Salmonella enterica serovar Gallinarum 287 91 uid59249

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|205351371|ref|YP_002225172.1| hypothetical protein SG0030 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQDGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|205351392|ref|YP_002225193.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|205351495|ref|YP_002225296.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEGAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|205351541|ref|YP_002225342.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|205351670|ref|YP_002225471.1| putative cation transport ATPase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYEARPIETAGQG
    EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
    ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
    VAHVLREGRIEDIPVDEVVLGDCVEVRPGERIPVDGEVTEGRRFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRA
    TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
    GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVASGFERREVLAKVAAVESRSEHP
    IARAIVVSAEEEGIALPGMNGFESVTGMGVYATVDGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
    AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
    INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWG
    ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTTRGGAS

    >gi|205351714|ref|YP_002225515.1| putative peroxidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|205351805|ref|YP_002225606.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISSVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDSKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLIGVFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|205351860|ref|YP_002225661.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPMKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDQDIAQAITHILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|205351896|ref|YP_002225697.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKAPWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|205351897|ref|YP_002225698.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|205351898|ref|YP_002225699.1| alkyl hydroperoxide reductase subunit F [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYNVDVIDSQSASKLVPAAAEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|205352098|ref|YP_002225899.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MAELSDQEMLRYNRQIILRGFDFEGQETLKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|205352124|ref|YP_002225925.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|205352166|ref|YP_002225967.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|205352267|ref|YP_002226068.1| copper-sensitivity suppressor membrane protein B [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLSGVLTLSTCSNVCLLTDYPFSVTATVQNADFAHDY
    ARAMGKVPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
    RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNVWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|205352268|ref|YP_002226069.1| secreted protein, suppressor for copper-sensitivity C [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|205352269|ref|YP_002226070.1| secreted protein, suppressor for copper-sensitivity D [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MAAKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVNDAKGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|205352341|ref|YP_002226142.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGAWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGG
    CETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFAALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|205352527|ref|YP_002226328.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|205352563|ref|YP_002226364.1| hypothetical protein SG1348 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MQNIVIVANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|205352636|ref|YP_002226437.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MLKKGIFALALFVAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|205352640|ref|YP_002226441.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|205352658|ref|YP_002226459.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLTDYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|205352751|ref|YP_002226552.1| osmotically inducible protein C [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|205352828|ref|YP_002226629.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|205352833|ref|YP_002226634.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|205352836|ref|YP_002226637.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLAPYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAALERKFQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|205352853|ref|YP_002226654.1| hypothetical protein SG1685 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|205352911|ref|YP_002226712.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAEKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|205352936|ref|YP_002226737.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKITLAK

    >gi|205352976|ref|YP_002226777.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|205352988|ref|YP_002226789.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSTFKVRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFY
    QPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|205353096|ref|YP_002226897.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESIDIVHYVDNLDGKPLLTG
    KRNTAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPIKVADYRDNMAKQTQINLLSSMAI

    >gi|205353105|ref|YP_002226906.1| hypothetical protein SG1966 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPTFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPKCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|205353366|ref|YP_002227167.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|205353383|ref|YP_002227184.1| ADA regulatory protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAEQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKVSTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGWCLVAESERGICAILPGDSDDALLAELHTLFPTARHEPADA
    SFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|205353585|ref|YP_002227386.1| hypothetical protein SG2512 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|205353594|ref|YP_002227395.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGKRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|205353600|ref|YP_002227401.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|205353632|ref|YP_002227433.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|205353640|ref|YP_002227441.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|205353692|ref|YP_002227493.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCSPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|205353753|ref|YP_002227554.1| hypothetical protein SG2710 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTTLRQPYYELSPEVYSALVQAKNALEKSTIDPTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVSH
    HFNEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLMNCFNRLAIGMRM

    >gi|205353755|ref|YP_002227556.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPTPHAAN
    A

    >gi|205353967|ref|YP_002227768.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEK
    EMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGK
    GVKPASCDMNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|205354108|ref|YP_002227909.1| disulfide isomerase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKAGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|205354109|ref|YP_002227910.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|205354298|ref|YP_002228099.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNHNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|205354417|ref|YP_002228218.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|205354436|ref|YP_002228237.1| thiamine biosynthesis protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASHVLIVGLGGLGSPAALYLAGAGIGKLTLADDDDIHLSNLQRQILFTTDDIA
    RSKSQVARQRLTQLNPDIELVSLQRRLKGDALRHAVSRADVVLDCTDNMSTRQEINAACVALNTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGVLGPVVGVMDTLQALEAIKLLSGIETPNGQLRLFDGKTSQWRSLALRRASGC
    PVCGGQHANSIQ

    >gi|205354514|ref|YP_002228315.1| thioredoxin [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|205354599|ref|YP_002228400.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|205354694|ref|YP_002228495.1| hypothetical protein SG3728 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|205354695|ref|YP_002228496.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|205354785|ref|YP_002228586.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MAKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|205354806|ref|YP_002228607.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLIKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRVRKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IIREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPAAAFAGQISELENAGQTVVLVLRNETVLGVLALQDT
    LRDDARDAIRDLHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|205354852|ref|YP_002228653.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MKERFMEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAA
    QYLLQQGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|205354921|ref|YP_002228722.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLELPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|205355087|ref|YP_002228888.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MAQRIFTLILLLCSTYAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTSETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFNAQGQEQPQSRVTGFMDAATFSA
    HLHDRQP

    >gi|205355165|ref|YP_002228966.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|205355225|ref|YP_002229026.1| Thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MTMNYARELFFLRGILFSFFLPGCARPVIAQEWEFITPLVADAPAEVELFSFYCPPCYAFSQTMGVAQAIRHVLPHGDRM
    IKYHVNLLGPLGHELTRARALAMMMKETDVVEKAFFMADMVEKRLHSPDDVHRVFMSATGISRGEYDRSIKSPAVNDMVA
    LQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVEDFRSRYAAVVWKLLAGNPDAD

    >gi|205355229|ref|YP_002229030.1| hypothetical protein SG4330 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
    MMMDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGF
    YTRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQW
    LKPDGKLLVEVHTFDEVKRQGMAQPCWQR
    CPHGLFLAEPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRD
    DEYISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKAPPAEGITLSKRNNPMDIPRIFTISESEHRIHNPFTAEKY
    ATLGHALRMKPGTRILDLGSGSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYD
    VTACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRQIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMV
    LADPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIAR