Bacillus cereus E33L uid58103

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|52144967|ref|YP_081862.1| protein disulfide isomerase (S-S rearrangase) [Bacillus cereus E33L]
    MKIEVWSDFVCPFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKDQGKEKEITEKLLLAYFTESRNLSDVDTLATIAEASGLDKQEALKVINDKS
    AYANDVRVDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPVPKLQELSSEGGSDMSCTDESCSVPS
    KEQ

    >gi|52144904|ref|YP_081925.1| alkyl hydroperoxide reductase subunit F [Bacillus cereus E33L]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|52144902|ref|YP_081926.1| alkyl hydroperoxide reductase [Bacillus cereus E33L]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|52144858|ref|YP_081970.1| thioredoxin [Bacillus cereus E33L]
    MKKFETIEELVTYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNG
    KEILRESRFISLENLERTIQLFEE

    >gi|52144776|ref|YP_082052.1| bacterioferritin comigratory protein [Bacillus cereus E33L]
    MITMVTVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDSYGLFQEKDTVILGVSPDPANRHL
    KFIEKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIN

    >gi|52144770|ref|YP_082059.1| thiol-disulfide oxidoreductase (disulfide bond formation protein D) (disulfideoxidoreductase D) [Bacillus cereus E33L]
    MYMKSSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLP
    RLKEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVD
    IAQFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKAAIDKELKK

    >gi|52144714|ref|YP_082114.1| cation-transporting ATPase, P-type [Bacillus cereus E33L]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETAQNKESEVVTEAKQLVTKLEPHIKVQEEKN
    KKVAKEVFILEGLD
    CANCAMKIENKVKEMPTVSTATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKPVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVKIAKRTRSIVWQNIIFALGVKGIVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|52144665|ref|YP_082161.1| OsmC-like protein [Bacillus cereus E33L]
    MKLTIKHDDIEADLSYGPLAIGKENGYSPLQLLVSSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAQNITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|52144580|ref|YP_082248.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus E33L]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYAESDVENNLP
    KAVAAKKRLEEINSEVRVKALVQDVTAEELEELVTNVNVMIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPYKEEMDFERYKELLNDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTVYHRYFG

    >gi|52144564|ref|YP_082264.1| thioredoxin [Bacillus cereus E33L]
    MKKMLIFGGIIIVLFAAIFAVTQMEKKSASTDEKGYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPIVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKDKFKEWFEQTKK

    >gi|52144553|ref|YP_082275.1| NADH dehydrogenase [Bacillus cereus E33L]
    MSRKIVVVGGVAGGASVAARLRRLSEDDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVKINKEEKTITIKNVTTNETYNEQYDILILSPGAKPIVPPIPCIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIG
    GGFIGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKNHDVELVFEDGVDALEENGTVVRLKSGSVIQTDML
    ILAIGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    DSLYKGTLGTSVAKVFDLTVATNGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKRMDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYVASNIVDGFVDTVQWHEIDRIVENGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLEEVPVDKDIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERIVY

    >gi|52144552|ref|YP_082277.1| hypothetical protein BCZK0672 [Bacillus cereus E33L]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEVKATDKGSTVDIKSWANKVGHQYIGTKHEGDILMHYIRKAHEH
    EVNEVVKYPHTITNTELEEILVSGEECTVLDVREAAEFAFGHIPSATSMPLGELESLVLDKTKKIYVV
    CRTGNRSDVACQ
    MLKEKGYTNVKNVIPGMIEWQGNIEN

    >gi|52144550|ref|YP_082278.1| metallo-beta-lactamase family protein [Bacillus cereus E33L]
    MEVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAIRTVEAYEQFAKE
    NDVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITMGGTKIEIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQNLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYEEIRQTNMGKIHPSVDEEREMEIGPNRCAVHK

    >gi|52144546|ref|YP_082280.1| rhodanese-like domain-containing protein [Bacillus cereus E33L]
    MNTILSTLFIVLAAWFVISRFLPVKGVQNINGKELKSIVGKQGKYFIDVRTVGEYRGNHMKGFQNIPLNDLASKTNQLDK
    NREVIVI
    CQSGMRSKQAAKMLKKLGFQHVINVSGGMNGL

    >gi|52144547|ref|YP_082281.1| rhodanese-like domain-containing protein [Bacillus cereus E33L]
    MKEMTAKELEEKLLCKEAVNIVDVREVEEVAEGKIPEACNIPLGLLEFRMHELDKKKEYIIVCRSGGRSARAVQFLEGYG
    FRVINMVGGMLAWEGKVE

    >gi|52144143|ref|YP_082686.1| transcriptional regulator Spx [Bacillus cereus E33L]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|52144086|ref|YP_082743.1| pyridine nucleotide-disulfide oxidoreductase; NADH dehydrogenase [Bacillus cereus E33L]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEV
    TKVDTEKKIVYAEHTKTKDVFEFQYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHNIEILTNENVKAFKGNERVEAVETDKDTYKADLVLV
    SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPLGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMDLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|52143874|ref|YP_082954.1| thiol-disulfide oxidoreductase [Bacillus cereus E33L]
    MKKNRLLFRVIILLILCGAVGFTLYQGFFADKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETEIAVKNFVKQYDLKFPVAIDKGTKIIGTYSVGPLPTSFLIDKDGKVVEKIIGEQT
    KEQLEGYLQKITP

    >gi|52143776|ref|YP_083052.1| thiosulfate sulfurtransferase [Bacillus cereus E33L]
    MIVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYGEEHIPHALYFDLNVDLSSPITEHGGRHPLPNVEEFADKLSQAG
    IDEHMTVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPITQEIPVVIRKTFKANIQDHMLVTMETVREN
    IDAGKDVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|52143635|ref|YP_083191.1| thioredoxin family protein [Bacillus cereus E33L]
    MKKLIAIILAGALIWAGVNFYNSKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLHDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVRMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFKFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|52143571|ref|YP_083258.1| peptide methionine sulfoxide reductase [Bacillus cereus E33L]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLNLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHNEMQKELAEKSKQTLAESGMFKEPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGRADFIKENWQKK

    >gi|52143539|ref|YP_083289.1| hypothetical protein BCZK1694 [Bacillus cereus E33L]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEQIEAGK

    >gi|52143497|ref|YP_083332.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus E33L]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|52143394|ref|YP_083439.1| methylated-DNA--[protein]-cysteine S-methyltransferase (6-O-methylguanine-DNA methyltransferase) [Bacillus cereus E33L]
    MYQAYYESELGLLEITANDKGITSVIFVDERQEERTNEMIDQCINELDEYFKGKRKEFTVPLSAEGTSFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|52143310|ref|YP_083518.1| glutathione peroxidase [Bacillus cereus E33L]
    MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKGQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|52143299|ref|YP_083530.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus E33L]
    MQERYSRQVLFSGIGEMGQRKIREKHVLLIGAGALGAANAEALVRMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRKINSEVEIVPVVTDVTMKEMEELTKEVDLILDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQKKSTCP
    SCGNTRTYPSLTFESQVKTEVLCGRNTVQVRPGIKRVLNLNEIKKRLQKIVHVQKTPYLLSFLIDEYRFVLFTDGRAFIH
    GTNDVKIGKRLYTKYIG

    >gi|52143146|ref|YP_083681.1| thioredoxin [Bacillus cereus E33L]
    MKEIKSEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|52143033|ref|YP_083796.1| phytoene dehydrogenase related enzyme [Bacillus cereus E33L]
    MKKFDIAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALYRGGAAFLTFNELGMSLPGGI
    PSTKAHGIWKRNIFTIPTDFRSILLTPLLSWSAKVQFLRLMIRLGNLNIGEVPKMSLTTWTENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKEGVFYVDGGWETIITKLRDIANHVGVQFLAKKHVLEIEHYEDKQRIYCFDDEVFEV
    GTVIVATPPKEACNIIKGAEGTSLQRWSEQSIPVTVTALDIGLRRLPNPTHQFALGLDQPIFFTNQSRAAKLSDDGSIAV
    SLIKYQNPALEMKHTHEDKEQLESTMDLLHPNWKREVVAQQYLPTIKVVYDFPHINRFETPGPNIPEMPGVYVAGDWAGH
    DEILADAAVASGKRAALHILKQLESEAVHHGNGAII

