Salmonella enterica serovar Paratyphi B SPB7 uid59097

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161612348|ref|YP_001586313.1| hypothetical protein SPAB_00036 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|161612370|ref|YP_001586335.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|161612502|ref|YP_001586467.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|161612572|ref|YP_001586537.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|161612631|ref|YP_001586596.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|161612695|ref|YP_001586660.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|161612707|ref|YP_001586672.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFMPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|161612752|ref|YP_001586717.1| hypothetical protein SPAB_00451 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|161612759|ref|YP_001586724.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|161612768|ref|YP_001586733.1| hypothetical protein SPAB_00467 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|161613018|ref|YP_001586983.1| hypothetical protein SPAB_00725 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQQ
    RRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFPD
    SSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDDALLAELHTLFPAARHEPADAL
    FQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    C
    HRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|161613037|ref|YP_001587002.1| hypothetical protein SPAB_00744 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|161613468|ref|YP_001587433.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIHLEGTPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPMFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDLWISGHAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTPAKES
    V

    >gi|161613685|ref|YP_001587650.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|161613736|ref|YP_001587701.1| hypothetical protein SPAB_01461 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|161613837|ref|YP_001587802.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MLKKGIFALALFIAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLQEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|161613842|ref|YP_001587807.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|161613859|ref|YP_001587824.1| hypothetical protein SPAB_01594 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTPATTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPSLDTPVCEWQVKEY
    SDRLKSAGSHSNRAVYVLSMDTPFAQARFIREHDIHPGITFVSDYACRQFLDNSGLKINELSIFARALIECDENNVVTRV
    SVPRDITHLPVY

    >gi|161613868|ref|YP_001587833.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|161613997|ref|YP_001587962.1| hypothetical protein SPAB_01736 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|161614122|ref|YP_001588087.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|161614127|ref|YP_001588092.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|161614131|ref|YP_001588096.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKFQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|161614148|ref|YP_001588113.1| hypothetical protein SPAB_01888 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|161614217|ref|YP_001588182.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|161614246|ref|YP_001588211.1| hypothetical protein SPAB_01991 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDKLAQQLAIPASLFDATNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVAEKYALWFEEVAARTGRLIAEWQTVGF
    AHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNALLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAVVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|161614251|ref|YP_001588216.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|161614301|ref|YP_001588266.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQAMLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIELTAIGELVEARGGRAMVEIR

    >gi|161614309|ref|YP_001588274.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFYQPVSEEAIRY
    IDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|161614614|ref|YP_001588579.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|161614625|ref|YP_001588590.1| hypothetical protein SPAB_02375 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAYEGINAQISVPQSKVETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPSFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRARAQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|161614682|ref|YP_001588647.1| hypothetical protein SPAB_02433 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MAAKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLRTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVINDANGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|161614683|ref|YP_001588648.1| hypothetical protein SPAB_02434 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|161614684|ref|YP_001588649.1| hypothetical protein SPAB_02435 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLRGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDY
    ARAMGKVPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
    RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNAWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|161614812|ref|YP_001588777.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINKVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|161614864|ref|YP_001588829.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|161614898|ref|YP_001588863.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|161615185|ref|YP_001589150.1| hypothetical protein SPAB_02953 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MFQSWAHLRPFHFSTMTQVALMQSREVGLHDDVFREGRRMLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLA
    EIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEF
    ETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEK
    RAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYD
    VDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVI
    GGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVA
    LAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA


    >gi|161615186|ref|YP_001589151.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|161615187|ref|YP_001589152.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSAIGIIINTLFALILKGKNMIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYL
    TPDGKHAISGYMYNEKGENLSNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWV
    ESGKVQLRTLLVGVIKPESPATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAI
    YYMNKDKILQQVVGLPEKAQLDAMMGQP

    >gi|161615228|ref|YP_001589193.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|161615293|ref|YP_001589258.1| hypothetical protein SPAB_03062 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAA
    QFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIG
    LLLAEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPQDAALATQLALQLHQVGR
    NEEALELLFSHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|161615299|ref|YP_001589264.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGRASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|161615414|ref|YP_001589379.1| hypothetical protein SPAB_03185 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|161615474|ref|YP_001589439.1| hypothetical protein SPAB_03245 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYEARPVETAGQG
    EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
    ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
    VAHVLREGRIVDIPVDEVVLGDCMEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRA
    TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
    GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVAGGFERREVLAKVAAVESRSEHP
    IARAIVVSAEEEGIALPGMNGFESVTGMGVYATVAGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
    AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
    INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWG
    ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTT

    >gi|161615698|ref|YP_001589663.1| hypothetical protein SPAB_03483 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MMTTLRQPYYELSPEVYSALVQAKNALEKSTLDLTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVS
    HHFSEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLMNCFNRLAIGMRM

    >gi|161615700|ref|YP_001589665.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPTPHAAN
    A

    >gi|161615990|ref|YP_001589955.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|161616184|ref|YP_001590149.1| hypothetical protein SPAB_03986 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|161616185|ref|YP_001590150.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|161616478|ref|YP_001590443.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLALPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|161616564|ref|YP_001590529.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|161616624|ref|YP_001590589.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPAAAFAGQISELENAGQTVVLVLRNETVVGVLALQDT
    LRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|161616649|ref|YP_001590614.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|161616780|ref|YP_001590745.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|161616781|ref|YP_001590746.1| hypothetical protein SPAB_04600 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|161616928|ref|YP_001590893.1| hypothetical protein SPAB_04749 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|161617033|ref|YP_001590998.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|161617118|ref|YP_001591083.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|161617269|ref|YP_001591234.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|161617301|ref|YP_001591266.1| thiamine biosynthesis protein ThiF [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MNDHDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGKLTLVDDDDIHLSNLQRQILFTTDDIA
    RSKSQVAQQRLTRLNPDIELVSLQQRLKGDALRHAVSRADVVLDCTDNMATRQEINAACVALNIPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGIVGPVVGVMGTLQALEAIKLLSGIETPSGELRLFDGKTSQWRSLALRRASGC
    PVCGGRHANSIQ

    >gi|161617560|ref|YP_001591525.1| arsenate reductase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSNITIYHNPACGTSRNTLEMIRNSGIEPTVILYLENPPSRDELVKLIADMDISVRALLRKNVEPYEELGLAEDKFTDDQ
    LIDFMLQHPILINRPIVVSPLGTRLCRPSEVVLDILPDAQRGEFTKEDGEKVIDAHGQRVIK

    >gi|161617592|ref|YP_001591557.1| thiol:disulfide interchange protein precursor [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTSETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|161617685|ref|YP_001591650.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVISYEQLLQIFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASCERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|161617794|ref|YP_001591758.1| hypothetical protein SPAB_05658 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
    MDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGFYT
    RLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQWLK
    PDGKLLVEVHTFDEVKRQGMEQPGWQR
    CPHGLFLAVPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDDE
    YISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKASTSEGIALSKRNNPMDIPRIFTISESEHRIHNPFTAEKYAT
    LGHALRMKPGTRILDLGSGSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDVA
    ACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRRIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMVLA
    DPQGWDRYEAAKWMTMRRWLEENPNDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIAR