Sebaldella termitidis ATCC 33386

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269118668|ref|YP_003306845.1| dihydrolipoamide dehydrogenase [Sebaldella termitidis ATCC 33386]
    MSVEIIMPKAGMSMEEGTIIKWLKEEGEAIKEGEPIVEILTDKVNMEVEAESSGYLLKKVRFENEVLPVFTVIGYIGEKG
    ESVSEVKEAEKKEEVKTETKTSDEKEYDVIVIGGGPAGYISANKASQLGAKTALVEKRELGGT
    CLNRGCIPTKTYIKNIE
    ILEEAEKAESRGLDIKVTKNISDLTKAVEFKNKVTKKLSQGVGGLLRSYGVDVYSTAGKLGEGKKVTLEDGQVLKGKKII
    LAGGSKTRYLNIPGIDSDKILTSTTILDLNKVPERLVIVGGGVIGCEFAEIFRGYGTEVTIVEAMSNLLPFNDKEISQEL
    EKIFKKKGIKLLTDKQVTGFKDKGKEIETVLKSGESLSSDYVLFSIGREADLSCVDGLEIKQDRGRLIVNEYMETSIAGV
    YAAGDINGLSMLAHSAFKMGETAAGNALGGREEVRLDNTPKCVYTLPEIASVGLTEEEALKKYGKIRTGRFNFGANGRAI
    ASSEEEGFVKVICDDNYGEILGVHVIGSKATEMISAGVILMEMEITIEEASELIYAHPTFSEAILEACADCLGKALHLPK
    KKM

    >gi|269118758|ref|YP_003306935.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sebaldella termitidis ATCC 33386]
    MKIIIIGGVAGGMSAAARLRRLDEKSDIIVIEKSGYVSFANCGLPYYIGGVIKEKDSLLLETPSTLKEKFNLDVRVKSEA
    VSINREKKEIKIKNIETNDEYTESYDKLLISTGAKPFVPDIKGLEEAGYLTLRNIEDMEKISS
    CIDSDGYKNAVIIGGGF
    IGLETAENLKHKNINVTIIEKADQVMAPLDPEMASFIHGEIKRRNIALYLNSDITEISNSGKKKIIKLKSGEVVETDIII
    ASIGVVPDSELAKNAGLKMSSKGAVEVDEYLKTSDSDIYAAGDVIEIRNAITGQKALVPLAGPANKQGRTAADNILGREE
    KYTGTIGTSIMKFFNMTAASTGINEKYLKKQDINYKSLFIIKADHAGYYPGASDIYFKILFEPETGKIFGAQAVGEKGAD
    KKIDIIATAILGNISVYKLKDLETAYAPPFNSAKDIINYASYMAENIKRDGLETVSWNETDKIGLIDVRTEDEYNIDHIQ
    GAVNMPLNTLRENMGKLDKNKEYIVY
    CKVGQRGYNAQRILVNNGYKVKNLNGGFSIYKSALMPQDNRIKFENDIKNDKHR
    SISGLNSADKKILDVTGLQCPGPIIKIKNKISELKTGEVLEVKATDPGFENDIKVWTRQTGNTLLNIENTDGEILAEIKK
    GESFLLSKKPDEEAVKENSTSLVIFSGDFDKVFAALVIANGALAMGNSVSIFFTFWGLNVLRKSNYKTRSKKGIIEKCFG
    IMMPKGVSKLKLSNMNFFGLGRKMINKVMKTKNIESLESLLEQYIENGGKITACTMSMDVMGIKKDELIENIEYGGVATY
    MENANKANHNLFI

    >gi|269119113|ref|YP_003307290.1| Thioredoxin domain protein [Sebaldella termitidis ATCC 33386]
    MGHPTVYPTGVTIYNSDKAWNGYTIIQACELGAVLLDMNGKELRLWEGLHGFPNKIFPGGHILGHSGSRNPKYGMQDMID
    LIQIDWEGNIVWKFNRYEYIKDGENEAEWMARAHHDYQREGSSTGYYSPGQEPKINSGNTLILVHKNLYNKKISDKLLLD
    DAIIEVDWEGNVIWEWICSDHFDELGFDEAAKNVLFRDPNMRKAGEGMGDWMHINSMSTLGPNKWYDQGDERFHPDNIIW
    DARESNIIAIIEKRSGKIVWKLGPDYSKEELKHIGWIIGQHHAHMIPKGLPGEGNILVFDNGGWGGYGEINPMSKIGQKN
    ALRDYSRILEINPVTLDIVWQYTPAEAGFPHPTDSFRFYSPYISSAQRLENGNTLIDEGADGRIFEVTPEHEIVWEFISP
    YWGKTTKNNMIYRAYRIPYDWIPQLEKPEEKSITAPDIRNFRLPNAAKTGAASIIKVEGLRPYEDSSDALCIIVDQENIK
    RSPKLFTIDREIFTENNTAEKKEAENRNEEKILVLFGAER
    CVHCKNLYLILVKIISKYKNKLKFEYIDVDKKTEFIEKYQ
    IRGIPTLIVFEKGKILAQSYGEKSEAELIEFFNDIENRFL

    >gi|269119251|ref|YP_003307428.1| NADH dehydrogenase (quinone) [Sebaldella termitidis ATCC 33386]
    MSRVTSIEELNTLKDSINKGRKYSKQVLICGGTGCISSGSNDIAAKMEERVKALGKEDEIRVIKTGCFGFCEKGPIVKML
    PDNTFYTEVTPEDVDKLVDKHLIGDEKVEELLYVDPVSKKRISDSDHMDFYKKQERVALRNCGLVDPEDIDDYFLHDGYT
    ALHKVTGMEQQAVIDIIKNSGLRGRGGAGFSTGMKWQFALNNKADQKYVVCNADEGDPGAFMDRSILEGDPHSIIEAMAI
    CGYAIGATKGLVYIRAEYPLAIKRLKIALEEAKESGVLGTNIFNSGFEFDIEIKYGAGAFVCGEETALIHSMEGHRGEPT
    TKPPFPAEHGYNGYPTNVNNVETLANIPVIINKGADWFKSFGTEKSSGTKVFALAGKINNVGLIEVPMGTTLREVIYEIG
    GGIKDGKKFKSVQTGGPSGGCLTEKHLDVAIDFDSLMEQGSMMGSGGMIVMDEDDCMVAVSKFYLEFTVEESCGKCTPCR
    IGNQRLLEILEKITKGNGTEDDLRKLKELSNVIKDTSL
    CGLGQTAPNPILSTLNNFWDEYEAHVKDHKCPSGQCTALLKY
    VINDKCIGCTACARVCPVSCIEGKVKEKHVIEQDKCIKCGACYDKCKFSAIDRI

    >gi|269119703|ref|YP_003307880.1| Redoxin domain protein [Sebaldella termitidis ATCC 33386]
    MLERKGIVTFKGNPVTLVGEEVKPGDKAPDFTALKTDLSELKLSDYKGRVVILTSFPSVDTSVCALQAKRFNEEAGKLKD
    DVSVITISVDLPFALGRFCAAEGIENEVTVSDHRDLDFGYKYGFVVKELRLLERGIVVIDKDGIIRHVEYCKEIAEHPDY
    DKALEITKSLI

    >gi|269119717|ref|YP_003307894.1| Rhodanese domain protein [Sebaldella termitidis ATCC 33386]
    MSKLISSDFLNENMDKYTILDCRFSLGDKEYGRNAYNTEHIENAVFIDFENELSSKIGEHGGRHPLPNVEKFISAMEKHG
    ISDSTEVVIYDDGDLAGAGRLWWLFKYIGKENVYVLDGGLPVWKKKGYKTSNKEYKAEVSGKLSADTQTNILCDVNYVKA
    KLNDPDTVLVDSRAAERYQGLTEPVDRIPGHIPGAVNFPYGEAIVDGVVMNREELNSRFKSLTNKNIVVY
    CGSGVTGCVN
    FLLLEEIGLKPVLYSGSYSDWVSYPENEVEK

    >gi|269119723|ref|YP_003307900.1| NADH dehydrogenase [Sebaldella termitidis ATCC 33386]
    MALLDENIVKQLKGFFDKITEDIKIISFLSESDKSKELDSFLNEVADISDSIKYESYMFGSNNKLEELYGIKRETAFTIV
    KNNEKTGINFFGIPGGHEFNSFVLAILNLAGLGKKLDTDKADEIKSINKPLDIEVFVSLS
    CTHCPDVVQALDSIALYNDN
    ITVSMIDSGIYPEEAKSKDIQAVPTVFINDKLASIGAKTFDELLEIAKNS

    >gi|269119724|ref|YP_003307901.1| peroxiredoxin [Sebaldella termitidis ATCC 33386]
    MSLIGKKLDDFKIEYYQNEEFKTLTLNDIMGKWSIFFFYPGDFTFVCPTELGDVADHYEEFQKAGFEIYSVSTDSHFVHK
    AWHDTSETIKKIKYPMLGDRNAIIAKMFEVYKEDEGAAYRGSFIVNPDGEIMAYEINEMGIGRDAKDLLRRAKAAKFITE
    NPGLVCPAHWEEGKETLKPGLDLVGKI

    >gi|269119730|ref|YP_003307907.1| methylated-DNA/protein-cysteine methyltransferase [Sebaldella termitidis ATCC 33386]
    MKLKFEEMYNALLNKDSSYEGSFFAGIKTTGIFCRPTCTARKPKKENVEFFHTSKEAVLHGYRPCKVCHPLEHLGFTPEY
    IKIILKKLEKNPDEKLKDSDLNELNIEPNKVRRWFKKNLDITFHEYQRMLKINSALHQISGGEKIIDSAFDSGYNSLSGF
    SHAFKNATGSTPSDSAEINIINIMRFTTLLGPMTACATEKGIYLLEFSDRKNLNDELEYLKKTLHAKIIFGQNQYLDMLK
    EQIAEYFSGTRKIFDLPLHTPGTDFQNLVWKKLIDIPYGEHRSYKDQALAINKPKAVRAVGKANGSNRIAIIIP
    CHRIIG
    ESGKLTGYAGGLWRKQWLLDFERKNSSL

    >gi|269119849|ref|YP_003308026.1| arsenate reductase-like protein [Sebaldella termitidis ATCC 33386]
    MKIYYYPSCSTCKKALKWLDNSELKYEKEHIVDANLTRKEIENIYKKSKLDIKKFFNTSGKVYKELDLKNKLLNMNESEK
    LELLASNGMLLKRPLLVEGNKVIVGFNEKEYEEKLK

    >gi|269119920|ref|YP_003308097.1| redox-active disulfide protein 2 [Sebaldella termitidis ATCC 33386]
    MKIKVLGSGCKNCQNLEKNVKEALKESGKEAEVEKVTDMKEILKFGVMKTPALVIDEKVVVSGRVATIKELIEIL

    >gi|269120199|ref|YP_003308376.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sebaldella termitidis ATCC 33386]
    MKAKDFTLQASNGKDVSLSDYKGKAVILYFYPKDSTPGCTTEACDFRDNSSVIKEGNAEILGISLDSINSHEKFIEKNDL
    PFLLLSDPDHKVCEMYGVWQLKKNYGKEYMGIVRSTFLIDKDQNIVKEWRNVRVKNHVEEVTEELKKL

    >gi|269120236|ref|YP_003308413.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sebaldella termitidis ATCC 33386]
    MKKYLLLLMIFICSFSFSAEPVDFKVKLVKGEVFPEFVLEKLSGTKELSTEVFDKNKKTLIVLAAEWCPACQWEMGQLAK
    FYESNKTKYNIAVIFIRENSSEAKVKEYVGYNNYTFPVYFDYSGKILQGTGVESIPTNIVLDKNRKISAVKSGIWEEGDF
    INNLK

    >gi|269120239|ref|YP_003308416.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sebaldella termitidis ATCC 33386]
    MELEYDLIIVGGGSAGLAAAKTAKENGISKILILEREKELGGILRQCIHNGFGIHKFKKELTGPEYAQEYINEINRLGIN
    YKIDATVISMEISPDEHSSKFVYVVSEEGYHVYETKAVILAMGCYERTRGGIAIPGDRPAGVFTAGQAQTFINMNGYMVG
    KEIVILGSGDIGLIMARRLTLEGALVKAVVELMPYSNGLNRNIVQCLEDFNIPLLLSHTVVRINGKNRVESVIIAKVDEN
    RNPIPGTEQEIICDTLLISAGLLPDNSLSKKLGIRIDSKTKGAVVNEKMETNIKGIFACGNVLHVHDLVDYVSTEAEIAA
    LSAAEYIKNQFKAENETIVHIEPGSGLIYAVPQNFNINTESKTLNISFRVNNVYKDKKISVKCQDKEIAGFKRSHLVPSE
    MEKISIPTDLIKSNLIISIEGDGL

    >gi|269120245|ref|YP_003308422.1| glutaredoxin [Sebaldella termitidis ATCC 33386]
    MKKILLMFLLLFTMSFSADKVNIEIFTRKDCKNCVRLEEFLTELSKDRNDFTVTKYDINEDKSAREFFDEVTKKGKLVKG
    TPVIYLNETIIQGFDSGDTTGKDITELIESGKVKDTIPGLKVFIENYDPDNINTSYTQNTCEGDEVCAITPVADKKSYVV
    TLPLLNKKVDVMKYSLPSMSFILGTIDGFNPCAMWVLILFLTALIAIGDKKKMFLVAGLFILAEAVMYYLILNIWIFTWD
    FIGLNRVITPLVGLIGIIGGILFIKSYIKNRNEIACEVGDFEKKAKISGKIQDLAHKPFTILTGLGIITLALSVNVIEFA
    CSIGIPQTYTKILEMNTVSFLSRQVYNLIYIIGYMIDDFVVFALALFSINKIASTGKYSKLMNLFGGILMVILGLMLIIK
    PEILVF

    >gi|269120273|ref|YP_003308450.1| selenide, water dikinase [Sebaldella termitidis ATCC 33386]
    MEIKLTEYARKCGCGAKLSSKKLSEVLEKLPKVHNENLIVGTETSDDAGVYKLNDQMAIIQTVDFFTPIVDDPYTFGVIA
    ATNALSDVYAMGGDPVTALNIVCFPNRIDLSVLGEILRGGIDKAKEAGAIIVGGHTIEDEEPKYGMAVTGIISPDKVLKN
    YGARVGEVLILTKPLGIGIISTAMKGGKASDHSKEAVIKSMTTLNKYSSEIVRKYNISACTDVTGFGLMGHSYEMASSSG
    VTIVLDKEKIPYIKEAEEYSKQGLVPGGMFNNMEYLKDKYEFIDIPEYLSNIVFDPQTSGGLLVSCSSEDAEKMLEELNK
    LEIKSHIIGTVAEKQEKSILFK

    >gi|269120384|ref|YP_003308561.1| thioredoxin [Sebaldella termitidis ATCC 33386]
    MSKVFHYNGEDFKGEVVSTKGITLVDFFATWCGPCQMLGPVLDDLSEEVDYKVVKVDVDQSRDLAAEYGVRSVPTMFIFK
    DGEVAEQMIGFLTKDEIKDKINSHL

    >gi|269120421|ref|YP_003308598.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sebaldella termitidis ATCC 33386]
    MKKFTVLLSVLILGVLLSVSAYSENTSASDTFSVDLQEGNTFPVFTLETLNGKKIPSSRVFDKNKKTIIVTAAEWCPDCH
    EELPVLEKFYRKNKNKYNFAVIFIERRSSEEKVKEYLSKEKFTFPVYFDYNSVFVEGTQVKFVPTNIFIDKNGKITSVVA
    ETISDENEFINRLK

    >gi|269120867|ref|YP_003309044.1| peptide methionine sulfoxide reductase [Sebaldella termitidis ATCC 33386]
    MKEIILAGGCFWGVEAYFQRLNGVIKTEVGYTDGVSENPTYKEVCSGTTNHAEACKIIYDENIITLKKILEHLFRIIDPT
    SLNRQGYDIGTQYRTGIYYKTAEDKEIAENFIKDEAGKYNKPIVVDIKKESRFWNAEEYHQNYLIKNPKGYCHVDLNLIK
    DEEIKPHLDLEKILASN

    >gi|269121162|ref|YP_003309339.1| Heavy metal transport/detoxification protein [Sebaldella termitidis ATCC 33386]
    MKKTFRLENLDCANCAAKIERSVQKVEGVNSVNVNFMTAKMNLELVDENSDSVIEEIKKTVKKIESAVIIKK

    >gi|269121168|ref|YP_003309345.1| redox-active disulfide protein 2 [Sebaldella termitidis ATCC 33386]
    MKIKVLGSGCKNCQNLEKNVKEALKESGKEAEVEKVTDMKEILKFGVMKTPALVIDEKVVISGRVATIKELKEII

    >gi|269121359|ref|YP_003309536.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sebaldella termitidis ATCC 33386]
    MKIIVVGCTHAGTAAILNAKRINPDADITVFERNDNISFLSCGIALYVGGVVKDPQGLFYCSPEKLKELNVNTKMKHDVV
    SIDIKGKKAVVKNLDTGLEFEETFDKLIITSGSWPIIPRIEGIDMDNILLSKNFNHSNEIIETAKNSKKVVVVGAGYIGV
    ELVEAFREEGKEVVLIDAEDRILSKYLDKDFTDVAEKTFREHGITVAVSEKVMKFEGENGTVKRVITDKNTYEADMVIMS
    VGFRPNTDIFKGQLDMLPNGAIKVDEYMRTSDKDVMAAGDCCSVYYNPTREYMYIPLATNAVRMGTLAAINLEGDKIKHP
    GTQGTSGIKIYENNMASTGITEEEAKKKGIDVDIVYAVDNYRPEFMPTYEKVTLKVVFEKESRRIIGAQLNSKADLTQSI
    NTISVCIQNNMTIDELAFIDFFFQPHFNKPWNFLNLAGLNALK

    >gi|269121366|ref|YP_003309543.1| hypothetical protein Sterm_2767 [Sebaldella termitidis ATCC 33386]
    MKKIIKFEKNDCNPCAMVSDLLDKSGVEYEKVNPFDSPELAVKYKIRSVPTVILFEHDQELRRTVGFKPEELKEIMDSL

    >gi|269121651|ref|YP_003309828.1| methylated-DNA/protein-cysteine methyltransferase [Sebaldella termitidis ATCC 33386]
    MNKYTGYIKVSAGIIKIICSEEYVLSVSFSDIIKENDKGSEVLDKALKQMNEYFSGERKKFDLPLYFEGTEFQKSVWNEL
    RKIPYGTTVSYKDIAEGINNEKAVRAVGNANNKNKIMIIVP
    CHRVIGKNGKLVGFAGGLDKKEFLLEHEKKFM

    >gi|269122150|ref|YP_003310327.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Sebaldella termitidis ATCC 33386]
    MAKIAVIGGGAAGMMFSTQYKKMNPGDEIFIFEKTPYVAWAGCPTPYYIAGELGFGSVVLGTPDEFRSRGLNVLVNHEVK
    KVDFEKKELEISGSDINGAFQYDKLILAFGGKSFVPNIKGYKDGLENVFTLSHAVHAEKIKKFLDTRNDIRKAVVVGGGF
    IGMEMAEAFKKRGLDVTILEKMGDILPTVSSSMKEPIIKEMAAKGVTLKLNSGVTEVKSEDGKATALVLENGEEVSFDIV
    LFSIGITPNIDFIENSCIETKNGKVIVNDKFETNTKDVYALGDAIYTRNILTNEYLYAPFGDVANKEGMILAKYLSGQDV
    SWRGALRSYASSFYEIRIAQTGLTLDEAKRHGYNADRLEMRAMTKNSDFEDSKPNKVEMIYDKDRKVLLGGTVTGHEAVA
    QFLDQIAIVINFEIPVEKFIEIDFAYSPTNSSVWNPLLVAYRKLIK

    >gi|269122265|ref|YP_003310442.1| heavy metal translocating P-type ATPase [Sebaldella termitidis ATCC 33386]
    MKTGLYDVKGMTCTACAGAIERGLGKLDGIKEANVNFATEKLKVEYDEAKYDFDKIKNEVKKIGYDLADDEKIKKVSVSI
    SGMT
    CSACSAAVERSVLKLEGIKKASVNFANGTGYFEYDPAAVNIGKIKEKITEAGYKPLDADMKEEEKEDLYNKEIRSL
    GIKFIVSLIFAVPLLYVAMGHMMGLHLPDFINPEINPGNFAIAQVILVIPILVAGNGFFVRGFRNLLKRSPNMDSLIAVG
    TSAAVLYGSFSVYQIFSGQVHYVMDLYFESAGVIITLILLGKFLEAKTKGKTSSAIKKLIGLQPKKAVIIKDGEPHEVLI
    EEINAGDIILVKPGEKIPVDGIVVKGHTSVDESMLTGESIPVGKKADDKVIGGSINKNGSIEFRATKVGTDTMLSQIIKL
    VEEAQGSKAPISRMADTISGYFVPIVMVIAVIAGLAWYISGSGLVFALTIFIAVLVIACPCALGLATPTAIMVGTGKGAE
    NGILIKSGEALETTHSIDTIIFDKTGTITQGKPVVTDVIADNEGIFLQYAASAEKGSEHPLAEAVMAYSKERNIELYNAE
    KFENIPGYGIKCEVNGKTVFLGNKKLMTENNMDISKFEKDFDRLSDEGKTVVFLAADGKTEGIAAIADVVKESSARAVKE
    LHEMGIKVVMLTGDNRKTAEYIAKQVGIDEVIAEVLPDEKSNAVKSYQKKGDFVAMVGDGINDSPALAQANVGIAIGSGT
    DVAIESADIVLIRSDILDVVNAIKLSKATIRNIKQNLFWAFAYNTLGIPFAAGVFYAFGGPKLDPMIAALAMSLSSVSVL
    LNALRLKFFKAENYKFRKKTKKYKGSENFMEKELKVKGMSCEHCVKRVKTAVESIDGVSSVSVDLNSGAVKYSAEKDVIK
    EVIEKIKEAGYEAE

    >gi|269122270|ref|YP_003310447.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sebaldella termitidis ATCC 33386]
    MKKLMMVILGVIFLMSCSGETSATFDLDATKGAKFPAFTAKSIDGKETFKSTDLLKSDKKTLFVIAAEWCPHCRDEAIEI
    QEFYEKHKDEANIVVIYSANNSSPEIVTEYLTKNKYTFPAYYDHDNVILYGSKIESFPFNAVIGKDGKIEEIVEGELSYD
    SLVEKLIK

    >gi|269122271|ref|YP_003310448.1| Redoxin domain protein [Sebaldella termitidis ATCC 33386]
    MKKFMIAAMTIFLIFSCGVKEEGAAVEKTTETKEVSAPEKETLKKEKVPESEKVTVDGIEVTIENKRIKVGDKLEDAELI
    APVNEFNKMKKVRLSDDKGIKLIYTAPSLDTPV
    CSLQTKMLDEKAKEHADVFFYSITDDLPFAMMRFCSDNGIANLKTLS
    DFQTHEFSAKNGFLMKEYQLLTRAVIIVDEDNIVRYVDYGKEVTDQLDLGKAIDFLEKKMLKK

    >gi|269122279|ref|YP_003310456.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sebaldella termitidis ATCC 33386]
    MDFNLNLGCIDEGNLSEISCDKLYDVLVVGTGPSAVSAAIYAARKGLDVAMIGLKIGGQVLDTREIENIIGTAKTTGSEY
    AENLEKHLKEYCVAFKEGTYVTKIEEDGKNKLITTSDKKIYKSKTVIIATGAKWRELNVPGEQEYKGKGVHY
    CATCDGPF
    YKGLDVAVVGGGNSGIEAALDMAGIAKNVTVVEFMPELKADKILQDKLNERNNIKVITNAATTKIYGEDFTKGMEYKNRA
    DESTHELNIDGVFIEIGLTPNSEFAKDLIATNKIGEIIIDENNMTNIKGIFASGDVTTVKQKQIVISVGEGAKAALGAFD
    YLLKEY

    >gi|269122357|ref|YP_003310534.1| dihydrolipoamide dehydrogenase [Sebaldella termitidis ATCC 33386]
    MSVEIIMPKAGMSMEEGTIIKWLKEEGEAIKEGEPIVEILTDKVNMEVEAESSGYLLKKVRFENEVLPVFTVIGYIGEKG
    ESVSEVKEAEKKEEVKTETKTSDEKEYDVIVIGGGPAGYISANKASQLGAKTALVEKRELGGT
    CLNRGCIPTKTYIKNIE
    ILEEAEKAESRGLDIKVTKNISDLTKAVEFKNKVTKKLSQGVGGLLRSYGVDVYSTAGKLGEGKKVTLEDGQVLKGKKII
    LAGGSKTRYLNIPGIDSDKILTSTTILDLNKVPERLVIVGGGVIGCEFAEIFRGYGTEVTIVEAMSNLLPFNDKEISQEL
    EKIFKKKGIKLLTDKQVTGFKDKGKEIETVLKSGESLSSDYVLFSIGREADLSCVDGLEIKQDRGRLIVNEYMETSIAGV
    YAAGDINGLSMLAHSAFKMGETAAGNALGGREEVRLDNTPKCVYTLPEIASVGLTEEEALKKYGKIRTGRFNFGANGRAI
    ASSEEEGFVKVICDDNYGEILGVHVIGSKATEMISAGVILMEMEITIEEASELIYAHPTFSEAILEACADCLGKALHLPK
    KK

    >gi|269122538|ref|YP_003310715.1| methionine-R-sulfoxide reductase [Sebaldella termitidis ATCC 33386]
    MDKKELKAKLTQLQYSVTQEGGTEPPFDNEYWDNKEPGLYVDIVSGEPLFSSADKFDSGTGWPSFSKPLDEKLLLFSDDY
    KLRLPRTEVRSKNSETHLGHVFPDGPAPAGLRY
    CLNSASLRFIPLKDLEKEGYSEYLSLFR