Segniliparus rotundus DSM 44985 uid49049

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296392454|ref|YP_003657338.1| thioredoxin reductase [Segniliparus rotundus DSM 44985]
    MPETLENLIIIGSGPAGYTAAVYAARAQLNPLVFEGTQFGGSLMTTTEVENFPGFQEGVQGPDLMVEMRSQAERFGARLQ
    TKDVEWVELGGDRKLVHVDGEVHAARAVILAMGAAPRYLGVPGEQELLGRGVSS
    CATCDGFFFKDQDIAVIGGGDSAMEE
    ATFLTRFAKSVTLIHRRDEFRASRIMLERAKSNPKIKFVLGASVSRVLGSTSVTGVELSHVATGQTSELPVTGLFVAIGH
    DPRAELVVGQVDQDEDGYVKVQAPSSATSTPGVFAAGDLVDRHYRQAITAAGSGCVAAIDAERWLAAAETAQAAPRHALS
    AQH

    >gi|296392455|ref|YP_003657339.1| thioredoxin [Segniliparus rotundus DSM 44985]
    MADSESKTLTVTDNSFAQDVLASEQPVLVDFWAAWCGPCRMVAPVLEEIAKEQAGKLVVAKLDVDANPKTSTKYDVNSIP
    NLILFQNGEPVKQIIGAKPKAAILRELGL

    >gi|296392577|ref|YP_003657461.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Segniliparus rotundus DSM 44985]
    MSSSASPRYDLVVIGSGPGGQKAAIAAAKLGKSVAIVERKHMLGGVCLNTGTIPSKTLREAVLYLTGMNQRELYGASYRV
    KSNITPEDLFARTAQVIGKETEVVRSQLQRNRVEIFPGVASFVDEHTVEVVDDDRGESTRLHGEFFVIATGTRPARLPGV
    NYDEERILDSDEILQLKAIPATMVVVGAGVIGIEYASMFAALGTRVTVVERRPSMLEFCDPEVIEALRFHLRDLAVTFRF
    GEEVTDIEVGPNGAVTKLASGKRIPAETVMYSAGRQGQTEALALENAGLSADDRGRIQVDKHFQTAVDHIYAVGDVIGFP
    ALAATSMDQGRLAAYHAFGESAEGMTELQPIGIYSIPEVSYVGATETELTKAAVPYEVGVSRYRELARGQIAGDSYGMLK
    LLVNTDDRKLLGVHIFGSQATELVHIGQAVMGCGGTVDYLIEAVFNYPTLSEAYKVAALDVANKIRALAQYCD

    >gi|296392628|ref|YP_003657512.1| peroxiredoxin [Segniliparus rotundus DSM 44985]
    MSTLLDTPVTTLHGQSTTLRELAQPSGPVLVVNVASKCGLTPQYKALEELAENYGPKGLTVVGVPCNQFGGQEPGSAEEI
    QTFCSTTYGVTFPLLEKAEVNGEGQHPLYRELVQKADAEGHAGAVQWNFEKFLIAPDGSVSARFRPTTAPQAPELTAAIE
    ALLPGA

    >gi|296392757|ref|YP_003657641.1| redoxin domain-containing protein [Segniliparus rotundus DSM 44985]
    MRLIRHIRAFAFSRALVAVVAMAAGLAVAVAPARADTPDQLQFTATSLDGKEISGATYAGKPAVFWFWTPWCPYCNQEGS
    FVQKVASEHPNVPFVGVASRSDQGAMRDFVNKYGLNFPQIEDSSGEIWGKFGVTWQPAFAFVSSNGDVDMVKFGDLLTED
    QLSDRVGALR

    >gi|296392892|ref|YP_003657776.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Segniliparus rotundus DSM 44985]
    MALQVGDVVQDFELPDQTGAPRKLSEFLALGPVVVFFYPKASSPVCTAQACQFRDLGAQFRELGAQRVGISKDSVSGQAG
    FVSGKSLDFPLLSDKAGVAAALFGVKGGLGGLSPVKRSTFVLDQTGKVLKAIHHEFRGKAHADEALAFLQSVVAS

    >gi|296392951|ref|YP_003657835.1| rhodanese domain-containing protein [Segniliparus rotundus DSM 44985]
    MHVDPASVAAGYAVPERVVSTEWLSANLGHRQLRLLEANEDSLVYDAGHIPTAAKVDWRTELASPNSHDVLDPSRFASLL
    NSKGIDRNHTVVVYGDKQNRWAAHLVWILTLFGHTDVRLLDGGRAAWLAEGRETTLDFPRLAQADYPLVKRDDETNRVFR
    DQLARSLGSCTVLDVRSPEEYAGPRRPVPEYPVERSARAGHIPSAKNIPWASAIHPSGHFLSAAELTQVFDGLAEGKRSK
    VVTY
    CQIGERSAHTWFVLKFLLGVSSARNYDGGWSEWGNTVAAPFATGEEPGAP

    >gi|296393186|ref|YP_003658070.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Segniliparus rotundus DSM 44985]
    MTDVVIIGGGPAGYEAALVARDQGADVVILDEAGMGGSCVLYDCVPSKTFIASTGVRTELRRAENLGFNIDNVEHLLRPS
    TLQQINCRVKELADAQSADIHDKLAEQGIRVLIGRGEIADKQPGLAAHEVLATVNGRTERLRADVVLIATGSSPRTLPNA
    QPDGERILTWRQIYDLQTPPEHLVVIGSGVTGAEFVHAYTELGVAVTAVSSRDRVLPHEDQDAARVLEEVLAHRGVTIVK
    NAAAESVRRTKTGVRVALADGRAVEGSHALLTVGSVPNTTGLGLEKAGIELTERGHIKVDRVSRTSALGIYAAGDCTGLL
    PLASVAGMQGRIAMYHALGEALSPIKLRTVTSAIFTRPEIAQVGVTQKDVDSGKVQARTVSLPLATNARAKMGAIRRGFV
    KLFCSSGSGRVLGGVIVAPSASELIQPIALAVRNKLTVEDVTRTFSVYPSLMGSINEAARILSSDDDE

    >gi|296393189|ref|YP_003658073.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Segniliparus rotundus DSM 44985]
    MTESAHLCVGDPAPAFTLESDSGTPVSLSDYAGKQVLVYFYPAASTPGCTKQACDFRDNLAALQDAGIAVVGVSPDPVAK
    LAKFRDKENLTFPLLADPTKETLTAYGAFGEKKMYGKTVQGVIRSTFLVDEKGVIKLAQYNVKATGHVAKLLRDLGI

    >gi|296393474|ref|YP_003658358.1| iron-sulfur cluster assembly accessory protein [Segniliparus rotundus DSM 44985]
    MTADLQAEAREHEVVLTDSAAVKAKALLEQEGRDDLALRISVQPGGCAGLRYQLFFDDRSLDGDLVSEFDGVRLVVDRMS
    APYLSGASIDFVDTIQKQGFTIDNPNATGSCACGDSFN

    >gi|296393700|ref|YP_003658584.1| glutaredoxin-like protein NrdH [Segniliparus rotundus DSM 44985]
    MSPVNTVGTQTITLYTKPACVQCDATHRAFNRAGIAHEVVDISADDDARDYVMALGYLQAPVVVAGGEHWSGFRPDRIAA
    LTAGAAVA

    >gi|296393983|ref|YP_003658867.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Segniliparus rotundus DSM 44985]
    MALLTIGDQFPAYKLQAVVPGDLSQVNAQKPDDYFTTVDSAENSGKWRIVFFWPKDFTFVCPTEIATFGKLNADFEDRDA
    IVHGVSVDNEFVHFQWRAQHDDLKKLPFPILSDLKRELATAAGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVEE
    VLRVLDALQSDELCACNWKKGDPTIQVKEALAEAVSA

    >gi|296393984|ref|YP_003658868.1| alkylhydroperoxidase [Segniliparus rotundus DSM 44985]
    MSVEAVKEALPEHAKDLKLNLGSIVRSTVLSEQRLWGTILATAAASRSAKLLKEVSEDALDILSAEAAEAALGAAAVMGM
    NNVFYRTRGFLNGAYDDLRAGLRMNIIANPGVPKADFELWSLAVSAVNGCSH
    CVVSHEATLREEGVSREEILEAVKVGAI
    LAGVGQALTTAQAL

    >gi|296394056|ref|YP_003658940.1| methionine-R-sulfoxide reductase [Segniliparus rotundus DSM 44985]
    MPTSSQSPKLSKAEAEALSEEQWRERLSPSEYQVLREAGTERPFVGEYTDTTTVGVYSCRACGAELFRSEAKFDSHCGWP
    SFFTPLAGDAVIEREDRSLGRARTEVLCGNCGSHLGHVFAGEGYDTPTDQRY
    CINSISLRLESDE

    >gi|296394063|ref|YP_003658947.1| methylated-DNA/protein-cysteinemethyltransferase [Segniliparus rotundus DSM 44985]
    MKQIDPTDLCPVESADLDRVRARLASAAADQGLLDVAYRVVDSPLGPLLAAATPLGLVRVAFAREGHDGVLQSLADQISP
    RVLQAPGRLDAFAWQLDSYFSGRLRCFDLALDWQLSRGFRRTVLEHLAAGVPYGTTATYATLAQLAGSPRAVRAVGSACA
    TNPIPLVVP
    CHRIIRSDGAAGGYRGGAEAKRVLLDLENTA

    >gi|296394065|ref|YP_003658949.1| methylated-DNA/protein-cysteinemethyltransferase [Segniliparus rotundus DSM 44985]
    MSTTTSAARHVVVEFFLGTLAIGPLTLVRDEEGLTGIFFPGHWTRPDESSFGARTDPARDDSFNEAIAQLREYFAGSRRE
    FDLELRPRGSQLAQRVWRRLAQVPFGQTTTYGALAKEIGGGISPRAIGGFVGHNPVSIIIP
    CHRVLGSTGGLTGYAGGLD
    RKRALLEHEGALLPAEAMLW

    >gi|296394101|ref|YP_003658985.1| redoxin domain-containing protein [Segniliparus rotundus DSM 44985]
    MRQPLVALGCALLALTSTACVVRQPSPNGIFSPDGKPEHWYDPGHRPALTGPVAGPDLLTDKRISLDDPQFAGKAVVINT
    WGSW
    CGPCRGETPALESTYQASKDRGVAFLGVDLREDSRDAAKDYVLDRGVSYPSIYDPSGRSLLGLSAHVSTSAVPTTV
    VLDRTHAVAFVHIGAVSQTSLEPVLDKVLAE

    >gi|296394236|ref|YP_003659120.1| thioredoxin domain-containing protein [Segniliparus rotundus DSM 44985]
    MYGAVDLSALKAQADRPAPPAQSPEGSAAGTAAGPAAESEHVFDVDEADFESQVLERSTRQVVVVDLWAPWCQPCKQLSP
    VLEGLAAQSGGRWALAKVDVDANQRIAQVFGARSIPMVVAIAGGRPVSAFQGAQPEATVKQWLADVLEQAAPLYGQEESG
    DEPVDPRLVAASEALSAGDFAEAKALFEDIKARGTDETEGSQKAAARKATAEAGLREVAFLERVSALSPENTVRAAQEEP
    GDTAAQLDMADLEVAAGRAEQAFDRLIALVRTSPDPGKTTARVRLLELFELFDPADPTVIAARRKLASALY

    >gi|296394268|ref|YP_003659152.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Segniliparus rotundus DSM 44985]
    MTLAINRTASATRGLRAPSVVVIGAGMSGVCMGVKLKQAGIEDFIILEKGASVGGTWRENTYPGLTCDVPSHLYQYTFDK
    NSEWSHLFSPQPEIESYFSGAAERFGIVPHIRFGEEVLEAVFEGTAWRVKTSKGEYTADFLVAASGVLHKPRMADIPGID
    KFEGALFHSARWDHSVPLDGKRVAVVGTGSTGVQIVSALQKRGIDVTLFQRTPQWVMPLPNPPTGPVVRLLLRKVPLLDN
    VFYWTMRQFFGIFAQATIQPDSWKYKLIDTMCRWNLRTVRDKQLRAKLTPPDKPMCKRMVMHPSFYRRMQQPNVRLVTEG
    VDHIEQRGVVTKDGELHEADVIAMCTGFDPQAFVQPVDLVGEDGRTLSQTWQASGGPRAYRTVALPGFPNFFFIMGPHSP
    VGNFSLVAVAETQAKYIMRWIDRWREGQFDTAAPKQSVTDAYNAEIKEASKSTIWNSGCNSWYLGKDGLPELWPWTPWAH
    EEMLADIAEHEFVLVKNPPTTSA

    >gi|296394307|ref|YP_003659191.1| hypothetical protein Srot_1901 [Segniliparus rotundus DSM 44985]
    MPENKKDLIEFWFDPACPWCWLTSRWILEVEKVRDVEVKFHIMSLYVLNEGREGLSDFYRERMPKTLPAVRVIEAAREKF
    GEQIVSPLYTAIGSRIHQNRPEDAPRPEQRDLIPAALAEVGLPAELIDAANTEPFGSGPHDEAIRASHHAGMDKVGPDVG
    TPTIHINGVAFFGPVLSRVPKGEEAGAVWDGAVALANYPYFYELKRSRTEGPQFDF

    >gi|296394388|ref|YP_003659272.1| dihydrolipoamide dehydrogenase [Segniliparus rotundus DSM 44985]
    MADEYDVVLLGAGPGGYVAAIRAAQLGLSVAVIEEKYWGGVCLNVGCIPSKALLRNAEIAHIVQKQAKEFGISGEVSADF
    GAAFDRSRKVADGRVRGVHFLMKKNNITEYSGWGAFLDAKTIEVKSQDGTTTQVRGKNVVIATGSTVKLPPGVSVSKNVV
    TYEEQILSRELPGSIVIVGAGAIGVEFAYVLRNYGVEVTIVEFLDRVLPNEDAAVSAELHKQYRKLGVKLLTSTAVKSVQ
    DDGSKVHVEYESRDGKAGSIDVDRVMLAIGFSPRVQGFGLEKTGVALTERGAIAIDERMRTNVEGVYAIGDVTAKLQLAH
    VAEAQGVVAAETIAGAPTLELGDYRQMPRATFCVPQVASFGLTEEQAKAEGHEIKTASFPFSANGKAAGLGESAGFVKLV
    ADAKYGELLGGHMIGPDVSELLPELTLAQKWDLTVEELIRNVHTHPTLSEALQEALHGLAGHMINF

    >gi|296394533|ref|YP_003659417.1| DSBA oxidoreductase [Segniliparus rotundus DSM 44985]
    MRNVLGFRRVLLMPILLVLSVVPVPRAGADPADTAVATIGDDGAPVVIDVYEDYLCPYSAAFEQEFGARLIEAAASGKLS
    VRYHMLRFLDPRSASGDYSSRAAGAALALFERDPEDFAPLHQRLFAQETQPKEHGKSDLSNEQLAKIADDLGADPGAVSA
    IADGAQTAAAEDLAEQSADELRQSTGQVSVPTVVKDGKPVDVDDKNWLRKLLG

    >gi|296394534|ref|YP_003659418.1| DSBA oxidoreductase [Segniliparus rotundus DSM 44985]
    MTIKTKTQSKKGAAKAPVRKGPSPKIGEWMPWALGTVVIVALAVGVWWGIKQQYKEDTPGKFEPVLASVGKPDAPAVIDV
    YEDFM
    CPACAEFEGAYGEQIAKAVEDGKLRVQYHMLNFLNRNSASGDYSSRAAGAALAVFQKAPDKFLAFHTKMFSADTQ
    PREGSESDLSNDQLAKIAESVGAGAAAADIRSGADVKAAAGSAQAAIKQLQSLTKSVSTPTVLKDNKPLNWQRDDQWLQK
    IVGGPALTQTPAQTSTPAQTPAPKPAG

    >gi|296394546|ref|YP_003659430.1| glutaredoxin-like protein [Segniliparus rotundus DSM 44985]
    MSTATEPRFTLYSTTWCGYCRRLKIQLEQAQIPFAEVDIEEDPQAAEFVRSVNGGNQTVPTLRFPDGTAFTNPPLSKIKE
    KLAEADNV

    >gi|296394673|ref|YP_003659557.1| OsmC family protein [Segniliparus rotundus DSM 44985]
    MATHEFQTRLEWSGSTAGDYREYSRSHTAANPPARAELRLSSAPEYVGDAGLLNPEQLLVTAASSCHMLSFLALANRKKI
    DVRAYQDDALGEMPSDEKPVRISRITLRPVITVAPGSDHALVVELAHRAHDV
    CFIANSLNSEVRVEPKVLEA

    >gi|296395169|ref|YP_003660053.1| Heavy metal transport/detoxification protein [Segniliparus rotundus DSM 44985]
    MTVQSYYVTGMTCGHCVSAVSKELSAISGVSDVSVNLETGEVRVASHTPLGEGQVRDAVTEAGYGLV

    >gi|296395218|ref|YP_003660102.1| UBA/THIF-type NAD/FAD binding protein [Segniliparus rotundus DSM 44985]
    MPLPPLVPPAAELTAAEQERFSRQTILPELGEDGQLRLKNAKVLVVGAGGLGSPVLLYLAAAGVGTLGVVDFDEVELSNL
    GRQILHGSADVGRAKTQSAEDRIAALAPQTRVCPIRERLTSANAASLFRQYDLVVDGSDNFATRYLVNDSAAQTGKPYVW
    GSLHRFSGQVSVFWEAAPGGRGIDYRDLYPEPPAEGSVPN
    CAEGGVLGVVCGVVGSLMAAEAVKLITGIGEPLLGTLVLY
    DALTGRTRTVAVRRDPDRGPGEKFRADGEGLGERPEVFPGQGPDRGPGEKFRADGEGLGERPEVFPGQGPDRGPGETFSA
    AARSSRLAEPRSVRPRELAELLSSESPPALVDVREDAEWAGGHIAGAKHIPLARIASAAQSGEIPDDRMVVVY
    CGLGPRS
    AHAAKLLVDAGFKDVFDLKGGLIAWRAAQSG

    >gi|296395335|ref|YP_003660219.1| peptide methionine sulfoxide reductase [Segniliparus rotundus DSM 44985]
    MRMSLLSGWRVNAKLTVISPEDALPGRDLPVLRGGRSFFGGTPLDPLTASDHGPRNPQWPTDVETAVFGGGCFWGMEKAF
    WQLPGVFTTAVGYAGGTTANPTYKEVCSGRTGHAEVVLVAFHPDQISYSELLATFWESHDPTQGMRQGADIGTQYRSVVL
    TVAPRQQELAEQSRAAYQQELNKEGYGPISTEIRPLRAPSDSDCGFYFAEQDHQQYLAKNPWGYCGHGGTGVSCPVGLGS
    GARGPAAQ

    >gi|296395351|ref|YP_003660235.1| mycothione reductase [Segniliparus rotundus DSM 44985]
    MTSIDLAIIGSGSGNSIPDERFGSWRIAIFESGVYGGTCLNVGCIPTKMFVYAADVAEDIRESARYGLHASMDRVDWPSI
    VERVFGRIDPISSGGKRYRAEDCPNIDLHTSPVRFAGRAEDGAYRLTTGAGDEVLAKRVVIAAGARPVVPDAVVKSAAPF
    HTNEDIMRLPELPERLIVLGGGYIAAEFAHVFSALGSRVTVATRGEALLRRQDHDVSQRFTEIAKGKWDVRLGAEVASVE
    HVAGETTLFFSDGTRASGDALLVATGRRPNGDRLNLASVGIELDDAGRVVVDQHGRTAAEDVWALGDVSSPHQLKHVANH
    EARVVQANLLRGWESSELEAFDHRFVPAAVFTHPQIAAVGFTEQEARDQGLDIAVKTQNFGDVAYGWAMEDTTGFCKLVA
    ERGTGRLLGAHVLGPQASTLLQPLVQALSFGLDVRSMARGQYWIHPALTEVVENALLGLDV

    >gi|296395421|ref|YP_003660305.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Segniliparus rotundus DSM 44985]
    MNASLPLIALAVALIVGVAVGALWRSRQGKIRLAKPGPSAPDPHVDELAGHGVGSGEPVVMHFSAAWCAPCSAARAVIQS
    VTAEGRGRDVELDLDEHSALARKLGVLSLPTTLVYNGEGTLVARIAGVPKADKLRALL

    >gi|296395423|ref|YP_003660307.1| thiosulfate sulfurtransferase [Segniliparus rotundus DSM 44985]
    MSREHVLVSADWAAEHLNDPAVVFVEVDEDTEAYEFGHLPGAVRLDWRTELQDPVRRDFVSKEGFEKLLSSKGIAREDTV
    VLYGGNNNWFAAYAYWYFTLYGHEDVRLLDGGRKKWELDGRLLTATVPDRPTTDYKASEPDTSIRAFRDEVISAIGTANL
    VDVRSPDEFSGKILAPAHLPQEQSQRRGHIPGAINVPWSKAANEDGTFKSDEELRELYTGAGLDPGKETIAY
    CRIGERSS
    HTWFVLKELLGQDKVKNYDGSWTEYGALVGVPIELGA