Salmonella enterica serovar Paratyphi C RKS4594 uid59063

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224581867|ref|YP_002635665.1| hypothetical protein SPC_0030 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|224581887|ref|YP_002635685.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEEAILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|224582052|ref|YP_002635850.1| hypothetical protein SPC_0220 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MEQNMSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSL
    QYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|224582191|ref|YP_002635989.1| putative cation transport ATPase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSQSENRHDTISLLVEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYEARPIETAGQG
    EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
    ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
    VAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRA
    TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
    GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVASGFERREVLAKVAAVESRSEHP
    IARAIVVSAEEEGSALPGMNGFESVTGMGVYATVDGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
    AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
    INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWG
    ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTT

    >gi|224582239|ref|YP_002636037.1| probable peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|224582336|ref|YP_002636134.1| copper-transporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRNLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFSVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|224582342|ref|YP_002636140.1| thioredoxin-like protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAA
    QFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNCEIG
    LLLAEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNPQDAALATQLALQLHQVGR
    NEEALELLFSHLRKDLTAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|224582403|ref|YP_002636201.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|224582440|ref|YP_002636238.1| thiol:disulfide interchange protein DsbG precursor [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSVIGIIINTLFALILKGKNMIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYL
    TPDGKHAISGYMYNEKGENLSNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWV
    ESGKVQLRTLLVGVIKPESPATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAI
    YYMNKDKILQQVVGLPEKAQLDAMMGQP

    >gi|224582441|ref|YP_002636239.1| alkyl hydroperoxide reductase c22 protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|224582442|ref|YP_002636240.1| alkyl hydroperoxide reductase F52A protein (subunit F) [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MFQSWAHPRPFHFSTMTQVALMQSREVGLHDDVFREGRRMLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLA
    EIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEF
    ETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEK
    RAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYD
    VDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVI
    GGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVA
    LAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA


    >gi|224582657|ref|YP_002636455.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|224582768|ref|YP_002636566.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLIERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|224582919|ref|YP_002636717.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|224582930|ref|YP_002636728.1| putative thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFTPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|224582971|ref|YP_002636769.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|224582977|ref|YP_002636775.1| bacterioferritin comigratory protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|224582986|ref|YP_002636784.1| hypothetical protein SPC_1177 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGHRSGITDADSVA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|224583249|ref|YP_002637047.1| ADA regulatory protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCHSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEQITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDEALLAELRTLFPAARHAPADA
    PFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|224583265|ref|YP_002637063.1| heme lyase disulfide oxidoreductase, cytocyhrome c-type biogenesis [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|224583536|ref|YP_002637334.1| hypothetical protein SPC_1749 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGLGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGG
    CETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFTALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|224583702|ref|YP_002637500.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|224583741|ref|YP_002637539.1| hypothetical protein SPC_1962 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLNLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|224583824|ref|YP_002637622.1| phage shock protein E precursor [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MLKKGIFALALFIAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|224583828|ref|YP_002637626.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|224583841|ref|YP_002637639.1| putative thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MAKIIQTLKGEVFMTPATTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPS
    LDTPV
    CEWQVKDYSDRLKSAGSHSNRAVYVLSMDTPFAQARFIREHDIHPGITFVSDYACRQFLDNSGLKINELSIFARA
    LIECDENNVVTRVIVPRDITHLPVY

    >gi|224583849|ref|YP_002637647.1| O6-methylguanine-DNA-alkyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MLRLLEEKIATPLGPLWVVCDEQFQLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|224583943|ref|YP_002637741.1| osmotically inducible protein C [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|224584032|ref|YP_002637830.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|224584037|ref|YP_002637835.1| NADH-ubiquinone oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|224584040|ref|YP_002637838.1| glutathione S-transferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|224584058|ref|YP_002637856.1| hypothetical protein SPC_2298 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|224584119|ref|YP_002637917.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|224584144|ref|YP_002637942.1| hypothetical protein SPC_2386 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTLSFTARWRDELPATYTALLPTLLKNARLIWYNDKLAQQLAIPASLFDVTNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVPEKYVLWFEEVAARTGRLIVEWQTVGF
    SHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNVLLNELFSLMAREGSDYSRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAVVLRNWLAQRAIDAAEQGDMAELHWLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|224584147|ref|YP_002637945.1| putative glutathione peroxidase/vitamin B12 transport periplasmic protein BtuE [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|224584187|ref|YP_002637985.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|224584202|ref|YP_002638000.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSTFKVRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFY
    QPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|224584331|ref|YP_002638129.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDESRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|224584341|ref|YP_002638139.1| hypothetical protein SPC_2594 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKLETFRQQ
    LYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPSFDASNVGDYLKAADVNVMLDDPDAVFIDMRNHYEYE
    VGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGLPV
    RFIGKNFVFDERMGERISDEVIAHCHQCGASCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRRRR
    AGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|224584377|ref|YP_002638175.1| secreted protein, suppressor for copper-sensitivity D [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVNDAKGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|224584378|ref|YP_002638176.1| secreted protein, suppressor for copper-sensitivity C precursor [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSILAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|224584379|ref|YP_002638177.1| membrane protein, suppressor for copper-sensitivity B precursor [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLRGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDY
    ARAMGKIPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEQAPDL
    RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNAWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVALRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|224584504|ref|YP_002638302.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|224584588|ref|YP_002638386.1| hypothetical protein SPC_2849 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MMTTLRQPYYELSPEVYSALVQAKNALEKSTLDPTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVS
    HHFSEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLINCFNRLAIGMRM

    >gi|224584590|ref|YP_002638388.1| putative glutaredoxin [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPTPHAAN
    A

    >gi|224584832|ref|YP_002638630.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKKRFMMFTLLAAAFSGVAHADDVAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|224584994|ref|YP_002638793.1| disulfide isomerase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|224584995|ref|YP_002638794.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACILAFGLCLILLLVMSGAWALKLARGK

    >gi|224585246|ref|YP_002639045.1| hypothetical protein SPC_3520 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLALPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|224585318|ref|YP_002639117.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKERFMEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFIREHGFDTAVMVMCYHGNSSKGAA
    QYLLQQGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|224585368|ref|YP_002639167.1| heavy metal-transporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQVLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESR
    LKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTTLVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAA
    MVLLLFLIGERLEGWAASRARKGVSALMALKPETATRLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDE
    SALTGESIPVERATGDKVPAGATSVDRLVTLEVLSEPGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALL
    VTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIG
    KPRVTAIHPASGISEAELLALAAAVEQGATHPLAQAIVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICTAGKQP
    TAAFAGQISELENAGQTVVLVLRNETVVGVLALQDTLRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKAG
    LLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAASIGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQ
    NITIVLGLKAIFLVTTLLGFTGLWLAILADTGATVLVTANALRLLRKN

    >gi|224585390|ref|YP_002639189.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPEIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|224585502|ref|YP_002639301.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|224585503|ref|YP_002639302.1| putative secreted protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|224585613|ref|YP_002639412.1| heme lyase disulfide oxidoreductase, cytocyhrome c-type biogenesis [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|224585702|ref|YP_002639501.1| thiamine biosynthesis protein ThiF [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDDVHLSNLQRQILFTTDDIA
    HPKAQAAKLRLAQLNPGSKLIVLQQRLTGDVLKNAVAHADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGIVGPVVGMMGTLQALEAIKLLSGIETPSGELRLFDGKTSQWRSLALRRASGC
    PVCGGRHANSVQ

    >gi|224585738|ref|YP_002639537.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|224585807|ref|YP_002639606.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MIMKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKY
    HVEFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEK
    AAADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|224585939|ref|YP_002639738.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPSDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|224586167|ref|YP_002639966.1| thiol:disulfide interchange protein precursor [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTVTYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTGETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAGMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGNPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|224586250|ref|YP_002640049.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA