Salmonella enterica serovar Paratyphi A AKU 12601 uid59269

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|197361238|ref|YP_002140873.1| hypothetical protein SSPA0025 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPSEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|197361259|ref|YP_002140894.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMFLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKDAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|197361364|ref|YP_002140999.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNSLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDTEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|197361412|ref|YP_002141048.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MGENLSNYRCRLEQNMSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQ
    GVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|197361463|ref|YP_002141099.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|197361516|ref|YP_002141152.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|197361524|ref|YP_002141160.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFTPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGVRTDLPVEPA

    >gi|197361557|ref|YP_002141193.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTDTIKTYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|197361562|ref|YP_002141198.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHKVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|197361571|ref|YP_002141207.1| hypothetical protein SSPA0362 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGHRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|197361770|ref|YP_002141406.1| ADA regulatory protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDDALLAELHTLFPAARHEPADA
    LFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|197361786|ref|YP_002141422.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKRNVLLLPLLIFLLIAAALLWQLARNAEGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|197362048|ref|YP_002141685.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVAGGIIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGG
    CETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFAALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|197362199|ref|YP_002141836.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|197362234|ref|YP_002141871.1| hypothetical protein SSPA1030 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|197362315|ref|YP_002141952.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MLKKGIFALALFIAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|197362319|ref|YP_002141956.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNGLKA

    >gi|197362331|ref|YP_002141968.1| putative thiol peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MAKIIQMLKGEVFMTPTTTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPS
    LDTPV
    CEWQVKEYSDRLKSAGSHSNRAVYVLSMDTPFAQARFIREHDIHPGIIFVSDYACRQFLDNSGLKINELSIFARA
    LIECDENNVVTHVSVPRDITHLPVY

    >gi|197362339|ref|YP_002141976.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIGTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|197362415|ref|YP_002142052.1| osmotically inducible protein C [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|197362496|ref|YP_002142133.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|197362501|ref|YP_002142138.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSTLRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|197362504|ref|YP_002142141.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKLFCKPGACSLASHIILREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADCVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKFQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|197362522|ref|YP_002142159.1| hypothetical protein SSPA1320 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|197362581|ref|YP_002142218.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MELHSGTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|197362592|ref|YP_002142229.1| hypothetical protein SSPA1390 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDELAQQLAIPASLFDATNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVAEKYALWFEEVAARTGRLIAEWQTVGF
    AHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNVLLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAIVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|197362596|ref|YP_002142233.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|197362640|ref|YP_002142277.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTDRNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|197362646|ref|YP_002142283.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFYQPVSE
    EAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|197362771|ref|YP_002142408.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|197362779|ref|YP_002142416.1| hypothetical protein SSPA1576 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPTFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|197362815|ref|YP_002142452.1| copper sensitivity supressor protein D [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERSVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGGDAEVARWLARKGVDFPVVNDANGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|197362816|ref|YP_002142453.1| copper sensitivity supressor protein C [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSILAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|197362913|ref|YP_002142550.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|197362961|ref|YP_002142598.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|197362981|ref|YP_002142618.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDATVGQPKVE
    SARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQVTVFTYRE
    NEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMRNPGCEVCG
    Q

    >gi|197363177|ref|YP_002142814.1| alkyl hydroperoxide reductase subunit F [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLKQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|197363178|ref|YP_002142815.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|197363179|ref|YP_002142816.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|197363214|ref|YP_002142851.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTQYQTLIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDSLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKNVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|197363262|ref|YP_002142899.1| thioredoxin-like protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMSAAQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIGLLLAEAQIA
    LNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPQDAALATQLALQLHHVGRNEEALELLF
    SHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|197363267|ref|YP_002142904.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAEYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGQITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAVKTFNGVDEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRAMLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|197363364|ref|YP_002143001.1| putative peroxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|197363690|ref|YP_002143327.1| hypothetical protein SSPA2482 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTTLRQPYYELSPEVYSALVQAKNALEKSTLDPMLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVSH
    HFSEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLMNCFNRLAIGMRM

    >gi|197363692|ref|YP_002143329.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLPPTPHAAN
    A

    >gi|197363918|ref|YP_002143555.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEK
    EMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGK
    GVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|197364062|ref|YP_002143699.1| dsbA-like protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYTAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|197364063|ref|YP_002143700.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|197364300|ref|YP_002143937.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLALPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|197364363|ref|YP_002144000.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|197364404|ref|YP_002144041.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADTDLRAQIEHAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGISALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPAAAFAGQISELENAGQTVVLVLRNETVVGVLALQDT
    LRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|197364431|ref|YP_002144068.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKWQNTNVEGIYAVGDNTGAIELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|197364519|ref|YP_002144156.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|197364520|ref|YP_002144157.1| hypothetical protein SSPA3318 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|197364620|ref|YP_002144257.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKRNVLLLPLLIFLLIAAALLWQLARNAEGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|197364705|ref|YP_002144342.1| thioredoxin [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|197364774|ref|YP_002144411.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|197364890|ref|YP_002144527.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|197364915|ref|YP_002144552.1| thiamine biosynthesis protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MNDRDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDDVHLSNLQRQILFTTDDIA
    RSKSQVAQQHLTRLNPDIELVSLQQRLKGEALRHAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQVMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGIVGPVVGVMGTLQALEAIKLLSGIETPSGELRLFDGKTSQWRSLALRRASGC
    PVCGGQHANSIQ

    >gi|197365043|ref|YP_002144680.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTVTYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTGETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|197365124|ref|YP_002144761.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|197365198|ref|YP_002144835.1| hypothetical protein SSPA4001 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MECFRDDELCPGAVFPEGNIIFFFLPGRARPVIAQEWEFITPLVADAPAEVELFSFYCPPCYAFSQTMGVARAIRHVLPH
    GDRMIKYHVSLLGPLGHELTRAWALAMMMKETDVVEKAFFTADMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVN
    DMVALQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVEDFRSRYAAVVRKLLAGNPDAD

    >gi|197365208|ref|YP_002144845.1| hypothetical protein SSPA4011 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
    MDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGFYT
    RLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQWLK
    PDGKLLVEVHTFDEVKRQGMEQPGWQR
    CSHGLFLAVPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDDE
    YISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKAPLAEGIALSKRNNPMDIPRIFTISESEHRIHNPFTAEKYAT
    LGHALRMKPGTRILDLGSGSGEMLRTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDVA
    ACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRRIPATEEIAHACGVSSVADFRPLPELVVFFDQLGYDVVEMVLA
    DPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTAAPKRHVTWTREYFGWGVFALIAR