Salmonella enterica serovar Enteritidis P125109 uid59247

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|207855543|ref|YP_002242194.1| hypothetical protein SEN0027 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQDGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|207855565|ref|YP_002242216.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|207855669|ref|YP_002242320.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|207855720|ref|YP_002242371.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|207855835|ref|YP_002242486.1| putative cation transport ATPase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYEARPIETAGQG
    EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
    ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
    VAHVLREGRIEDIPVDEVVLGDCVEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRA
    TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
    GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVASGFERREVLAKVAAVESRSEHP
    IARAIVVSAEEEGIALPGMNGFESVTGMGVYATVDGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
    AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
    INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWG
    ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTTRGGAS

    >gi|207855884|ref|YP_002242535.1| putative peroxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|207855977|ref|YP_002242628.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|207855983|ref|YP_002242634.1| thioredoxin-like protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNGEIGLLLAEAQIA
    LNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPQDAALATQLALQLHQVGRNEEALELLF
    SHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|207856037|ref|YP_002242688.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDQDIAQAITHILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|207856073|ref|YP_002242724.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|207856074|ref|YP_002242725.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|207856075|ref|YP_002242726.1| alkyl hydroperoxide reductase F52A protein subunit F [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAAEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|207856280|ref|YP_002242931.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MAELSDQEMLRYNRQIILRGFDFEGQETLKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|207856306|ref|YP_002242957.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|207856350|ref|YP_002243001.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|207856457|ref|YP_002243108.1| membrane protein, suppressor for copper-sensitivity B [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLSGVLTLSTCSNVCLLTDYPFSVTATVQNADFAHDY
    ARAMGKVPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
    RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNVWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|207856458|ref|YP_002243109.1| suppressor for copper-sensitivity C [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|207856459|ref|YP_002243110.1| suppressor for copper-sensitivity D [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MAAKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVNDAKGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|207856522|ref|YP_002243173.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGG
    CETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFAALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|207856686|ref|YP_002243337.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|207856724|ref|YP_002243375.1| hypothetical protein SEN1270 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|207856799|ref|YP_002243450.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MLKKGIFALALFVAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|207856803|ref|YP_002243454.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|207856818|ref|YP_002243469.1| putative thiol peroxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MAKRIQTLKGEVFMTPATTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPS
    LDTPV
    CEWQVKDYSNRLKSAGSHSNRAVYVLSMDTPFAQARFILEHDIHPGITFVSDYACRQFLDNSGLKINELSIFARA
    LIECDENNVVTRVIVPRDITHLPVY

    >gi|207856826|ref|YP_002243477.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLTDYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|207856942|ref|YP_002243593.1| osmotically inducible protein C [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|207857037|ref|YP_002243688.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|207857042|ref|YP_002243693.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|207857045|ref|YP_002243696.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAALEKKFQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|207857063|ref|YP_002243714.1| hypothetical protein SEN1614 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|207857125|ref|YP_002243776.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAEKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|207857148|ref|YP_002243799.1| hypothetical protein SEN1699 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDKLAQQLAIPASLFDATNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLAYGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVPEKYALWFEEVAARTGRLIAEWQTVGF
    SHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPLVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNALLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAVVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|207857152|ref|YP_002243803.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKITLAK

    >gi|207857194|ref|YP_002243845.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|207857208|ref|YP_002243859.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSTFKVRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFY
    QPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|207857327|ref|YP_002243978.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|207857336|ref|YP_002243987.1| hypothetical protein SEN1892 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPTFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|207857668|ref|YP_002244319.1| cytochrome c biogenesis protein CcmG [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|207857685|ref|YP_002244336.1| ADA regulatory protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAEQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKVSTGMTPKGWQQAWRARRLREALAKGEPITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDDALLAELHTLFPTARHEPADA
    SFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|207857893|ref|YP_002244544.1| hypothetical protein SEN2461 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|207857902|ref|YP_002244553.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|207857908|ref|YP_002244559.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|207857941|ref|YP_002244592.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|207857949|ref|YP_002244600.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|207858003|ref|YP_002244654.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCSPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|207858072|ref|YP_002244723.1| hypothetical protein SEN2648 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTTLRQPYYELSPEVYSALVQAKNALEKSTIDPTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVSH
    HFNEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLMNCFNRLAIGMRM

    >gi|207858074|ref|YP_002244725.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVIAGDLSWSGFRPDMINRLHPTPHAAN
    A

    >gi|207858306|ref|YP_002244957.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEK
    EMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGK
    GVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|207858451|ref|YP_002245102.1| disulfide isomerase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|207858452|ref|YP_002245103.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|207858693|ref|YP_002245344.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLELPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|207858764|ref|YP_002245415.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|207858814|ref|YP_002245465.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IIREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPAAAFAGQISELENAGQTVVLVLRNETVLGVLALQDT
    LRDDARDAIRDLHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|207858835|ref|YP_002245486.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|207858939|ref|YP_002245590.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|207858940|ref|YP_002245591.1| hypothetical protein SEN3525 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|207859038|ref|YP_002245689.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|207859127|ref|YP_002245778.1| thioredoxin [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|207859191|ref|YP_002245842.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|207859315|ref|YP_002245966.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|207859340|ref|YP_002245991.1| thiamine biosynthesis protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASHVLIVGLGGLGSPAALYLAGAGIGKLTLADDDDIHLSNLQRQILFTTDDIA
    RSKSQVARQRLTQLNPDIELVSLQRRLKGDALRHAVSRADVVLDCTDNMSTRQEINAACVALNTPLITASAVGFGGQLMV
    LMPPWEQGCYRCLWPDDVEPERN
    CRTAGVLGPVVGVMGTLQALEAIKLLSGIETPNGQLRLFDGKTSQWRSLALRRASGC
    PVCGGQHANSIQ

    >gi|207859472|ref|YP_002246123.1| thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTSETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFNAQGQEQPQSRVTGFMDAATFSA
    HLHDRQP

    >gi|207859555|ref|YP_002246206.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|207859622|ref|YP_002246273.1| Thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MTMNYARELFFLRGILFSFFLPGCARPVIAQEWEFITPLVADAPAEVELFSFYCPPCYAFSQTMGVAQAIRHVLPHGDRM
    IKYHVNLLGPLGHELTRARALAMMMKETDVVEKAFFMADMVEKRLHSPDDVHRVFMSATGISRGEYDRSIKSPAVNDMVA
    LQERLFKEYGVRGTPSVYVRGRYHINNAAFSAFSVEDFRSRYAAVVRKLLAGNPDAD

    >gi|207859627|ref|YP_002246278.1| hypothetical protein SEN4261 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
    MMMDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGF
    YTRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQW
    LKPDGKLLVEVHTFDEVKRQGMAQPCWQR
    CPHGLFLAEPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRD
    DEYISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKAPPAEGITLSKRNNPMDIPRIFTISESEHRIHNPFTAEKY
    ATLGHALRMKPGTRILDLGSGSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYD
    VAACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRQIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMV
    LADPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIAR