Salmonella enterica serovar Dublin CT 02021853 uid58917

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|198242816|ref|YP_002214003.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|198244895|ref|YP_002214108.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|198242974|ref|YP_002214164.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|198244172|ref|YP_002214305.1| copper-translocating P-type ATPase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYEARPIETAGQG
    EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
    ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
    VAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTVRA
    TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
    GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVASGFERREVLAKVAAVESRSEHP
    IARAIVVSAEEEGIALPGMNGFESVTGMGVYATVDGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
    AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
    INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWSFAYNTALIPVAAGALFPVWG
    ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTTRGGAS

    >gi|198243953|ref|YP_002214356.1| peroxiredoxin-2 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|198242788|ref|YP_002214454.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSQTIDLTLDGLSCGHCVKRVKECLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGA
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|198242491|ref|YP_002214460.1| thioredoxin domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAA
    QFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIG
    LLLAEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPQDAALATQLALQLHQVGR
    NEEALELLFSHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|198245052|ref|YP_002214565.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|198244227|ref|YP_002214600.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPRVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKTWHDYETSAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|198244619|ref|YP_002214601.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|198245508|ref|YP_002214810.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNTGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|198243502|ref|YP_002214837.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|198242483|ref|YP_002214882.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|198244938|ref|YP_002215045.1| membrane protein, suppressor for copper-sensitivity B [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMPEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLSGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDY
    ARAMGKVPLRSGLTDSLDVGYRPGELVVTATRAAGWSSPGLYLDTIDDVDFAKPRLRVEGDRLQATVPVTDSWGEKAPDL
    RNKSLTLVLADGAIAQESTQTIGAAPAQTPDNAALPFWQVVMMALIGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGIQFQNVWFIGFMALVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRIL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALWGDWTLPSDAITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|198244971|ref|YP_002215046.1| suppressor for copper-sensitivity C [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|198243663|ref|YP_002215047.1| suppressor for copper-sensitivity D [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVNDANGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|198242438|ref|YP_002215122.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIHLEGTPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFAALMLIIGWEKRFFRRAGLTPAKES
    V

    >gi|198241963|ref|YP_002215334.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|198242186|ref|YP_002215376.1| hypothetical protein SeD_A1554 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|198243060|ref|YP_002215458.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MLKKGIFALALFVAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|198245820|ref|YP_002215462.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|198244410|ref|YP_002215477.1| putative thiol peroxidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTPATTQDYISLGQEHAVTFGKTQLTLKPGILAEGEPLPCTKGLVSHNLLPGYCIPGIKKRIIVVPSLDTPVCEWQVKDY
    SNRLKSAGSHSNRAVYVLSMDTPFAQARFIREHDIHPGITFVSDYACRQFLDNSGLKINELSIFARALIECDENNVVTRV
    IVPRDITHLPVY

    >gi|198242298|ref|YP_002215486.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MLRLLEEKIATPLGPLWVVCDEQFRLRAIEWEQYRDSMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|198243578|ref|YP_002215583.1| peroxiredoxin OsmC [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|198246144|ref|YP_002215676.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|198245620|ref|YP_002215681.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLARLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|198243539|ref|YP_002215684.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|198245741|ref|YP_002215701.1| hypothetical protein SeD_A1910 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|198244881|ref|YP_002215758.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAEKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|198243364|ref|YP_002215781.1| hypothetical protein SeD_A2000 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDKLAQQLAIPASLFDATNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVAEKYALWFEEVAARTGRLIAEWQTVGF
    AHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNALLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDHYRA
    RLRTEAVDDALRQQQMQRVNPAIVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|198245225|ref|YP_002215785.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|198243320|ref|YP_002215829.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|198245259|ref|YP_002215844.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFYQPVSEEAIRY
    IDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|198242930|ref|YP_002215972.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI

    >gi|198243375|ref|YP_002215982.1| hypothetical protein SeD_A2217 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPTFDASNVGDYLKAADVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|198243828|ref|YP_002216319.1| thiol:disulfide interChange protein DsbE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|198243812|ref|YP_002216335.1| regulatory protein ada [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQQ
    RRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRAQRLREALAKGEQITSAIYRAGFPD
    SSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDDALLAELHTLFPAARHEPADAL
    FQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    C
    HRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|198242221|ref|YP_002216549.1| hypothetical protein SeD_A2848 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGHRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|198243671|ref|YP_002216558.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|198242154|ref|YP_002216564.1| arsenate reductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|198245272|ref|YP_002216596.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAVVRLTDV
    LLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|198243888|ref|YP_002216606.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|198242015|ref|YP_002216664.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|198244156|ref|YP_002216779.1| alkylhydroperoxidase AhpD family core domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MMTTLRQPYYELSPEVYSALVQAKNALEKSTLDLTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVS
    HHFSEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLMNCFNRLAIGMRM

    >gi|198242912|ref|YP_002216781.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDVSWSGFRPDMINRLHPTPHAAN
    A

    >gi|198242869|ref|YP_002217020.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|198241747|ref|YP_002217173.1| disulfide isomerase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|198244537|ref|YP_002217174.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|198243569|ref|YP_002217413.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLELPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|198242994|ref|YP_002217483.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|198242165|ref|YP_002217535.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSTPDTDGKKVPPFTSFRLAPAIQKADSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIATT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFEGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASGISEAELLALAAAVEQGATHPLAQA
    IVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPTAAFAGQISELENAGQTVVLVLRNETVVGVLALQDT
    LRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|198241838|ref|YP_002217557.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPSIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|198241846|ref|YP_002217664.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|198245197|ref|YP_002217665.1| rhodanese domain-containing protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|198243999|ref|YP_002217762.1| thiol:disulfide interChange protein DsbE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKRNVLLLPLLIFLLIAAALLWQLTRNAQGDDPTNLESALTGKPVPAFRLESLETPGQYYEAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|198242687|ref|YP_002217853.1| thioredoxin [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|198245828|ref|YP_002217919.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|198242526|ref|YP_002218054.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSNTMPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHS
    RLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPNDV
    DFSHPRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRH
    NEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYP
    SLASAAYDQGRIAAQALVKGEASAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTL
    KILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|198245874|ref|YP_002218078.1| thiazole biosynthesis adenylyltransferase ThiF [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASHVLIVGLGGLGSPAALYLAGAGIGKLTLADDDDIHLSNLQRQILFTTDDIA
    RSKSQVARQRLTQLNPDIELVSLQQRLKGDALRHAVSRADVVLDCTDNMSTRQEINAACVALNTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGVLGPVVGVMGTLQALEAIKLLSGIETPNGQLRLFDGKTSQWRSLALRRASGC
    PVCGGQHANSIQ

    >gi|198245746|ref|YP_002218212.1| thiol:disulfide interchange protein precursor [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTSETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFNAQGQEQPQSRVTGFMDAATFSA
    HLHDRQP

    >gi|198244283|ref|YP_002218290.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|198242184|ref|YP_002218362.1| hypothetical protein SeD_A4888 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MTMNYARELFFLRGILFSFFLPGCARPVIAQEWEFITPLVADAPAEVELFSFYCPPCYAFSQTMGVAQAIRHVLPHGDRM
    IKYHVNLLGPLGHELTRARALAMMMKETDVVEKAFFMADMVEKRLHSPDDVHRVFMSATGISRGEYDRSIKSPAVNDMVA
    LQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVEDFRSRYAAVVWKLLAGNPDAD

    >gi|198244990|ref|YP_002218368.1| putative SAM-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
    MDISAVIFATHHIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGFYT
    RLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADARSLISHCAQWLK
    PDGKLLVEVHTFDEIKRQGMAQPGWQR
    CPHGLFLAVPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDDE
    YISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKAPPAEGIALSKRNNPMDIPRIFTISESEHRIHNPFTAEKYAT
    LGHALRMKPGMRILDLGSSSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDVA
    ACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRQIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMVLA
    DPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIAR