Acidiphilium cryptum JF 5 uid58447

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148243758|ref|YP_001219998.1| E1-E2 ATPase-associated domain-containing protein [Acidiphilium cryptum JF-5]
    MAAAISVKLKIEGMDCGGCAVKIENAMKRLPGVTDVSVSFSTASLSLMLDEDRTARTMIEARIRALGFTPLGGTRQADAD
    KVRTESASGNVWWKTRKVRLVGVTGLLLALGFVVTQAEPAWSPWPYVAAALVGLLPIVRRALAGMRTGTPFTMETLMSIA
    SIGALAIGEGADAAIVVFLFALGELLEGVAAGRARAGIEGLIGLVPRTARRVRGDAIETVPVETLAIGDVVTVRAGDRVP
    SDGTVVGGTSQVNEAPVTGESAPVVKAEGAPVYAGSIAGHGELRIEITRTSADNTIARIIHMVEEAQATKAPTARFIDRF
    SRWYTPAAMAFSALVMLGPPVDFH

    >gi|148243762|ref|YP_001220002.1| regulatory protein, ArsR [Acidiphilium cryptum JF-5]
    MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLAERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYS
    LVSETEVVTLLGSLGRVGERNIAEIDQVLQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPADEFARGHLPGALNIPL
    DQLDAALGHFTENIPVVAY
    CRGPYCVLSYEAVAQLRARGVQASRLEDGYPEWKGAGLPIET

    >gi|148243774|ref|YP_001220014.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLAERIGLSVSNTSRHLQILRRARLAAPRREGKNMFYS
    LVSETEVVTLLGSLGRVGERNIAAIDQVMQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPPEEFAQGHLPGALNVTL
    DHLDAMLDSLASRSPIVAY
    CRGPYCVLSFEAVARLRTRGIEAMRLEEGYPEWKAAGFPVKI

    >gi|148243974|ref|YP_001220213.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLAERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYS
    LVSETEVVTLLGSLGRVGERNIAEIDQVLQAYFRARDCLEPVSRLALLERLRDGSVTLLDVRPADEFARGHLPGALNIPL
    DQLDAALGGFTENVQVVAY
    CRGPYCVLSYDAVAQLRARGVRAIRLEDGYPEWKAAGLPVET

    >gi|148259171|ref|YP_001233298.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidiphilium cryptum JF-5]
    MSVAEGDQAPDFTLPATGGRTVSRAGYKGRPFILYFYPKADTPGCTKEACAFQEALPALGGIGIDVIGVSKDKMPALEKF
    AAKYNLAFPLASDESGAVVEAFGAWVEKSMYGRKYMGIDRSTFLVGADGRIAKAWRGVKVPGHAKAVMDAAAALQKA

    >gi|148259213|ref|YP_001233340.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Acidiphilium cryptum JF-5]
    MSTTTVGRAGRRGTARALGFAALALALVALVVALQRQGLGIARLEGDLAGLRGMVAAHPLAGFLLYFGLYVAATSLSVPG
    AAVLTLGAGALFGVAEGAVLVSFASSIGASLAFLAARFLLRDFALARFPALFERIERGIARDGAFYLVSLRLAPVVPFFA
    VNLLAGLTSLRLRSFYLASQIGMLPATLIYVNAGASLATLGGHGPILTQRLVIGLLLLAALPLAAPRLRDALATRRLYAR
    FRRPKRFDRNLVVIGAGAGGLVAAYVASAVKAKVTLVEAGEMGGD
    CLNSGCVPSKALLHAARAGKDFRAAIADVRAAIAG
    IAPHDSVARYEGLGVEVRRGRAVIESPWCVAVDGVPITTRAIVIAAGAEPFVPPIPGLAEAPHATSETLWDIEDLPRRLV
    ILGGGPIGCEMAQAFARLGSAVTLVEMSERLLVREDDEVSAAMAAALARDGVAIRTGHRAEAVTRTEAGFALVAASGVQT
    IELPFDRLLVAIGRRPRVSGYGLEALGIPLTPARTIETDDGLRTLYPNIFACGDVAGPYQFTHMAGYQGGYAALGALFAP
    FWRFRPSYRAVPAVTYTSPEIARVGLNAREAAARGIEAEITRYDFAELDRAIAEGDTEGFVTVLTRKGSDRILGATIVGP
    QAGELLTGFTLAMQHGLGLKKLMGTIFPYPTRSEAIRAVAGQWRQAHASARGLAILERFHRWRRG

