Salmonella enterica serovar Typhi Ty2 uid57973

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|29140571|ref|NP_803913.1| hypothetical protein t0029 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPSEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|29140593|ref|NP_803935.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|29140701|ref|NP_804043.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|29140745|ref|NP_804087.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MGENLSNYRCRLEQNMSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQ
    GVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|29140796|ref|NP_804138.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MNTVCTHCQAINRIPGDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPMIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|29140848|ref|NP_804190.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|29140856|ref|NP_804198.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFTPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|29140890|ref|NP_804232.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|29140895|ref|NP_804237.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|29140904|ref|NP_804246.1| hypothetical protein t0377 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGHRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|29141113|ref|NP_804455.1| ADA regulatory protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESGRGICAILPGDSDDALLAELHTLFPAARHEPADA
    PFQQRVRQVAAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|29141130|ref|NP_804472.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNRLAAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|29141399|ref|NP_804741.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGGCETGWMYRAVEVQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFTALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|29141545|ref|NP_804887.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|29141636|ref|NP_804978.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSTFKVRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFY
    QPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|29141642|ref|NP_804984.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSKQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQAMLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIELTAIGELVEARGGRAMVEIR

    >gi|29141686|ref|NP_805028.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|29141690|ref|NP_805032.1| hypothetical protein t1226 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDELAQQLAIPASLFDATNGAGVWGGETLLPGMSPVAQVYSGHQFGI
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVAEKYALWFEEVAARTGRLIAEWQTVGF
    SHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNALLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAIVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|29141701|ref|NP_805043.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MELHSGTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|29141760|ref|NP_805102.1| hypothetical protein t1301 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|29141778|ref|NP_805120.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKLFYKPGACSLASHIILREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKFQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGSTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|29141781|ref|NP_805123.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|29141786|ref|NP_805128.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|29141925|ref|NP_805267.1| osmotically inducible protein C [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|29142003|ref|NP_805345.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|29142011|ref|NP_805353.1| putative thiol peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MAKIIQMLKGEVFMTPTTTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPS
    LDTPV
    CEWQVKEYSDRLKSAGSHSNRAVYVLSMDTPFAQARFIREHDIHPGIIFVSDYACRQFLDNSGLKINELSIFARA
    LIECDENNVVTHVSVPRDITHLPVY

    >gi|29142026|ref|NP_805368.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSQTVHFQDNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|29142031|ref|NP_805373.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MLKKGIFALALFVAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|29142112|ref|NP_805454.1| hypothetical protein t1678 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|29142188|ref|NP_805530.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|29142196|ref|NP_805538.1| hypothetical protein t1764 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFR
    QQLYTFDPALDGVRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPSFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGVSCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|29142235|ref|NP_805577.1| secreted copper-sensitivity suppressor D [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VAHLAAEGENVMTVALRSGGDAEVARWLARKGVDFPVVNDANGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|29142236|ref|NP_805578.1| secreted copper-sensitivity suppressor C [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIKNLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSILAARIALTTWRDHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVDVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|29142237|ref|NP_805579.1| copper sensitivity suppressor membrane protein B [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANSETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLRGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDY
    ARAMGKVPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
    RDKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNAWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTAQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|29142398|ref|NP_805740.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|29142445|ref|NP_805787.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|29142465|ref|NP_805807.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYIAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|29142659|ref|NP_806001.1| alkyl hydroperoxide reductase F52A protein subunit F [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGVLERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|29142660|ref|NP_806002.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|29142661|ref|NP_806003.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MIKRTLLLAMLPILAHAEELPALVKAIEKQSITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKNPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|29142697|ref|NP_806039.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVYDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITHILQEKGVELILNANVQAVSSTEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|29142746|ref|NP_806088.1| thioredoxin-like protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYVDALPLLKDAWQLSSQNSEIGLLLAEAQIA
    LNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNPQDAALATQLALQLHQVGRNEEALELLF
    SHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|29142752|ref|NP_806094.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAVIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSILF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAVKTFNGVDEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|29142849|ref|NP_806191.1| peroxidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|29143067|ref|NP_806409.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLPPTPHAAN
    A

    >gi|29143311|ref|NP_806653.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|29143454|ref|NP_806796.1| disulfide isomerase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYTAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|29143455|ref|NP_806797.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|29143703|ref|NP_807045.1| thioredoxin [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|29143783|ref|NP_807125.1| thiamine biosynthesis protein ThiF [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MNDRDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDDVHLSNLQRQILFTTDDIA
    RSKSQVAQQHLTRLNPDIELVSLQQRLKGDALRHAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQVMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGIVGPVVGVMGTLQALEAIKLLSGIETPSGELRLFDGKTSQWRSLALRRASGC
    PVCGGRHANSIQ

    >gi|29143805|ref|NP_807147.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|29143922|ref|NP_807264.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPKGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|29143998|ref|NP_807340.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNRLAAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|29144096|ref|NP_807438.1| hypothetical protein t3816 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|29144097|ref|NP_807439.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|29144189|ref|NP_807531.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKWQNTNVEGIYAVGDNTGAIELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|29144215|ref|NP_807557.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADTDLRAQIEHAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPAAAFAGQISELENAGQTVVLVLRNETVVGVLALQDT
    LRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKTGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|29144256|ref|NP_807598.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|29144319|ref|NP_807661.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRVWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLELPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|29144623|ref|NP_807965.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTGETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQVLGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|29144707|ref|NP_808049.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|29144786|ref|NP_808128.1| hypothetical protein t4550 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
    MMDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGFY
    TRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQWL
    KPDGKLLVEVHTFDEVKRQGMAQPGWQR
    CPHGLFLAVPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDD
    EYISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKASTSEGIALSKRNNPMDIPRIFTISESEHRIHNPFTAEKYA
    TLGHALRMKPGMRILDLGSGSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDV
    AACVGATWIAGGVAGTIDLLAKSLKPGGIILIGKPYWRQIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMVL
    ADPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTAAPKRHVTWTREYFGWGVFALIAR