Sanguibacter keddieii DSM 10542 uid40845

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269793682|ref|YP_003313137.1| thioredoxin reductase [Sanguibacter keddieii DSM 10542]
    MTEDTHADLRADLHADVVVVGGGTAGLAAAVALARSRRSVVVVDAGEPRNAPADGAHNVLGQEGISPLELLARGRAEAEG
    YGVRVVRGLVTGASGVVDDFRLEVDGADEGDGAVQRVTARRVILAAGLVDQLPDVPGVAEGWGHSVLH
    CPFCHGWEVRDQ
    RIAVLGTTENALHQVMLFRQLSDDVTFFVHDAPEPTEEQWDQLAALGVRVVTPRVERLVVDGRQVQAVEVEGGRSFPMDA
    VVVAPRFVARTELYEALGGERTVTPFGEHVAPDPRGATAVPGVWVAGNTGDLMAMVVAAAASGVMAGAAVHGDLAVADLA
    KAVAERRAPFSAAMESEVHEAVLADRRHGV

    >gi|269793725|ref|YP_003313180.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Sanguibacter keddieii DSM 10542]
    MTAPLKVDIWSDIACPWCYVGKRRFEEALVAFDASGAARPVEIEYHSFELAPDTPVDFDGSEVDFLAGHKGMPREQVVQM
    LGQMTEVAASVGLDYDFDALQHTKTLKAHELLHHAKAHGLQGELKERLLRAYFVEGRHLGRIDDLVELAAEVGLDADAAR
    AVLESGELAPAVAQDIAQAQAYGIQGVPFFVVDGKYGVSGAQEPAVFVQVLEKAASDADEPADQATSTRG

    >gi|269793835|ref|YP_003313290.1| predicted peroxiredoxin [Sanguibacter keddieii DSM 10542]
    MSEQTGAPSRRLVVKSTAGASSPELTNQAFTVAASALAAGVEVSVWLTGDSAWFGVPGRAGDLVLEHAAPLEDLLASLVD
    GGTVTV
    CTQCAARRGITPDDLLPGVRIAGAPVFVEEIMAPQTQALVY

    >gi|269793929|ref|YP_003313384.1| dihydrolipoamide dehydrogenase [Sanguibacter keddieii DSM 10542]
    MTATEPGTDRDLDADLDADAHYDLIVLGAGSGNSLPGPELDGWSVAIVEEGRFGGTCLNVGCIPSKMFVYTADVARATEH
    AGRLGLDAAVHGVDWPGIVSRVFDQRIDPFAAGGEAYRRGPQTPNIDVYDQHAVFVGERTLRTGQGTHQKIISADQVVVA
    AGSRPVVPQVIADSGVHFHTNEDIMRLPTLPRSLVILGGGYIAMELGHVFEALGTAVTIVARSSLLRTLDADLHEPFNRM
    AAERFTVLAGRGVVGADQDADGVTLRLDDGSAVTAEALLVATGRTPNADLLDLAAAGIATTDDGRVDVDPNGRSTSAPGV
    WALGDVSSPFMLKHVANAEMRAVRHNLLHPEDLRRMPHENVPSAVFTDPQVATVGMTEQQARDAGHDVATSLQRYGDVAY
    GWAMEDTTGLVKLVADRTTGRLLGAHYMGPQASTLIQQMITVMAFDLDVREVADRQYWIHPALPEVTENALLGLDLT

    >gi|269793960|ref|YP_003313415.1| predicted redox protein, regulator of disulfide bond formation [Sanguibacter keddieii DSM 10542]
    MDTLYSAEALATGDGRNGHVATPDGRLDMGLAIPKEMGGSGDGANPEQLFAAGYSACFHSALQSAAREAKVKITGSSVGA
    RVNIGPLDNGGFGLSVALEVVIPEVPHDEAQALADRAHQI
    CPYSNATRGNIEVTVSVVED

    >gi|269794049|ref|YP_003313504.1| Glutaredoxin-like domain (DUF836) [Sanguibacter keddieii DSM 10542]
    MNAQRRVVVFTRQDCHLCDDALEVVARVCEDLGAPWTTVDVDTSAALRAEYGEHVPVVEVDGVQQAFWRVDEARLRRALT
    TAPR

    >gi|269794055|ref|YP_003313510.1| thiol-disulfide isomerase-like thioredoxin [Sanguibacter keddieii DSM 10542]
    MLSGCASDSGNTNPDDVQGQGYQSGDGSLRTWSLDERGDVVDLVGVDFEGNDVSSDPGDGEVVVLNTWYAACPPCRAEAP
    DLLTVATDRADDGVRFIGINGVDDAGAALAFEREHDITWPSIADTDGSVVASLQKVVPVRAVPTTVVLDRQGRVAARVLG
    QVDATTLDGLIEDALAEPAGA

    >gi|269794148|ref|YP_003313603.1| methionine-S-sulfoxide reductase [Sanguibacter keddieii DSM 10542]
    MFGSLFGSSLKTTMVTPERALSGRPEPTYSVPSTHTVLGTPLAGPWPEGTRVIYLGLGCFWGAEKEFWQLPGVVTTAVGY
    QGGFTQNPSYEEVCTAMTGHTEAVLVAYDPSVVTDTEILRMFWESHDPTQGFRQGNDVGTQYRSAVYWTTPEQEVAAKTT
    FDVFQKNLAARGFGQITTDLRSAEAAGPFYYAEGYHQQYLDKNPSGYCPVHSTGVACQPADA

    >gi|269794292|ref|YP_003313747.1| O-6-methylguanine DNA methyltransferase [Sanguibacter keddieii DSM 10542]
    MRTYRVIESPVGPLTAVSTDGVLSGLYMADAAHLPATFGEPWTQPTGQPGVDQPGVDQPGADQRGADQLEAELAEYFAGE
    RTVFTVPTAAVGTPFQLRVWEQLAEIPYGTTRSYLDLALALGDARLVRAVGAANGRNPLSIVVP
    CHRVVGSDGTLTGYAG
    GVARKELLLALEDPRRRADTLF

    >gi|269794294|ref|YP_003313749.1| O-6-methylguanine DNA methyltransferase [Sanguibacter keddieii DSM 10542]
    MHDADTQGRSIQPGPLHDDLGDTVDRDGDLADRDRDRDLADLDPTAGATVEGRLRARLAQAAADDGVLDVAYRTVDTPVG
    EMLVAATEVGVLRLAFAVEGFDQVLDTLARKVSPRVLRAPARLDPVVRELEEYLAGRRTRFDLPLDLALTSGFRREVVRH
    LPDIPYGQTASYAAVAALAGSPRAVRAVGTACATNPLPLVVP
    CHRVVRSDGALGQYVGGADAKGWLLDLEAAR

    >gi|269794346|ref|YP_003313801.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Sanguibacter keddieii DSM 10542]
    MSITVYSKPACVQCDATYRALDKKGIDYTIVDISADPEALEMVRGLGYLQAPVVVAGDEHWSGFRPDQINALAAKVSASV
    A

    >gi|269794733|ref|YP_003314188.1| Peroxiredoxin [Sanguibacter keddieii DSM 10542]
    MTTTGAVSAARPTAPSVGDAAPDLELKDTHGTPVRLSSLRGTPVLVVFYPFAFSGICTGELCELRDNIAELETAGVRLLA
    VSCDPMYSLKAWSEQEGFGFDLLSDFWPHGEAARAYGVFDEERGRAVRGSFLVDAEGIVRWAVVNEAGQRRDLSGYLEAV
    AAL

    >gi|269794779|ref|YP_003314234.1| thioredoxin-disulfide reductase [Sanguibacter keddieii DSM 10542]
    MSMTSPTHELIIVGSGPAGYTAAVYAARAGLAPLVLAGSVTAGGALMNTTEVENFPGFVEGIMGPELMENMQKQAERFGA
    RIEWDDATSLDLDGPIKVVTTGSGEVFSARAVILATGSAYRELGLEDETRLSGRGVSW
    CATCDGFFFRDQEIVVVGGGDS
    AVEEATFLTRFASKVTMVHRRDSLRASKIMAERAASDPKIEFAWNSEVVAIHGADKVEGVRLRDTLTGEERDVAAGGLFV
    AIGHDPRTELVKGQVTLDDEGYIEVQGRSTRTNLEGVFACGDAVDHTYRQAITAAGSGCAAALDAQHYLADLVGAQDSPT
    ELVEAVDALEAH

    >gi|269794861|ref|YP_003314316.1| dihydrolipoamide dehydrogenase [Sanguibacter keddieii DSM 10542]
    MAETPGTDFDIVVLGGGSGGYATALRAAQLGQKVALVEADKLGGTCLHYGCVPTKALLHAAELADNARDGEHFGVQTEFK
    GIDMEGVNKYKDGVISGLYKGLQGLIKSRKITVIEGYGKLVGKDTVEVDGTRYTGRHVVIATGSYSRSLPGLEIGGRVLT
    SEQALKLDTVPKSVIVLGGGVIGSEFASVWRSFGVEVTIIEGLPHLVPAEDEALSKAFERAFRKRGIAFNLGDRFKTVEQ
    DDSGVHVTLESGKTFDAEIMLVAVGRGPRTADLGYEEQGITLDRGFVITDEKLHTGVGNIWAVGDIVPGLQLAHRGFAQG
    IFVAEQILGLNPAPIVESGIPRVTYSDPEIASVGLTEAKAKESLGADNVETLEYNLAGNGKSKILDTQGFIKLVRQKDGP
    VVGVHMIGARVGELIGEGQLIVNWEAYPEDVASLVHAHPTQNEALGEAFLALAGKPLHAHN

    >gi|269794874|ref|YP_003314329.1| Iron-sulfur cluster assembly accessory protein [Sanguibacter keddieii DSM 10542]
    MSETTETATHGVLLSDVAAQKVRTLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERVLDGDALKDYDGVEVVVDKMSVP
    YLEGATIDFADTIEKQGFTIDNPNAGEGCACGGSFS

    >gi|269795017|ref|YP_003314472.1| cytochrome c biogenesis protein [Sanguibacter keddieii DSM 10542]
    METLILIGLIGGLITGISPCILPMLPVIFFAGGIQGARPGSGEGTDGSSAAAGEGSSSAAPSASLFAGAPGAVRIDGRGN
    VAVADRPKAGTGGDSVSLSGGKNGKGGKSTAGDKPVKEVSARRKSLRPYLVISGLVVSFSFFTLLGSLILNALGLPQDLL
    RWVGLSLLAIIGVGMIVPRLEEIIERPFQRIAAMGARRGSARQDRGAFLLGLGLGVLYVPCAGPVLAAITVAGATGNIGA
    DTVALTVSFAVGAAIPLLIFALAGRRVAERVGAFKRHTKGIRIFGGVTMILLAIGLAFNLPQYLQRALPDYTGSLQSQIN
    ESDTVQEALDLGGLVTDENRLLSNCTNGASELESCGPAPQLSGINNWFNTPGDEALNLSDLKQEGKVVLVDFWAYS
    CINC
    QRAIPHVNAWYDQYKDVGKGFEVIGVHTPEFAFERETRNVVAGAEQLGVTYPVAQDNAYSTWTKYRNRYWPAQYLIDSDG
    TVRHIRFGEGGYENTEKLVRELLEQANPGVELPAETTVDDGTPQDATTPETYFSSTKVVNYSGEQDYKSGDFTVNPDQPK
    DTFSLGGSWTLDPQGATAAADGAAVQLAYSGTNVFTVLGGEGTVKATVKDADGKVVETKDIKVTGNPNLYPVLEGDAATT
    GTVELELPQDVQVFTFTFG

    >gi|269795172|ref|YP_003314627.1| hypothetical protein Sked_18680 [Sanguibacter keddieii DSM 10542]
    MDPFVSSVPGRAVLLLVLLGLVSIAWWVRTRRSGTVRAPRASAPPPPDQPLLAVLSTRGVALGDRATFVQLSSEVCTPCR
    RTAAVLSDIAAVEPGVTHVELDAAEHMELARHLRVLRTPTVLLLDPAGHESGRSSGAMSPAQARAALTALSTASDRSARP
    HAPTTDQPTDETRRS

    >gi|269795748|ref|YP_003315203.1| hypothetical protein Sked_24570 [Sanguibacter keddieii DSM 10542]
    MTTEQTTQTADFWFDPLCPWAWMTSRWIGEVEKVRDITVRWHVMSLSVLNEGRDLPEKYSELMAKGWGPVRVVTAARIEH
    GEQYVKPLYDAIGTRLHPGGRDDFDAVILESLAEVGLPETLAAAATSDRYDTELRASHKEGIDRVGEDVGTPVVAFGDVA
    FFGPVVTPAPKGEDAGRLWDGCVLVAGTPGFFELKRTRTQGPVFD

    >gi|269795779|ref|YP_003315234.1| Peroxiredoxin [Sanguibacter keddieii DSM 10542]
    MTTRLAPTDLAPEFSLPTAGGGTISSGELRGSRVVVYFYPAASTPGCTTQACDFRDSLASLTGAGFTVVGISPDPVAKLD
    TFVANEHLTFPLASDEDKAVATAFGAYGEKKLYGKVVTGIIRSTFVIDAEGRIELAQYNVRATGHVAKLRRDLGIDAA

    >gi|269795781|ref|YP_003315236.1| thioredoxin [Sanguibacter keddieii DSM 10542]
    MATQELTQDTFEQTIKDNDIVLVDFWASWCGPCRQFAPVFEASSETNTEIVHGKIDTEAQQSLAAAANITSIPTLMAFRE
    GVLVFSQPGALPAPALAQVVDAVKALDMDEVRSQIAAQGAGGGTAL

    >gi|269796038|ref|YP_003315493.1| Glutaredoxin-like protein [Sanguibacter keddieii DSM 10542]
    MSETTATSPTLPPAGEVVMYTTSWCGYCRRLKTQMDSAGIGYTEINIEEVPGTAEYVEQVNGGNQTVPTLVFPDGSAATN
    PSLADVKARLAA

    >gi|269796110|ref|YP_003315565.1| rhodanese-related sulfurtransferase [Sanguibacter keddieii DSM 10542]
    MSTRPALPSLVTSPQLHEALRDRPEEVRVLDATTFLPTTVEGAPYTASAGRDGYLAEHVPGAVFADVAGALSDPEAEQLF
    TVPSAEAFARAAHDLGVGPATHVVVYDTVGSAWATRVWWLFRLFGHDAVSVLDGGLGAWKAEGLPVASGTTDVDGLAGVS
    TPAFVAELRPHLLATKAEVVGTLPGATSDQGAGSSRGTVVVNALDPATFVGSPDLSPYARRGRIPGSVNLPLYTLLDPST
    GRFLPVEDLFSLLQAQGVLDADRAVTY
    CGGGIAATLPAFAAYLVAGAEVAVYDGSLSEWTADRSLPVEVG

    >gi|269796170|ref|YP_003315625.1| hypothetical protein Sked_28890 [Sanguibacter keddieii DSM 10542]
    MSAAPTVQVISRDGCQPCVATHRRLAKLQVDYTSVDASDETAIAQARELGHLELPVVIVSDETGVIDSWAGFSPDRLSAL
    AASHTPKKEHRMSENNTPEATAATRTITVDGMQIELIGRESILDRGEAGLRAGWEADKAARQADEPEEDEDAEEAYEALV
    ELVAEVAVGYTVERAAIASGQEQVSVTDPEARESITTTVKISDETGKPFSPEALRASLPTQLREIQGLADWIEHVFEDDD
    TDYSDPSPHGFDDQYTADREFYYGQDDILARHNALEARLAQISAE

    >gi|269796202|ref|YP_003315657.1| rhodanese-related sulfurtransferase [Sanguibacter keddieii DSM 10542]
    MSDHAVDLDERRARVLVGPAGLQGLLDSGKPLTVLDVRWALGRTDGRAQYESGHVPGAVFVDLETELAGPASPAVGRHPL
    PTLGSLQDSARSWGVRRGVPVVVYDDVSGTSAARAWWLLRWAGVDDVRILDGGLSAWVARGGELESGDVVVPESDITLSS
    GRMPVVDADAALQTASDGVLLDARAGERFRGETEPVDPQAGHVPGAVSLPTVGNLDGSGRMLPAEALLERFVSAGVVPEA
    PRPGTDGPRQVAVY
    CGSGVTASHQVAALASLGIDAALYPGSWSQWSNDPERPVAVGA

    >gi|269796218|ref|YP_003315673.1| predicted sulfurtransferase [Sanguibacter keddieii DSM 10542]
    MAVHKIVLFYAFTPVPDPLALQLWQTALAERWDLTGRVIVSQHGINATLGGTVEDLKQYVKTTRRYPGFADMDVKWSDGT
    GADFPRLSVKVRPELVSFGAPDELEVGPDGIVGGGTHLSPQEVDDLVAARGDEVVFFDGRNAFEAEIGRFKGAVVPDVRT
    TRDFVAELDSGRYDDLKGRPVVTY
    CTGGVRCEVLSALMTARGFGEVYQIDGGIVRYGETFGTSSLWEGSLYVFDERMHVD
    FDPQTVPLGSCVLCSAATASYENCASPACTTLRVVCAGCAEEARAQVCPVCAASGAVPEPVSA

    >gi|269796516|ref|YP_003315971.1| predicted redox protein, regulator of disulfide bond formation [Sanguibacter keddieii DSM 10542]
    MPTRTARTAWNGTLEQGSGQVELSSSKVGTYDVSFPKRAADEAGGTTSPEELIAAAHSSCYAMQLSALIGEAGGTPDALD
    VSADVTLAPDPAGGFQITGIKLTVRGEVSGIDEAAFLKATEDAKAT
    CPVSKALTGTTITLDASLEK

    >gi|269796641|ref|YP_003316096.1| methionine-R-sulfoxide reductase [Sanguibacter keddieii DSM 10542]
    MTKTDEQWRDELSPEEYQVLRQAGTERPGTGELLHENREGVFRCRACSAELFRSDTKFDAHCGWPSFFAPQDSDAVELIE
    DRTLGMVRTEVRCARCGSHLGHVFDDAPQTPTGERF
    CMNSISLTFEDGKTA

    >gi|269796769|ref|YP_003316224.1| Rhodanese-related sulfurtransferase [Sanguibacter keddieii DSM 10542]
    MSYAGDLTPQQAWDLLESTPDAVLVDVRTVGEWQQVGVPDIADLDGDREVVFAEWATAFGPNPTFVEQLTEAGLAPGDGR
    PVIFL
    CRSGNRSIGAAVDATAAGLGPSYNVLEGFEGDTDLYGQRTVNGWRLRGLPSTTYTAGE

    >gi|269796827|ref|YP_003316282.1| thiol-disulfide isomerase-like thioredoxin [Sanguibacter keddieii DSM 10542]
    MTANTQPSARLPRVRASELVGRGWLNTGGVDVTLADLRGKIVVLDFWTFCCVNCLHVLDELRELEEAHRDEVVIVGVHSP
    KFVHEADPVALAAAVDRYEVRHPVLDDPDLVTWSAYTARAWPTLVVVDPEGYVVAHMAGEGHASTLEILVRELVEEHSAK
    GTLHRGSGPYVPAEPTPGTLRFPAAVIALESGNLLVADAGHHSLAELAADGETLVRRIGSGERGLSDGGRQDATFSEPNG
    LCLVPATLRDQLGYDVLVADTVNHALRGVRLSDGHVTTVAGTGDQLMVGGAENVVPETTAPDATPALRHRLTSPWDVVWS
    ERLGAFLVAMAGNHSLWTFDPVAGVVEQVGGTQNEGLLDGPLAQAWFAQPSGLSVGPDGSVWLADAETSALRRVDVADDG
    SATITSLVGQGLFDFGHRDGAAAQALLQHPLGVAALPDGSVVVTDTYNGALRRYDPATDEVTTLVGGLAEPSDALVQVDG
    DEVHVLVVESTAHRITRVALPATLAGEVLDSGAHRTQRPVTDVPPGELRLDVVFTPATGQKYDDRFGPSTQLTVSSTPPE
    LLLEGAGRDLPLVRTLRINPEVAEGVLHVTAQAASCDADPAVEFPACHLAQQDWGVPVRVVAGQPDVLTLPLRG

    >gi|269796881|ref|YP_003316336.1| copper/silver-translocating P-type ATPase [Sanguibacter keddieii DSM 10542]
    MTDPTSEHPQSPLAPRSGLAVAELDLAVSGMTCASCVARVEKRLNRIEGVEATVNLPLESAHVVLSQDVDESALVEAVAK
    AGYDARVTGRRQLGSGTNAAGGTTGPAEHTSESHHPGGHDHQHDDPEMALSGHSMAEGHVMVDGEDTSAPTPDRGSDLRR
    RLVVSGVLTVPVVLLSMIPALQVDGWQWVVTALALPVVTWGAWPFHRAAVRAARHGASTMDTLVSTGVVAATAWSLWALL
    FGGAGEIGMRMSPALFPAAEHAAMSGPELYFEVAAVVTTFLLAGRYAEHRSRRRAGDALRSLLALGAKDVAVLTSDDAGR
    RVEQRVPVDALRVDDLFVVRPGEKVATDGVVVEGSSAIDASLLTGEPVPVDVTPGDPVTGATVSTSGNLVVRATRVGEET
    TLAQIGRLVSAAQTGKAPVQRLADRISAVFVPVVFVIAVATFAAWTVWGDSAQSAFTAAVAVLIIACPCALGLATPTALL
    VGTGRGAQLGVLIKGPEILESTRRVDTVVLDKTGTVTQGRMVVEGVVGDERTLRLAGAVEALSEHPIAQAIAAAAQTQAQ
    SQSHDADVAVVADVAVGGDGVVVGSDQVLDFVSAAGGGVSGVVRTAHSGVSLATRVLVGRLSWLAEQGVTVDGEEQQPLR
    DAVHEAEQTGATAVVAAWDGAARGVVVLRDPVKETSAQAVAELTALGLRPILLTGDNPGAARVAAEQVGIAADDVIAQVV
    PSEKAEVVARLRAEGRVVAMVGDGVNDAAALAGADLGLAMGTGTDVAIEASDITLVRGDLRSAATAIRLSRTTLRIIKQN
    LFWAFAYNVAAIPLAALGLLNPMIAGAAMAASSVIVVGNSLRLRRAG