    >gi|148259365|ref|YP_001233492.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MNMQTRTAALATARPAAAIMASLSAAALGIAVLGLAATAPARAAPASSAPPLVDAAWLRAHLHDRGQVILEVYDTATQRP
    AYEAGHIPGAVFTGFLNDGWRVPRDGIPGMLPPPEQIAGVIGHFGIGNATRVIIVPAGRARGDFNAAARVFWTLRMEGAD
    NASILNGGDRAWFADPADPVARGNVPLRPAVFVPHPTTEYLATMPMVRATLDSHAAQLVDARPPAQFEGRVRAPVDARAG
    TLPGARNLPFSAVLTADGEGVRPMPELAQALHRAGVERGAPSITF
    CNTGHFASTDWFVLREVLANPRVRLYDGSMSEWSR
    NPALPMVPGHSAF

    >gi|148259417|ref|YP_001233544.1| protein-disulfide isomerase-like protein [Acidiphilium cryptum JF-5]
    MDRRSLLGMVGGLATAGSLGIAFPAAAAETKTDSPYSIRSLGNPNAPVTVYEYFSLNCPHCAEFATHALPKVIESYVKPG
    KVYYVFKDFPLNEDALWAAQIARALPAKAYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAGMDRTTFDAAIAN
    KKLRAFVLNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKAA

    >gi|148259423|ref|YP_001233550.1| peptide methionine sulfoxide reductase [Acidiphilium cryptum JF-5]
    MTLVDQIRAIMSAMKTRMPTAGEALPGRATPMPIPEFHYVSGARLAEPYPPGSEVAIFGLGCFWGAERKFWQAPGVLVTA
    VGYAGGFTPNPTYEEVCSGRTGHAEVVLVVFDPRAISYQNLLKLFWENHDPTQGMRQGGDIGTQYRSAIYALSDEQLRLA
    ELSRDAYQNVLSEAGFGRITTEILPAPTFFFAEAYHQQYLAKNPDGYCGLGGTGVTCPAGVMPAD

    >gi|148259515|ref|YP_001233642.1| protein of unknown function DUF395, YeeE/YedE [Acidiphilium cryptum JF-5]
    MSQIAATGPRPPRALLAAASVLIVGLLAMTMPATGGRLPALVLIGAAMGMTLAHGSYGFAYGWRALVLRRDGSGAMANLL
    MLAAATVLFAPILARGAVFGHGVAGAIAPAGVPVAVGSFLFGVGMQMSGACASGCLYASGGGNLRTLLALLFFCAGAFIA
    TFELPWWLSLPSLGAVSFGGMIGWGPGATLQIVAFGGLALILRRFAPPASPMMRAWLPKGSAWFRGPWPLPFAALMLAGL
    NWLTLLIAGHPWSIVWGFTLWGAKGASLLGWVPPAHGFWSWPFPHAALSHGILADETSVMNISIVLGALLASAIGGRFSL
    TTKFEPLPLLSAALGGLAMGYGARLAFG
    CNIGSLFSGIASTSLHGWEWLVFALLGTPVGIALRRRFGLPD

    >gi|148259516|ref|YP_001233643.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MKLSVIPAFGLAAAVLGGTAFAAKPVPPLVSADWVAAHACKPGVVMLDVRNPIGGGNVQTYMHGHVPCAVYSNYSQNGLW
    RKDVDGAPGMVPPVAELETLIGGLGIGNRTRVVIYTAGTSATDMASAARVFWTFKYLGDNNISILNGGYAGYVGRGSTPA
    HPVQAGFVKPVETRFVAHVRPRLLATEAEVERAMKAHVPLVDDRPSAQYLGVNLAPVDTRPGTIPGARNLPESWLTVNDG
    GVFRTPADLAGLYKAAGVPMAGRQINF
    CNTAHWAALGWFASYELLGNKQAKLYTGSMSQWSRNAALPVERQVR

    >gi|148259758|ref|YP_001233885.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidiphilium cryptum JF-5]
    MRFGLSRRQFAALGAGLVLPDLTSLAGIGKSAEAMELPDVAPNLDVTVPQPLPDFHFLDAFGRRLTLAHFRGEGLVVNFW
    ATW
    CPPCRAELPTLVALNPRIRGDGIRVLPISVDSQGIKAVRPYYAKHHITGVPILLDPSSSALDAFDVNGIPFTVIVDR
    KGQMVASLQGAGDWNTPATIAQLRKLIGPKPAAASGTTAT

    >gi|148259830|ref|YP_001233957.1| OsmC family protein [Acidiphilium cryptum JF-5]
    MKTLYHGRGHATGGRTGHAETSDGRLKVDLSTPKELGGDGGQGTNPEQLFAIGYSACFLGALKFVANQAKVKIPEDAKVN
    AEIGIGPRDDGTGFGITAHLTVTIPGMDRAQAEDLVRKAEIV
    CPYAHATRGNIDSRFAVA

    >gi|148259977|ref|YP_001234104.1| DSBA oxidoreductase [Acidiphilium cryptum JF-5]
    MVLPRLPRITVEVVFDFVCPWCYLGVHRLQQLRASRPDLPIAPQWRPFLLNPDMPRPGISRADYTARKFGDEERARRFHA
    AVAAIAAEDGLDLAFPRISRAPSTVDAHRLIRFAHDHGPVEDLVLAIFRAYFTEGRDIGDAATLAALAAAHGLPRDRVAA
    FLAGDRATDQIHADNLFVHRLGINGVPCFIIDGQTAIAGAQEPGILERLVELAASDVALS

    >gi|148260371|ref|YP_001234498.1| methylated-DNA--protein-cysteine methyltransferase [Acidiphilium cryptum JF-5]
    MAPEPLFLDRIDCPIGTMLVITDAAGALRALDWPDHEARMRRLLRRHYGAEGTGFTLAARPAPAALREALLAYFAGRADA
    LGGIAVRTGGTAFQRAVWAALRGIPAGETLSYGALAARIGRPRAVRAVGLANGANPVAIVVP
    CHRVTGADGSLTGYAGGL
    ERKRWLLAHEAAMQPRGWANAGTPG

    >gi|148260392|ref|YP_001234519.1| thioredoxin domain-containing protein [Acidiphilium cryptum JF-5]
    MADATHLVCPHCGAVNRIPPARPAQAAQCGACHRKLFDGHPVEVDQAGFERHAERDGIPLLLDVWAPWCGPCRMMAPQFE
    QAATILEPEVRLLKLNADEAPEISARLGVRGIPALFLLRGGRVIGQSAGAMSAQAIVDFARRHLAAAA

    >gi|148260394|ref|YP_001234521.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MTTPSKLRDLDPATVHDDLRAGRILLVDVREPQEFAVERIHGAMLFPLSTFDPAMLPQDPGKPIVFQCGSGKRSAMAAAK
    CREAGIAVNAHLAGGMMAWKAAGMPYVSLDSATGQVVDRR

    >gi|148260452|ref|YP_001234579.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidiphilium cryptum JF-5]
    MAETITTDVAIIGAGPAGLFAVFECGMLKLGTVLIDALGEVGGQCAALYPEKPIYDIPALPAIEAAGLIENLERQIAPFA
    APRLLGRLVTAISGSSGDFTIGTDLGDIVRAKAIIIAAGAGAFGPNRPPLEGLAAYEASGAVQYYVKRREALRGKRVVIA
    GGGDSAVDWALALCGIASSIAVVHRRPKFRAAPESAAQLAEAAARGDIDLVIPYQLHALHGADGALRTVEVADLDGATRH
    LEADVLLPFFGLATDLGPVATWGLELSLHHVLVTPSTCETSTRGIFAIGDVAQYPGKLKLILQGFSEAAMAAHAIHPIVH
    PDEALHFEYSTSKGVPGTA

    >gi|148260456|ref|YP_001234583.1| thioredoxin [Acidiphilium cryptum JF-5]
    MGAATKAVSDAEFSTSVLDSKEPVLVDFWAEWCGPCKIIGPSLEELGSEYAGRVTIAKVNIDENPMTPTQYGVRGIPTLI
    LFKDGKPAAQHVGAAPKSVLKAWLDKNI

    >gi|148260496|ref|YP_001234623.1| glutaredoxin 3 [Acidiphilium cryptum JF-5]
    MPTVEIYTQAFCPYCSRAVRLMREKGVPFTEIDAPRGSAARREAIERSGGSTTVPQIFIDGQSIGGCDELLELERTGRLD
    PLLAA

    >gi|148260619|ref|YP_001234746.1| dihydrolipoamide dehydrogenase [Acidiphilium cryptum JF-5]
    MADQFDVIVIGAGPGGYVCAIRAAQLGMKVACVEKRATLGGTCLNVGCIPSKALLQSSENYHELLHGFARHGVSAENVSF
    DLGKMMGHKDEVVGANTKGVEFLFKKNKVTWLKGAASFKSANTIVVDGKEYGARHIVIATGSESVPLPGVEVDETQIVTS
    TGAIALESVPKHLVVIGGGYIGLELGSVWRRLGAEVTVVEFLDRLVPTMDGEVATAFQKTLGKLGMKFKLGTKVTGAAKT
    AKGVTLTLEPAKGGAAETLEADVVLVAIGRRAHTEGLGLDAVGVATDERGRVKTNGHYATSVPGIYAIGDVIAGPMLAHK
    AEEEGVALAELLAGQAGHVNYGAIPGVVYTWPEVASVGKTEEELKAEGVAYKVGKFPFTANGRARAMGDTDGFVKLLSDK
    TTDKLLGAHIIGPDAGTIIAELVLAIEFGASAEDVARTSHAHPSLNEAVKEAALAVDGRALHI

    >gi|148260637|ref|YP_001234764.1| OsmC family protein [Acidiphilium cryptum JF-5]
    MDAAELRALQAPLKQKYREDAAAARIVSRAVGEIVQGGIACVVRGHDGEVTAGLHEAAGGDGSQACSGDMLLEALVACAG
    VTLSAVATAMGVIVKRGSITAEGVWDARGTLAIDRAAPVGVTDISLRFDLDTDADEATVARLIQSTERYCVILQTLRNPP
    RIEAIRG

    >gi|148260898|ref|YP_001235025.1| redoxin domain-containing protein [Acidiphilium cryptum JF-5]
    MIKVGDRLPAMKLMTPGAEGPQEIDTGELFAGKTVVLFAVPGAFTPTCSAKHVPGFLEHYDALKAKGVDEIACIAVNDVF
    VMTAWAESQKAGGKVTFLADGSGAFTRALGLELDLIARGLGVRSQRYALVAQDGLVTHLAIEQPGGFEVSRAEAVLEALG
    G

    >gi|148260974|ref|YP_001235101.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Acidiphilium cryptum JF-5]
    MNHDFDLFVIGGGSAGVRLARIAAGHGARVGIAEDRHWGGTCVNIGCVPKKLMVMAAEYGLGAADARGFGWDMRAVAHDW
    PGFIAAKDREIGRLNGAYTGLLERAGATIFNARARFLGPHTLMVGEQHVTADRIAIATGGQPLRPAIPGADLAIVSDDAF
    HLPARPEHVVMVGGGYIAVEFAGIFAGLGSKVDIVYRQPLPLRGFDPDLRAGLAEALAANGIGVHHGVEPVRIEAAGARR
    RLHLSNGHMIEADCVFFATGRAPNVAGLGLDKAGVTAGPGGAIPIDEDYRTNVPHIFALGDVTDRLNLTPVATAEGHALA
    DTLFGNRPRRISLANVASAVFSIPPLATVGVTEDAAPDGAKVFVARFTPMRHTLSGRARKTMMKLIVDAETDQVIGAHML
    GEDAAEIMQGLAVAITAGATKADFDRTIGIHPTAAEEFVTLRTETRRVNRGGESAKPRAAE

    >gi|148261118|ref|YP_001235245.1| thioredoxin domain-containing protein [Acidiphilium cryptum JF-5]
    MDHFTDSDARRPTGADAAIIEGSQTTFMADVVEASRKVPVLVDFWATWCGPCKTLTPTLEKVVRAYGGRIRLVKIDIDEN
    RALVQQLSSLGLPLQSVPTVAAFWQGQIADLFQGALPESEVRRFVDALLKLAGSSAPSADLIAQARKAMEDDQPEQAAAL
    FSAALDEDQNRPEAWAGLVRALVALGADERAEAILAEVPQSLAEHAEIQAAKTAVSVAREGRMAARQLAELQARLAADPN
    DHDTRFALAAALNATGDRTGAAEALLDIMRRQRNWKDDAARLQLLKFFDAWGVDDADTMAARRKLSALLFS

    >gi|148261162|ref|YP_001235289.1| UBA/THIF-type NAD/FAD binding protein [Acidiphilium cryptum JF-5]
    MDLDFTETEIARYSRHILLREVGGTGQARLRAASVLIVGAGGLGSPAALYLAAAGVGRISIVDDDVLELSNLQRQIAHGV
    AFLGAPKVESAAAAMRGLNPEVSVNPVRARLDAGNVGALVAAHDIVLDGTDNFATRFLVADACVAARRTLVSAAVLRFEG
    QLSTFKPHAGPDCPCYRCLYPEAPPAGMVPT
    CSEAGVLGPVTGVMGTLQATEAMKEILGIGTSLAGRLLLWDALDARFRT
    ITIPRVPDCAACAGV

    >gi|148261250|ref|YP_001235377.1| rhodanese domain-containing protein [Acidiphilium cryptum JF-5]
    MSSPLISTEALAATLDDPALVVFDASFYLPNERQDALSLFDEAHLPGAAFFDIERIADTTSHLPHMLPDEGGFASAVEAL
    GVGNDSRIVVYDQRGLFSAARGWWMFRVFGHENVFVLDGGLPKWRAEGRPLEQGKANLRPLGRFIARFDPSRVRDRAAIE
    ANVACRAETVLDARAAGRYAATVPEPRAGMRGGHVPGARSLPYSELLGADATMLPPDALRARFAAAGIDDTSRPVTM
    CGS
    GVTAAVLTLGLARAGLPMGALYDGSWAEWGALPDTPVATGEDPA

    >gi|148261253|ref|YP_001235380.1| iron-sulfur cluster assembly accessory protein [Acidiphilium cryptum JF-5]
    MTTIRTESAPPRRSLPPLMQLTDAAADRLRALYENGQQGRLLRISVGTKGCSGLSYEMNWVDEPAPTDEQVSDKGVTVLI
    DRKATLFLIGTVMDYKVEKFTSGFTFENPNEKGRCGCGESFHV

    >gi|148261387|ref|YP_001235514.1| methyltransferase type 11 [Acidiphilium cryptum JF-5]
    MREASKSIMRRLTDSRFATRYFVGEGIDIGSGPDPISFYAELFPLMREVRSWDLADGDAQYLEGVPDASFDFVHSSHCLE
    HMRDPLVALRNWLRVLKPGGHMVVLVPDEDLYEQGVFPSTFNADHK
    CTFTLYKKTTWSPRSVNVLALIAQLDGVMPLKVE
    LLDSTFLYRMERMDQTMLPASECAIEVVLRKATAAEAARGGRLPEPRN

    >gi|148261395|ref|YP_001235522.1| hypothetical protein Acry_2409 [Acidiphilium cryptum JF-5]
    MSLRAVIAADEDVMGEIRRLRRNIIHVVQLSYQSREEPSRSGAGLLSTGAETLQKVRSSMSSTLDRNTLADATSPYLLQH
    ADNPVHWQMWSDATLAAARAANRLILLSIGYAA
    CHWCHVMAHESFEDPATAALMNRLYVNIKVDREERPDIDGIYMTAVQ
    AMGEQGGWPLTVIMTPDGAPIFGGTYFPPEPRWGRPSFRQVLEMVADAWKKDGEKFARSGASLLRRIAAHAELKPGAPIA
    PGDLAAVTERFLGMMDWEEGGLRGAPKFPNAPIFRFLWGEYARTGRHEAGAVVALMLARMAQGGICDHLGGGFARYATDE
    SWLVPHFEKMLYDNAQLLDLLALAHAAEPDLLLAARAAELVEWLRRDMRARHDPAPDGTLAFAASEDADSEGEEGKFYVW
    TRDEIASVLGADMALFEDHYPCPAAGNWEGKLILTRATHPEHPETEARLAALRARLFAAREGRVRPGWDDKILADWNGLA
    IAALARASAVFARPDWLDLAITAHGAVTALLGREDGRFDHAIRRGRISASGLLDDQAAMLRATLALYQATGRAAYLDQAE
    LIAAATLAAFGDGQGGLHLTAADAADLPGGIRPRASFDNATPSGAGLFAEGLAILHHLTGSAAHRDAAAALIGAHTGERR
    ALSAFPTLLGAAALLEEGASVVIVGDAADPRFAALHRAALAHFDPAVVVLPVSDAAALPDGHPAHGKSAAEPAAFVCRAQ
    VCSLPVSDPALLRGQISQRAGVA

    >gi|148261426|ref|YP_001235553.1| thioredoxin reductase [Acidiphilium cryptum JF-5]
    MRCDERWNSRHRALNSASEVHEMADQATIETKLLIIGAGPAGYTAGIYAARANLAPVIVAGLQPGGQLTITTDVENYPGF
    ADVIQGPWLMEQMRAQAEHVGTRIEYDIITEIDLSARPFTARGDSGALYRADAVVIATGAQARWLGLPSERQYQGAGVSA
    CATCDGFFYRGREVAVVGGGNTAVEEALYLTNHATKVTLIHRRDALRAEKILQDRLFAHPKIEVIWDHTVEEIIGAGTPA
    VVTGARLRDVKTGAERTIAVEGVFVAIGHDPATALFRGKLDMDEEGYIRTVPGTAQTSVPGVFAAGDVQDRVYRQAVTAA
    GTGCMAALEAEKFLAHHAQIEQQAA

    >gi|148261450|ref|YP_001235577.1| heavy metal translocating P-type ATPase [Acidiphilium cryptum JF-5]
    MDQISGAATRQDSAADTVIDLSVGGMTCASCVARVERAARKVPGVAAASVNLANERARISGHGFDAAAVIAAIGKAGYEA
    RAVADAPEAAAGEEARRAAEGQRELRHVIVAAALTVPLVGAMALHMAGSRFMLPGWAELLLATPVQFWLGARFYRAGWAA
    ARAFSGNMDLLVALGTSAAYGLSAVLLAEAWVTGRGAPPLYFDSAATVTTLILFGKWLEARARRQTGAALKALEALRPTT
    ALVRGADGAEREVPIGQVRTGDLVVVRPGGRIPVDGTIEAGESAVDLSMLTGESLPVPKAAGGRVPGGAINGEGVLLVRT
    EAVGAETTLAKIIRLVETAQAEKAPIQRLVDRVAAVFVPAVVAVAAVTLAGWLLAGATVSAAILNAVAVLVIACPCALGL
    ATPTAVMAGTGVAARHGILVKDAEALEAAERVDTVVFDKTGTLTEGKPSVVAVAPAEGVSEAELLAVMAGVQAGSEHPLA
    RAVCARAAADGVAARPASGVTALPGRGVSGTVGGIGILIGSSRLLEEQGAAPGALAERATALEEEGRSVSWVIGEGRVLG
    LVAFGDAPKRGAREAVAALRAQGRRVVLLTGDNAGSAAAAARAVGIDEVIAGQLPEGKAATVAALRREGRVVAMVGDGVN
    DAPSLAAADIGMAMASGSDVAMHTAGITLMRGDPALVAAALDVARATMRKIRQGLFWAFAYNVIGIPLAAIGFLSPMVAG
    AAMAASSVSVVTNALLLRRWTPPVE

    >gi|148261461|ref|YP_001235588.1| methylated-DNA--protein-cysteine methyltransferase [Acidiphilium cryptum JF-5]
    MPSLSMQHPVFGGFVLHERAGAIVSIDFGGDGGAADEATPLLRRAADALARYFDGGPLAEDLALAPAGTEYQRRVWAYLR
    TIPRGETRTYGEVARDVGGSARAVGGANRANPIPILIP
    CHRVRAADGLGGYCGSSEEGWGLAMKRRLLALEGAAFSDGAR
    RRA

    >gi|148261650|ref|YP_001235777.1| glutaredoxin-like protein [Acidiphilium cryptum JF-5]
    MSQATENPAFASIKTAVEENPVMLFMKGTAMFPQCGFSARVVQILTHMGVPFKTANVLEDPELRDGIKQFSNWPTIPQLY
    VKGEFVGGCDIVTEMFQSGELQTLFDQNGIARTGA

    >gi|148261794|ref|YP_001235921.1| arsenate reductase [Acidiphilium cryptum JF-5]
    MTVTIYHNPACGTSRNVLGLIRNAGLEPVVIEYLKTPPSREELRGLIARMGVPVRAVLREKGTPYAELGLDDETLTDNAL
    LDAMMAHPILINRPIVVTERAVRLCRPSETVLDILPTPQQGAFTKEDGQQVVDDAGRRLP

    >gi|148261805|ref|YP_001235932.1| dihydrolipoamide dehydrogenase [Acidiphilium cryptum JF-5]
    MTDQSFDVVVVGGGPGGYVTAIRGAQLKLKVALVERENLGGICLNWGCIPTKALLRSSEINHLLHTLPEYGFSAENVKFD
    LDKVVKRSRGVAKQLSSGVAHLLKKNKVTVFDGTGRLAGKGTLAVEKDGKPVATLKAKHIILATGARARVLPGIEPDGRF
    IWSYREAMVPDIMPKSLVVIGSGAIGIEFASFYRNMGAEVTVVEALPRILPVEDEEISAFMHKQFEKQGMKLLVGASVKG
    VEKGRDSVTVTIEAGGKAQKITAERVISAVGIVGNVENLGLEQAGVKVERTHVVVDGFGRTGVEGVYAIGDLTGPPWLAH
    KASHEGVVCIEHIAGLKPHPFETWNIPGCTYCRPQVASVGMTEAKAKEAGRKVKIGRFPFIGNGKAIAMGEPEGMIKTVF
    DAETGELLGAHMAGAEVTEMIQGYVVARQLETTEAELMHTVFPHPTISEAMHESVLDAYGQVIHF

    >gi|148261837|ref|YP_001235964.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidiphilium cryptum JF-5]
    MSVSRRMLFGLPLLVVGAGGVGFYELLRRMRTGSYNPQAFDNPLVGHDVPDFTLPGVNGRKGFDKPVLAAQKRPVLVNFF
    ASW
    CVPCAGEAPYLDRLAKAGVDIWGIAYQDKPEAIALYLAKYGNPYARLATDPSGRTAINWGVYGVPESFLIAPGGKVV
    WHIAAPLVPEIIDDQLRPAMQRLT

    >gi|148261846|ref|YP_001235973.1| cytochrome c biogenesis protein, transmembrane region [Acidiphilium cryptum JF-5]
    MKRLLPALAAFLLALAATGPARAARSNEVTSPRAQVSLVSAANAPKAGTITLGLLFHLKPDWHIYWSDPGDAGQAPTVSI
    VAPAGAKAGPFAFPPPHWLVAGGGVGDYIESGTVLLPFTVTLPQSGVTAIDAKAEWLVCNPKLCVPEHGRFHLALAGGAS
    AEAGLFRAARAALPRPSPYRATIAPDGTLAITGAGLGRSVVKSAHFYPDDPAAIVNAAPQRLGFVRDGFTLRLKPAHPPM
    TAAAGVIEITDPSGRMQALTLHAAPGAAPPPLAGTPLIVWLGAALLAGLILNLMPCVFPVLAIKALALARLGHDDRPLAR
    REALAYAAGTVAAMLLLGGGLLALRAGGAALGWGFQFQSPVFIAVMAWLVFAIGLNFAGLFEISGLENLGAGLARHGGVL
    GSFATGLLAVAVATPCTAPFMGGALAAALAAPVTLGLSIFASLGLGIGLPFVALAAVPAVGRILPRPGPWMVILRQILAF
    PMFGTAVWLLWVMSVEAGSSGVLIVGAGALLIGFALWLLRFPGILLRGLAVLAVIGAVLLLPRVVPADATGPAALPGALP
    RSAVPYSPSKLAALRKDGHAVFVDMTAAW
    CITCQVNERVALAPRAMQRLFAARHVTLMVGDWTRRDPAITRFLAAHGRDG
    VPIYVYYPPGHAAPVVLPQVLTPSIVRATIAGARS

    >gi|148261930|ref|YP_001236057.1| peroxidase [Acidiphilium cryptum JF-5]
    MALQLGQIAPDFEQDSSEGRLKFHEYLGSSWGILFSHPKDFTPVCTTELAEAARLMPEWKKRNVKPVGLSVDTGENHKGW
    AADIEETQGQTLNFPVIADHDRKVSTLYDMIHPAADPTVTVRSVFIIDPQKKIRLIMTYPPATGRNFAEILRVIDALQLT
    DGYKVATPVNWTDGKDVIIVPSLSDEEAKQRFPEGFRTLKPYLRMVKQPKLPSAS

    >gi|148261979|ref|YP_001236106.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidiphilium cryptum JF-5]
    MGLDEQLQAERDRRTADEAVRLAYEEVFTTLSTNGFLPSVLPEEATFPDFVLPDTEGRLVSLASRLARGPVLVQFFRGEW
    CPFCRLMLDALVGALPEIEAAGASLMALTPDIGPWAREAKRNHGAMFDVLSDVDCGVGLAAGVVFRIPPIYRARLMRAGI
    DFADRHDNGAEFLPIPAVFLLDADGRVAWRFVNVDFTRRAAPERILSALRRLTAPERE

    >gi|148261981|ref|YP_001236108.1| uncharacterized peroxidase-related enzyme [Acidiphilium cryptum JF-5]
    MNDKRHDAISRFPVPDLGALPADIREKILAVQEKAGFVPNVFLALAHRPDEFRAFFAYHDALMLRPAGLSKAEREMIVVA
    TSGANHCLY
    CVVAHGAILRIYAKDPEIADRLAVNPGKARLTPRQRAMIDYAMKVATASDTVGPDDHAALYEQGFDADEIW
    DIGAIAAFFAMSNRLANMAGMQPNPEFFAMGRLPKA

    >gi|148262014|ref|YP_001236141.1| alkylhydroperoxidase [Acidiphilium cryptum JF-5]
    MIEDWSALIGAVNGGVADLRKAAPEAMAGFSALAKAACAGDALDRKTKELIALAIGVATRCQPCIAYHARDAARAGATRA
    EIAETLGMAVYMGAGPSAMYAAEALEAFDQLSGPPR