    >gi|52142962|ref|YP_083867.1| hydroxyacylglutathione hydrolase [Bacillus cereus E33L]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPGRYIEQYIEFAKKEGMEVIAAAETHIHADFLSGSRELSTLYHANLYVSD
    VGDCDWKYQYLNEGQYNLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGMKDTAKIGAKQLFDSIQKIKTLPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNEESDFISTLL
    TGQPEPPRYFSLMKNLNKYGPPIRKKREIFAIKTVEELQEVMRSVQQIVDIRDVEIFASGHIEKSINIPYNNSFTTWCGW
    LLDYKTETLIILDEEKVRVEEVIRDFESIGLDNIIAFAPLQVIQRLDRFESYKEKTSIELYPHIKDGRVKVIDVRSKKEW
    DEGHLHDAIHIPLGNLLKQLDCIPKDCPIVLQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWNKEELPYTTCNLNV

    >gi|52142738|ref|YP_084091.1| dihydrolipoamide dehydrogenase [Bacillus cereus E33L]
    MSKLVVIGGGPAGYVAAITAAQNGKNVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKSNHYGVTLNNGSISIDWK
    QMQVRKSQIVTQLVQGIQYLMKKNKIKVIQGKAKFETDHRVRVTYGDKEIVVDGEQFIIATGSEPTELPFAPFDGKWILN
    STHAMSLKNIPKSLLIVGGGVIGCEFASIYSRLGTKVTIVEMAPQLLPGEDEDIAHILRRELENDGVKIFTGATLKGLNS
    YKKQALFEYEGSIQEVNTEFVLVSVGRKPRVQQLNLEKAGIQYSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFYE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLTEKDAREQYGDIQIGEFPFTANGKALIIGEQMGKVKVIVEPKYQE
    IVGISIIGPRATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALLQAVGHAVHA

    >gi|52142686|ref|YP_084143.1| carboxymuconolactone decarboxylase [Bacillus cereus E33L]
    MRYIAFLSSHTTIGTDNLNGGNNNMEHEQHHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGTLTKREKQLI
    ALGISLATQDEY
    CTIYHTKGCLDQGCSDKEILEACGVSAAFAGGAAMSQAVTLVQECLSELKNQKH

    >gi|52142132|ref|YP_084696.1| transcriptional regulator Spx [Bacillus cereus E33L]
    MVVLYTTASCASCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY
    KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|52142021|ref|YP_084808.1| hypothetical protein BCZK3222 [Bacillus cereus E33L]
    MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFHPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWY
    KLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALSNPYAYSADQEDYCAPPAPTNR
    PYRTF
    CGT

    >gi|52141968|ref|YP_084861.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus E33L]
    MAERYSRQQLFKPIGDRGQEKIRNKHVLIVGAGALGSASAESFVRAGIGKLTIIDRDYVEWSNLQRQQLYSEEDAREKLP
    KAIAAKNRLEKLNSEVQIDTFVMDACAENLEGLLENVDVIIDATDNFDIRFIINDLSQKYNIPWVYGSCVGSYGMSYTII
    PQETPCLHCMLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFAAIRKTFFMFDIWSNQNHFIKLGKIKTDDC
    PSCGLNRTYPYLSYENQTKVAVLCGRNTVQIRPVENRQYNFDDIEKVLKKLGEVDRNPYLLSCQLDEYRVVIFRDGRVFI
    HGTNDISKAKQLYYRVFG

    >gi|52141927|ref|YP_084902.1| AhpC/TSA family protein [Bacillus cereus E33L]
    MWRKLTIIVVLLCLAGYAAYEQFGKSDQAAQGEQEKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNIKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKKHKDNVEILAINYTPSEKGGGVEKVTNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRIAKLK

    >gi|52141760|ref|YP_085069.1| heavy metal-transporting ATPase [Bacillus cereus E33L]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNGATVNFALESATVDFNPDEINVNEMKSAITKLGYKLEVKSDEQDESTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNEEEILRLVGAAEKNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLLIGTRRLMKKFDINIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAITR
    LKKMGLDVVMITGDNTQTAQAIAGQVGIEHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAAFGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|52141758|ref|YP_085070.1| copper-ion-binding protein [Bacillus cereus E33L]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ

    >gi|52141749|ref|YP_085080.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus E33L]
    MNSYKNNYIYWTLLTHANWKFHIAATETGLCFIGSQNETFEEVNIWARKKLPQHILIHSPDYLQVYTKEIIEYLENKRET
    FTSPIDAYGTAFQLSVWSTVREIPYGKTYSYTEIADRIQKPTAVRAVASAIAANPILITIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLALEKLQVEFI

    >gi|52141520|ref|YP_085309.1| dihydrolipoamide dehydrogenase [Bacillus cereus E33L]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVTIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|52141504|ref|YP_085326.1| glutaredoxin family protein [Bacillus cereus E33L]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEIVAGFQIEKLQQLLNIE

    >gi|52141373|ref|YP_085457.1| Na+/H+ antiporter [Bacillus cereus E33L]
    MVSKIESVLLTIFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISALEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYISKTGIKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITKLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPIVTIIVGFTGFGLSWKKEKAVTIS

    >gi|52141335|ref|YP_085495.1| dihydrolipoamide dehydrogenase [Bacillus cereus E33L]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|52141286|ref|YP_085543.1| rhodanese-related sulfurtransferase [Bacillus cereus E33L]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|52141038|ref|YP_085791.1| organic hydroperoxide resistance protein [Bacillus cereus E33L]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|52140981|ref|YP_085847.1| thioredoxin [Bacillus cereus E33L]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|52140868|ref|YP_085961.1| thiol peroxidase [Bacillus cereus E33L]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKAAK

    >gi|52140809|ref|YP_086021.1| thioredoxin [Bacillus cereus E33L]
    MKSLESMEQFQELKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|52140794|ref|YP_086035.1| NAD(FAD)-utilizing dehydrogenase [Bacillus cereus E33L]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLKTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAKKAGHTITELFPTEVPILSNEPFIQDRSLQGLALRDVNLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTVQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|52140777|ref|YP_086051.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus E33L]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFEALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYTRYIG

    >gi|52140775|ref|YP_086056.1| rhodanese-like domain-containing protein [Bacillus cereus E33L]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVATGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|52140733|ref|YP_086097.1| hypothetical protein BCZK4522 [Bacillus cereus E33L]
    MYVTVTEAAYKKIMDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSTMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|52140589|ref|YP_086239.1| hypothetical protein BCZK4666 [Bacillus cereus E33L]
    MYNRTRTERMVYFMIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKE
    SAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTASNAGKPEEC

    >gi|52140588|ref|YP_086242.1| pyridine nucleotide-disulphide oxidoreductase (NADH dehydrogenase) [Bacillus cereus E33L]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWHNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|52140541|ref|YP_086286.1| thioredoxin [Bacillus cereus E33L]
    MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFE
    NGTLIKKIYAFHSVEYLYTELK

    >gi|52140537|ref|YP_086289.1| arsenate reductase [Bacillus cereus E33L]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|52140427|ref|YP_086401.1| glutaredoxin family protein [Bacillus cereus E33L]
    MKVVLYTKKDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|52140407|ref|YP_086422.1| thioredoxin-disulfide reductase (thioredoxin reductase (NADPH)) [Bacillus cereus E33L]
    MNSVSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGA
    EYAYGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSA
    VEEGVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFV
    YIGMLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSE
    K

    >gi|52145244|ref|YP_086701.1| bifunctional methionine sulfoxide reductase A/B protein [Bacillus cereus E33L]
    MVVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELAKSERFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSIDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLMLFGNK
    K

    >gi|67077909|ref|YP_245529.1| disulfide bond formation protein A [Bacillus cereus E33L]
    MNTMSKKILFSSLVILISIGSLFFIFTSKDLDKPEYTNIDMKEYKGKINSKDNFYIYVYKTSCTACQSTKPFLNEVIKED
    KKKVFAINMESEENMDIEFLKKNNIQKTPTLLKYKNGEEMNRVEGIQSKSELKSFLAE