    >gi|269797013|ref|YP_003316468.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Sanguibacter keddieii DSM 10542]
    MSTSTDHSSDSSSAAETTYDVIVVGAGAVGENAADRAGRTGLSVAVVEAELVGGECSYWACMPSKALLRPGAVLEAARAV
    PGAAEMITGTLDPAKVLARRDSFTSGWDDSSQVDWLDGAGIALVRGRARLTGPKTLDVTADDGTVTHLTARHAVVVATGS
    VPVVPPVPGLAEANPWGSREATSVKEVPASLAIMGGGVVGVEMATAFADLGTKVTLVVRGERLLASNEPFAGEAVADSLR
    DLGVDVHLSTDVTSVEVHDDGTHLVTSSGGSTQTLVAERLLVATGRKPATDDIGLDVVGLTAGDPLTVDDAMLVEGVEGG
    WLFAVGDVTGRVATTHQGKYDARVAGDVVAARFGGSSEGELDAPDWSRFRATADHAAVPQVVFSRPEVASVGLTEQGAKD
    AGYQVDVFSYDLGSVAGAAVAADGFTGKAQIVVDTDRGVIVGATFVGPEVAELLHAATIAVVGEVPLDRLWHAVPSYPTV
    SEVWLRLLEAAGL

    >gi|269797056|ref|YP_003316511.1| thioredoxin-disulfide reductase [Sanguibacter keddieii DSM 10542]
    MTAQTTPTHELIIVGSGPAGYTAAVYAARAGLAPLVLAGSITAGGALMNTTEVENFPGFVDGIMGPELMENMQKQAERFG
    AQIEWDDAVSLELDGPLKVVTTGNGDVFSARAVILATGSAYRELGLDDEKRLSGRGVSW
    CATCDGFFFRDQEIVVVGGGD
    SAVEEATFLTRFASKVTMVHRRDALRASKIMAERAEADPKIEFAWNSEVVGIHGADKVEGVRLRDTLTGEERDVAAGGLF
    VAIGHDPRTELVKEQVTLDAEGYIEVQGRSTRTNLEGVFACGDAVDHTYRQAITAAGSGCAAALDAQHYLADLVGAQDSP
    TELVEAVEALEAR

    >gi|269797057|ref|YP_003316512.1| thioredoxin [Sanguibacter keddieii DSM 10542]
    MTVSTPVHATDDTFKSVVLESDVPVLVDFWAEWCGPCRLVAPVLDEIAADYAGRLTIAKVDTEENPQVTAAYGVVSIPLL
    NIYHRGELVRSIVGARPKRSLVEEIDAVLAEIG

    >gi|269794508|ref|YP_003313963.1| protein-disulfide isomerase [Sanguibacter keddieii DSM 10542]
    MPARSSRLVASVVAALAAVVLGALVYVAISSGSSSAERPASGPAAPALAADTRLLSDAGEGAVTVVEFLDFECEVCAAVY
    PVLEDLRAEHEGQVTFAIRYFPMPGHANSTTAAVAVEAAARQGRLEEMYHRMFDTQAQWGEQQVSQADLFRTFAEDLGLD
    LEVYDRDVADPEVLDRVASDFEAGVALGVQGTPTIFVDDVRVELRTEADLRAAIDAALQARQG

    >gi|269795311|ref|YP_003314766.1| predicted redox protein, regulator of disulfide bond formation [Sanguibacter keddieii DSM 10542]
    MGAFHAYTATITWTGAGETGTTSYTAYSRDHVVSVEGKPDILASSDPAFRGDAARHNPEDLFVASLAQCHMLWFLHVAAQ
    ADVVVTEYTDSPVGTMRVEAAGAGQFTEIELRPKVTVGDGTPDATLAALHEKAHAH
    CFISRSVNFPVHVRPALHVGSTAG
    DADTTAG