Bacillus cereus G9842 uid58759

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218895384|ref|YP_002443795.1| FrnE protein [Bacillus cereus G9842]
    MKIEVWSDFVCPFCYIGKRRLEMALEQFPHKKDVEVEFKSFELDPNTPVYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKNHGKEKEITENLLFAYFTESKNLSDVDTLATIAEASGLDKQEALNVINDKN
    AYANDVRIEEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPAPKLQELSVDGGSDLSCTDGSCSVPS
    KEQ

    >gi|218895452|ref|YP_002443863.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus G9842]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSSITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERARGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|218895453|ref|YP_002443864.1| peroxiredoxin [Bacillus cereus G9842]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKDLGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|218895504|ref|YP_002443915.1| hypothetical protein BCG9842_B4872 [Bacillus cereus G9842]
    MTTFKTIEEIATYIEEQQLVLLFIKTENCGVCDVMLRKVNCVLENYDYVEKIEILLQDMQEIAGRYAVFTGPTILLFYNG
    KEILRESRFISLENLERTIQLFEE

    >gi|218895591|ref|YP_002444002.1| bacterioferritin comigratory protein [Bacillus cereus G9842]
    MITVGEMAPEFTLEGSNGEEVSLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGVFQEKDTVILGVSPDSANRHLKFI
    EKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|218895599|ref|YP_002444010.1| hypothetical protein BCG9842_B4758 [Bacillus cereus G9842]
    MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLK
    EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQ
    FKKDLHSKEITEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK

    >gi|218895652|ref|YP_002444063.1| heavy metal-transporting ATPase [Bacillus cereus G9842]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMILETAQNKENEVVTEAKQLVTKLEPHIKVQEEQK
    NKIAKEVFILEGLD
    CANCAMKIENKVKEMPAVSEATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKN
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMVTIPLFVLAYLLIGGDIVWRAVKNITRGQVFDENFLMAIA
    TVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENIEFKQPETVGTLVHVAIDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKTVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVKIAKRTRSIVWQNIIFALGVKGIVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|218895698|ref|YP_002444109.1| hypothetical protein BCG9842_B4658 [Bacillus cereus G9842]
    MKLTIKHDDIKADLSYAQLAIGKENGYSPLQLLVSSIAGCSAIVFRKILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    QYKIKAENITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|218895789|ref|YP_002444200.1| hesA/moeB/thiF family protein [Bacillus cereus G9842]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGKITIVDRDYVDWSNLQRQQLYAESDVKNNLP
    KAIAAKKRLEEINSDVTIEALVQDVTAEELEELVTNVDVIIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNC
    PSCGENAIYPYLNKENTSKTAVLCGRNTVQIRPPHKEEMDFERYKKLLDDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTIYHRYFG

    >gi|218895807|ref|YP_002444218.1| thioredoxin [Bacillus cereus G9842]
    MKKMLIFGGIIIALFVAIFAVTQMEEKNATSQKIDNPTESKTNGSDYYTNKISLSDLQKNLKEKKEETVYFYQTSCVHCQ
    KLSPVVVPMAKDLNVDMKVMDIEKLDAPWDEYKIQGTPTIIHFKDGKEVSRISGEQPKDKLKEWLEQTKK

    >gi|218895822|ref|YP_002444233.1| rhodanese domain protein [Bacillus cereus G9842]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLTPGQVIEVKATDKGSTVDIKSWASKVGHQYIGTKHEGDVLVHYVRKANEH
    EVNEAVKYPHTITNAELQSILSHGEESIVLDVREAAEFTFGHIPSAISVPLGELDSAVLDQTKQIYVI
    CRTGNRSDVACQ
    MLKEKGFSNVKNVIPGMLGWQGNVEK

    >gi|218895823|ref|YP_002444234.1| metallo-beta-lactamase family protein [Bacillus cereus G9842]
    MDIKMLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQVSSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLQNIYYLAGGMKAWSEYVKPLKVGDVQGGGSIYQFNRLGKGCLSYMVVSNDEAAVIDAVRTAEAYEEFAKE
    HGVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGFVITVGGTKIVIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYTLYKELSQDLIVLPAHYSKISEMDERGVVSASLQDLFKENVG
    LNIADEIEFRKAVTENLPPQPNAYEEIRQTNMGKIHPSVEEEREMEIGPNRCAVHESL

    >gi|218895825|ref|YP_002444236.1| rhodanese-like domain protein [Bacillus cereus G9842]
    MNTILSTLFIVLATWFVISRFLPVKGVQNISGKELKNIVEKKGKQLIDVRTVGEYSGNHMKGFRNIPLNELASKANQLDK
    NAEVIVI
    CQSGMRSKQAAKVLKKLGFQHLINVSGGMNGL

    >gi|218895826|ref|YP_002444237.1| rhodanese domain protein [Bacillus cereus G9842]
    MVCEEEFKMKEMTAKELEEKLLRKEAVNIVDVREVEEVAEGKIPEACNIPLRILEFRMHELNKKKEYIIVCRSGARSARA
    VQFLEGYGFRAINMVGGMLAWEGKVI

    >gi|218896225|ref|YP_002444636.1| hypothetical protein BCG9842_B4100 [Bacillus cereus G9842]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|218896288|ref|YP_002444699.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus G9842]
    MNYVIIGGDAAGMSAAMQIVRNDENATVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFREKYGIDAKVRHEV
    TKVDTEKKMVYAEHTKTKEVFEFPYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHNIEILTNENVKAFKGNERVEQIETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRTNYKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPLGTTANKQGRLAGLNMLDKRRA
    FKGALGTGIIKFMDLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|218896502|ref|YP_002444913.1| resA protein [Bacillus cereus G9842]
    MKKNRLLFRVIILLILCGAVGFTLYQGFFANKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQT
    KEQLEEYLKKITP

    >gi|218896605|ref|YP_002445016.1| rhodanese-like domain protein [Bacillus cereus G9842]
    MIVTVEWLREHIEDENVRVIDCRFDLANPNWGREKYEEEHIPHALYFDLNLDLSSPIVEHGGRHPLPSIEEFADKLSEVG
    IDEHTTVIAYDSQAGANAARLWWLCNYVGHEKVYILDGGFPVWKENGLPTTTEIPVVIRKTFKTNIQDHMLVSMETVREN
    IQAGADVTLIDSREPKRYAGVEELVDHKAGHIPTAANYFWKDGMLQSGQFKNEAEQQGRFQNLSKDKETIVY
    CGSGVTAC
    PNIIALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|218896761|ref|YP_002445172.1| thioredoxin family protein [Bacillus cereus G9842]
    MKKLIAIILVGALVWAGVNFYNSKKEEKERKAKQAELQEKEVLPQVGFKAPGITLKGLDGKLQSLNDAKGKPYIINFWAS
    W
    CGPCEMEAPDLVHMYDKYKKDVEIFAVNATVSDPVQEASAFANRYGFEFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVDHVRGVLPPDQLEKKFKKLIEN

    >gi|218896817|ref|YP_002445228.1| peptide methionine sulfoxide reductase [Bacillus cereus G9842]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKTGTSGHLEVVQITFDPSIFPYQKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHNETQKGLAEKSKQALAESSMFKDPIVTEIRPAAPFYEADDYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|218896842|ref|YP_002445253.1| rhodanese-like domain protein [Bacillus cereus G9842]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EEEGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKETLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEENEAKYLRACSHKCRVSPRNRYVIQHELTEEQVAAALEKIEAGK

    >gi|218896889|ref|YP_002445300.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus G9842]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDLLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|218897030|ref|YP_002445441.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus G9842]
    MYQAYYESEVGLLEITANQEGITSVIFVDERQEENKNEMIEQCINELDEYFKGKRKEFTVPLSAEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|218897112|ref|YP_002445523.1| methyltransferase [Bacillus cereus G9842]
    MTTFNWHESAEKKWDSSAEFWNQNSQEMWDSGSRSTIIPFFEQYVKKEAQVLDVGCGDGYGTYKLSRAGYKAVGVDLSEV
    MIQKGKERGEGPNLSFIKGDLSALPFENEQFESIMAINSLEWTEEPLRALNEIKRVLKKDGYACIAILGPTAKPRENSYP
    RLYGKDVV
    CNTMMPWEFEQLAKEQGFEVVDGIGVYKRGVNEKMLGQLPTELQQSLTFLWVFMLKNV

    >gi|218897126|ref|YP_002445537.1| glutathione peroxidase [Bacillus cereus G9842]
    MTVYNFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|218897136|ref|YP_002445547.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus G9842]
    MQERYARQILFSGIGEIGQRKIREKHVLLIGAGALGAANAETLVRMGIGKLTIADRDYVEWSNLQRQQLYIEEDAQQCKP
    KAIAAAEHVRKINSEVKIVPVVTDVTMQEIEELTKEVDLIIDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDYESLRGTMLSFDIWNNQYLSLKVNRQKKSTCP
    SCGKSRTYPSLAFEAQMKTEVLCGRNTVQIRSGIKRDLNLNEIQKRLQKSVHVQKTPYLLSFLIDEYRFVLFTDGRAFIH
    GTNDVKIAKRLYAKYIG

    >gi|218897280|ref|YP_002445691.1| thioredoxin [Bacillus cereus G9842]
    MKEIKTEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|218897388|ref|YP_002445799.1| hypothetical protein BCG9842_B2921 [Bacillus cereus G9842]
    MNTFDIAIVGGGLAGLTASIYLAKAGRKVIVLEKSSQFGGRGMTINKNGICMNLGAHALYRGGAAFITFNELGMNLPGGI
    PSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFSRLMIRLGNLDVGEIPKMSLTTWAENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKEGVLYVDGGWETIITKLRAIANDAGVQFLAKKHVLEIEHYEDKQRIHCVDDEVFEV
    GTVIVTTPPKEACKIIKGAEGTSLHRWSEQSVPVTVAALDIGLRQLPNPTHQFVLGLDQPIFFTNQSRAAKLSEDGSIAV
    SLIKYHNPVLAMNHIHEDKEQLESTMELLHPNWKREVVAQQYLPKITVVHDFPHIDRVEKPGPNIPEMPGIYVAGDWAGH
    DEILADAAVASGKRAALHILKQYESEVVHHGNGAVI

    >gi|218897795|ref|YP_002446206.1| acetoin dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus G9842]
    MDKLVVIGGGPAGYVAAITAAQNGKDVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKANDYGVTINTENISIDWG
    QIQARKSQIVKQLVQGIQYLMKKNKIKVVKGKAKFETDHRVRVVQGNKEEVIDGGSFIIAAGSEPTELPFAPFDGKWILN
    SSHAMSLESVPSSLLIVGGGVIGCEFASIYSRLGTKVSIVEMAPQLLPGEDEDIANILREKLEKDGVEIFTGAVLKGLNN
    YKKQASFEYEGITHEVTPEFVLVSVGRKPRVQQLGLEKAGVQFSNKGIAVNEHMQTNVSHIYAVGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLSEKGAREQYGDILIGEFHFTANGKALILGEQTGKVKVIVEPKYQE
    IVGISIIGPHATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALLQAVGQAVHA

    >gi|218897854|ref|YP_002446265.1| carboxymuconolactone decarboxylase [Bacillus cereus G9842]
    MEHEQHSSINDILHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGALTKREKQLIALGISLATQDEYCTIYHTKGCLDQG
    CSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|218898466|ref|YP_002446877.1| hypothetical protein BCG9842_B1835 [Bacillus cereus G9842]
    MVILYTTASCASCRKAKAWLEEHQIDYIEKNIVSNSMTVDELKAILRLTEEGANEIISTRSKTFQDLNINIEELSLNEFY
    KLIIEYPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|218898560|ref|YP_002446971.1| hypothetical protein BCG9842_B1740 [Bacillus cereus G9842]
    MTKNNETGWNLDNSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGLTPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEATYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLKSLADYTIKRHYPEIEAHENRYTALLQEVIKRQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYNQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYENHWFLGMKKKLGLFSTEEQDQPLIEQLLKMMEKYKADYTNTFRSLTLDAIENTALFESPEYKDWY
    KLWQSRLKRQEQSKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNDDYSVMEKLLEALSNPYAYSTDQEEYCIPPAPTNR
    PYRTF
    CGT

    >gi|218898568|ref|YP_002446979.1| hydroxyacylglutathione hydrolase [Bacillus cereus G9842]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPGRYIEQYIDFAKKEGMEVIAAAETHIHADFLSGSRELSTLYHTNLYVSD
    EGDCDWKYQYLNEGRYNLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGMKDTAKIGAKQLFDSIQKIKTLPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNEESDFVSTLL
    TGQPEPPRYFSLMKNLNKYGPPIRKKREVTTINTIEKLQEAMRNVQQIVDIRDVESFASGHIEKSINIPYNNSFTTWCGW
    LLDYKTETLIILDEEKVRVEEVIRDFESIGLDNSIAFAPLQVIKRLDRFESYKEKTSIELYPHIKDGSVKVIDVRSKKEW
    EEGHLYDAIHIPLGNLFKQLDCIPKDCPIVLQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWKKERLPYTTSNLNV

    >gi|218898658|ref|YP_002447069.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus G9842]
    MADRYSRQQLFKPIGSKGQEKIRNKHVLIVGAGALGSASAESFVRAGVGKLTIIDRDYVEWSNLQRQQLYSEQDAREKMP
    KAIAAKNRLEQINSEVQIHAFVMDATSENMEGLLKNVDVIIDATDNFDIRFVINDLSQKHNIPWVYGSCVGSYGMSYTII
    PQETPCLHCMLKNIPVTGVT
    CDTAGIISPTVQIVAAYQLAEALKILVEDFSAIRKTFFMFDIWSNQNHFIKLGEIKTDAC
    LSCGLNRTYPYLSYENQTKAAVLCGRNTVQIRTVDNRKYNFDDIEKVLQKLGKVDRNPYLLSCQFDDYRVVVFRDGRVFI
    HGTNDISKAKQLYYRVFG

    >gi|218898704|ref|YP_002447115.1| ahpC/TSA family protein [Bacillus cereus G9842]
    MWRKLTIIVVLLCLAGYAAYEQFGKKDQAVQGEQEKSEAAMKEMIASNGIEIGKSAPNFELTKLDETNVKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAINYTPSEKGGGVEKVSNFVKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRVAKLK

    >gi|218898828|ref|YP_002447239.1| copper-translocating P-type ATPase [Bacillus cereus G9842]
    MNEKKEANLQISGMTCAACANRIEKGLKKVEGVHEANVNFALEKTKIMYDPTKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLDGVNKATVNFALESATVDFNPDEVNVNEMKSVITKLGYKLEVKPDDQDASTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLTLATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEIKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDGVIGSTINKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMLFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFREEEILRLVGAAERNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLLIGTRRLMKEFNIDIEEVSKSMEALEREGKTAMLIAIDKEYAGIVAVADTVKDTSKAAIAR
    LKKMGLDVVMITGDNTQTAQAIAKQVGIDHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNALGIPIAALGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLKS

    >gi|218898829|ref|YP_002447240.1| copper-ion-binding protein [Bacillus cereus G9842]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSAVTLKDIVAVIEDQGYDVQ

    >gi|218898842|ref|YP_002447253.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus G9842]
    MNSYKNNYIYWTLLTHKNWRFHIAATENGLCFIGSQDENFEELNIWARKKLPQHILIHSPDYLQIYTKEIIEYLESKRET
    FTFPIDAYGTNFQSSVWNAVREIPYGKTYSYTEIAERIQKPKAVRAVASAIAANPLLITIP
    CHRVIGKNGKLTGFRGGLE
    MKKKLLTLEKLQVEFI

    >gi|218899125|ref|YP_002447536.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Bacillus cereus G9842]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVNIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|218899144|ref|YP_002447555.1| glutaredoxin family protein [Bacillus cereus G9842]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVAYEEFDVKKDAAARNRLLNDYDSYSTPTVVIDGEVVAGFQIEKLQKLLNIE

    >gi|218899327|ref|YP_002447738.1| 3-methyl-2-oxobutanoate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus G9842]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLVATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIAAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGRALHA

    >gi|218899375|ref|YP_002447786.1| rhodanese-like domain protein [Bacillus cereus G9842]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLIKTLTEEEFRAGYRKAQLIDIRETDEYNAGHILGARNIPLSQIRLRHKELR
    QDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKSWTGKIKKK

    >gi|218899636|ref|YP_002448047.1| organic hydroperoxide resistance protein [Bacillus cereus G9842]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRMKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAKELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|218899676|ref|YP_002448087.1| thioredoxin [Bacillus cereus G9842]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|218899794|ref|YP_002448205.1| thiol peroxidase [Bacillus cereus G9842]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVGEGTSHPNYEAALE
    AAKSAK

    >gi|218899851|ref|YP_002448262.1| thioredoxin family protein [Bacillus cereus G9842]
    MKSLESMEQFQQLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|218899865|ref|YP_002448276.1| hypothetical protein TIGR00275 [Bacillus cereus G9842]
    MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSLFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLLTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|218899881|ref|YP_002448292.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus G9842]
    MQERYSRQILFSGVREEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAIAAAEHLQAINSEVEINPVVTDVTVQEMEELVRDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIL
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFGALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRKNFNLEEIKKRLQRSVEIKATPYLLSFPVEEYRFVLFTDGRAFIH
    GTNDMNVAKSLYARYIG

    >gi|218899886|ref|YP_002448297.1| rhodanese-like domain protein [Bacillus cereus G9842]
    MTEVKTITTEEVQVRLENGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPHKVDFFNKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|218899925|ref|YP_002448336.1| hypothetical protein BCG9842_B0355 [Bacillus cereus G9842]
    MYVTVTEAAYKKIMDTIPSEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSTMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|218900086|ref|YP_002448497.1| hesB/yadR/yfhF family protein [Bacillus cereus G9842]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCTGLSYGLGFEVEPKEDDTVLEFFGVEFVIDTESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|218900089|ref|YP_002448500.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus G9842]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTITNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPIIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGLLWMYKYHKG

    >gi|218900144|ref|YP_002448555.1| putative thioredoxin [Bacillus cereus G9842]
    MIDWTGAEATSLIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEELKIGMLDLNYAPHLAKEYGIESVPCLLVFENGT
    LMKKIYAFHSVEYLYTELK

    >gi|218900148|ref|YP_002448559.1| hypothetical protein BCG9842_B0104 [Bacillus cereus G9842]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ

    >gi|218900262|ref|YP_002448673.1| glutaredoxin family protein [Bacillus cereus G9842]
    MKVVLYTKKNCGLCVQAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|218900278|ref|YP_002448689.1| thioredoxin-disulfide reductase [Bacillus cereus G9842]
    MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKEKELIVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKIPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|218900566|ref|YP_002448977.1| peptide methionine sulfoxide reductase [Bacillus cereus G9842]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIQVVSGYTGGHKEDPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDIGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELEQSGRFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLILFGNK
    K

    >gi|218847949|ref|YP_002454753.1| hypothetical protein BCG9842_0087 [Bacillus cereus G9842]
    MNKRWKIISLIVTIMILSISFFMINSQSDVKAKQKNAPDDIISIKELDEKKYENDTYVYFFKPDCKFCKQANDDIYKAAK
    DTNVNLNRVDLSKKENERLWDDHLIGGTPTIIHFNRGEEVERIQGAMPYETYKKFFKYRID