFSMADIKNLLERPYSLCFN

    >gi|119774738|ref|YP_927478.1| hypothetical protein Sama_1601 [Shewanella amazonensis SB2B]
    MAEFVLYHTDGCHLCHLAEALLQEAGVTYLMVDICDDELLAERYGVRIPVLLRKQDGAELGWPFELVDVTSFTGV