Salmonella enterica serovar Choleraesuis SC B67 uid58017

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|60115534|ref|YP_209325.1| putative mercuric reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAIEVGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLD
    KMRDLLGRNDKTGSSGALHIAVIGSGGAAMAAALKAVEQGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNLIVQLNDGGERVVAFDRCLIATG
    ASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFR
    MEGIEVREHTQASQVAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDPGMRTSVEH
    IYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQVATVGYSEAEAHHDGIKTDSRTLTLDNVPRA
    LANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLS
    C
    CAG

    >gi|62178596|ref|YP_215013.1| hypothetical protein SC0026 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MYYHALKLSRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG

    >gi|62178613|ref|YP_215030.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    TAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|62178723|ref|YP_215140.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|62178774|ref|YP_215191.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MGENLSNYRCRLEQNMSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQ
    GVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|62179014|ref|YP_215431.1| putative thiol - alkyl hydroperoxide reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|62179109|ref|YP_215526.1| copper exporting ATPase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSHPKAKPLTESSIPS
    EALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGT
    EAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
    WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLF
    RASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEFSVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSS
    HPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKA
    AALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|62179115|ref|YP_215532.1| paral putative thioredoxin protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPT
    VYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIGLLLAEAQIA
    LNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVADNPQDAALATQLALQLHQVGRNEEALELLF
    SHLRKDLTAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|62179171|ref|YP_215588.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRD
    KNFHNLADLDNVDVIEGRAEFIDNHTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGGGDSTGLLSLSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANVQAVSSKEGAVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKR
    STRDRQNVPYSVFMTPPLSRVGLTEEQARASGATVQVVILPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDSH
    EMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|62179208|ref|YP_215625.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEVPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENL
    SNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPF
    CPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESP
    ATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQ
    LDAMMGQP

    >gi|62179209|ref|YP_215626.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|62179210|ref|YP_215627.1| alkyl hydroperoxide reductase, F52a subunit; detoxification of hydroperoxides [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEGGLHQIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|62179410|ref|YP_215827.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTVFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCKVCGQ

    >gi|62179436|ref|YP_215853.1| glutaredoxin 1 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|62179482|ref|YP_215899.1| thioredoxin reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEI
    IFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADA
    SK

    >gi|62179635|ref|YP_216052.1| hypothetical protein SC1065 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKYMIVLLLALFSTLSIAQETAPFTPDQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSILAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|62179636|ref|YP_216053.1| hypothetical protein SC1066 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MAGKLRRWLREAAVFLALLIAIMVVMDVWRAPQAPPAFAATPLHTLTGESTTLATLSEERPVLLYFWASWCGVCRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLARKGVDFPVVNDAKGALSAGWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|62179673|ref|YP_216090.1| hypothetical protein SC1103 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKLETFR
    QQLYTFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPSFDASNVGDYLKAADVNVMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGASCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEELALPEEEQRR
    RRAGRENGNKIFNKSRGRLNSKLSIPDPAE

    >gi|62179683|ref|YP_216100.1| glutaredoxin 2 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTG
    KRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQ
    PNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMDI

    >gi|62179859|ref|YP_216276.1| MFS family transporter [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTTALSPRGKQGALLIAGILMIATTLRVTFTGAAPLLETIRSDYGLSTAQTGLLTTLPLLAFALVSPLAAGIARRFGMER
    SLFAAMLLICAGIALRSLPSAALLFAGTAIIGCGIALGNVLLPGLIKHDFSQHVARLTGAYSLTMGAAAALGSALVVPLA
    LHGFGWRGALLMLMLFPLLAFLIWLPQWRTTRSANLSSSRALHERGIWRSPLAWQVTLFLGLNSLIYYVIIGWLPTILIS
    HGYSEAQAGSLHGLLQLATAAPGLAIPLILHRFNDQLWIAALVSLL
    CAVGAAGLWFVPGQAVIWTLLFGFGSGATMILGL
    TFIGLRASSAHQAAALSGMAQSVGYLLAACGPPVMGKLHDASGSWYLPLSGVTVLAIIMAIFGLYAGRDREIAS

    >gi|62179874|ref|YP_216291.1| methionine sulfoxide reductase B [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSTFKVRCEQMANQPSAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCGWPSFY
    QPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|62179889|ref|YP_216306.1| selenophosphate synthetase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
    CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQTSGGLLLAVTPDAEDDVKAT
    AAEFGIDLTAIGELVEARGGRAMVEIR

    >gi|62179930|ref|YP_216347.1| putative glutathione peroxidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVVLGFPCNQFMGQEPGSEEEIK
    TYCASTRGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVAPEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|62179934|ref|YP_216351.1| hypothetical protein SC1364 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDKLAQQLAIPASLFDVTNGAGVWGGETLLPGMSPVAQVCSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVASDTPVQ
    RETQETGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVPEKYVLWFEEVAARTGRLIAEWQTVGF
    SHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTHYGQRMRQKLGFFTEQKDDNVLLNELFSLMAREGSDYSRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRA
    RLRTEAVDDALRQQQMQRVNPAVVLRNWLAQRAIDAAEQGDMAELHWLHEVLRQPFTDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|62179959|ref|YP_216376.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MELHSDTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGMLGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFAP
    LQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|62180022|ref|YP_216439.1| hypothetical protein SC1452 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAE

    >gi|62180039|ref|YP_216456.1| glutathionine S-transferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVSSLARYHALEWLNYIATELHKGFTPLFRPDTPETLKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFT
    VLRWAYGVKLNMDGLTHIESYMQRVAKRPTVAAALKAEGLN

    >gi|62180042|ref|YP_216459.1| electron transport complex RsxE subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGGWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

    >gi|62180047|ref|YP_216464.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLIYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|62180134|ref|YP_216551.1| putative resistance protein, osmotically inducible [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVEAGFAITKIALQSKVAVADIDASTFDQIIQKAKAG
    CPVSQVLNAEITLDYQLNA

    >gi|62180225|ref|YP_216642.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MLRLLEEKIATPLGPLWVVCDEQFQLRAIEWEQYRDRMEQLLNIHYRHEGYERVSATNPGGLSDKLADYFAGNLAVIDTL
    ETATGGTPFQREVWQALRAIPCGQVMHYGQLAAQLGRPGAARAVGAANGANPISIVVP
    CHRVIGRNGTLTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|62180245|ref|YP_216662.1| thiol peroxidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYD
    AALNVLKA

    >gi|62180249|ref|YP_216666.1| thiosulfate:cyanide sulfurtransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MLKKGIFALALFIAMPLYAAEYWIDVRIPEQYQREHIQGAINIPLKEIKSHIETVVPDRNDTVKLYCNSGRQSGMAKQML
    LDMGYTHAMNMGGISRLDMPKVKK

    >gi|62180333|ref|YP_216750.1| hypothetical protein SC1763 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MQNIVIIANGAAYGSESLFNSLRLAIALREQESHLNLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGTLVELAQWTLAADKVLTF

    >gi|62180370|ref|YP_216787.1| disulfide bond formation protein B [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYS
    AWRGLQLAYEHTMIQLHPSPFMT
    CDFMARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAV
    VIAQAFKPKKRDLFGR

    >gi|62180539|ref|YP_216956.1| putative inner membrane protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MIGVVCALLVSHLLSSEAKHMSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
    EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMG
    CNLAAFFTG
    IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPK
    LGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
    GIVLAGG
    CETGWMYRAVEGQVHYWWVGFGNVIGSTILAYYWDDFAPALATSWDKVNLLNTFGPLGGLLVTYLLLFTALML
    IIGWEKRFFRRAGLTPAKESV

    >gi|62180823|ref|YP_217240.1| heme lyase disulfide oxidoreductase, cytocyhrome c-type biogenesis [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPVFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|62180839|ref|YP_217256.1| O6-methylguanine-DNA methyltransferase/transcription activator/repressor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MMKKALLTDDECWLRVQARDASADGRFVFAVRTTGVFCRPSCHSKRALRKNVRFFANAQQALDAGFRPCKRCQPDNARAQ
    QRRLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGEQITAAIYRAGFP
    DSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWVYGRCLVAESERGICAILPGDSDEALLAELHTLFPAARHAPADA
    PFQQRVRQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALCAIPCGETVSYQQLAATIGKPTAVRAVASACGANKLAMVIP
    CHRVVRRDGALSGYRWGVRRKAQLLKREAQKEE

    >gi|62181047|ref|YP_217464.1| hypothetical protein SC2477 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLPLLNTFIAELGWQPLLNTRGTTWRKLDEGHRSGITDADSVA
    ALMVEQPAIIKHPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|62181056|ref|YP_217473.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|62181062|ref|YP_217479.1| putative arsenate reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADAATVRELLRMLGMSSARELMRQKEDLYKTLHLADSQLSE
    EALIQALVEHPKLMERPIVVANGQARIGRPPEQVLDILG

    >gi|62181098|ref|YP_217515.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTTAFFVAADWLAEHIDDPEIQILDARMVPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMR
    ELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFTPQAVVRLTDV
    LLASHEKTAQIVDARPATRFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIAS
    CGS
    GVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|62181105|ref|YP_217522.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|62181224|ref|YP_217641.1| thioredoxin 2 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAEE
    RSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDSWLNEAL

    >gi|62181307|ref|YP_217724.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTTLRQPYYELSPEVYSALVQAKNALEKSTLDPTLMELIYLRVSQINGCAFCLEMHSKALRKAGVNQAKLDALAGWRVSH
    HFSEQECAALAWAESVTHIAETHAEDNVYLPLLDHFSAREISDLTFAIGLINCFNRLAIGMRM

    >gi|62181309|ref|YP_217726.1| glutaredoxin-like protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MEIRIMSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPT
    PHAANA

    >gi|62181553|ref|YP_217970.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKKRFMMFTLLAAAFSGVAHADDVAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYVLGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

    >gi|62181707|ref|YP_218124.1| putative thiol-disulfide isomerase and thioredoxin [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|62181708|ref|YP_218125.1| putative disulfide oxidoreductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPI
    VPDGVTLSSVQQWFVDLYQQSEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK

    >gi|62181955|ref|YP_218372.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MRYAIMVTGPAYGTQQASSALQFAHALLNEGHELASVFFYREGVYNANLLTSPASDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDETEAGRLALPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|62182026|ref|YP_218443.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRRFPADVANGA

    >gi|62182075|ref|YP_218492.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MSTPDTDGKKVPPFTSFRLAPAIQKTDSCCCEEHCASSAPVSTAVAGTRYTWKISGMDCAACARKVENAVRQIRGVNQAQ
    VLFATEKLVVDADADLRAQIERAVQKAGYTLRSEDSRDAAPESRLKENLPLITLIIMMAISWGLEQFNHPFGQLAFIVTT
    LVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARKGVSALMALKPETAT
    RLRDGVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALLVTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTIGKPRVTAIHPASDISEAELLALAAAVEQGATHPLAQA
    IVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQPTAAFAGQISELENAGQTVVLVLRNETVVGVLALQDT
    LRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFKAGLLPEDKVRAVTALNQQAPLAMVGDGINDAPAMKAAS
    IGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQNITIALGLKAIFLVTTLLGFTGLWLAILADTGATVL
    VTANALRLLRKN

    >gi|62182096|ref|YP_218513.1| glutathione reductase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPEIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKFQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVIFSHPPIGTVGLSEPQAREQYGDEQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|62182195|ref|YP_218612.1| glutaredoxin 3 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|62182196|ref|YP_218613.1| putative rhodanese-related sulfurtransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|62182305|ref|YP_218722.1| heme lyase disulfide oxidoreductase, cytocyhrome c-type biogenesis [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPVFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGLNYKDDRAKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNARVWESELKPLWDRYSREAAQ

    >gi|62182391|ref|YP_218808.1| thioredoxin [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MLAKLTSAPRWLMLHQHARLIPVELYMSDKIIHLTDDSFGTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKL
    TVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|62182460|ref|YP_218877.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKELTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|62182585|ref|YP_219002.1| soluble pyridine nucleotide transhydrogenase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MPHSWDYDAVVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNAHFIDEHTLALECHDGTVETLTAEKFVIACGSRPYHPSDVDFSH
    PRIYDSDSILSLHHEPRHVIIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALENIGLETDSRGQLKVNSMYQTALPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|62182613|ref|YP_219030.1| thiamine biosynthesis protein ThiF [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MNDRDFMRYSRQILLGDIAIEGQQKLLASHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDDVHLSNLQRQILFTTDDIA
    HPKAQAAKLRLAQLNPGSKLIVLQQRLTGDVLKNAVAHADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMV
    LTPPWEQGCYRCLWPDDVEPERN
    CRTAGIVGPVVGMMGTLQALEAIKLLSGIETPSGELRLFDGKTSQWRSLALRRASGC
    PVCGGRHANSVQ

    >gi|62182771|ref|YP_219188.1| thiol:disulfide interchange protein precursor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTVTYQGCADAGFCYPPETKTVPLSEVAAAIDATPTPAVTQTGETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQRLSTGRALLLAFIYVQGMALTYTALGLVAAAAGLQFQA
    ALQHPYVLIGLAIVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFLLERIIGEAWGLRLWSLLGVAF
    FGWAFITSLQARRAGMRIVQIILLAAALISVRPLQDWAFGSPSAQAPAHLNFTAISTVDELNQALAQAKGNPVMLDFYAD
    W
    CVACKEFEKYTFSDPRVQQALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|62182853|ref|YP_219270.1| methionine sulfoxide reductase A [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MNLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWENHDPTQGMQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSA
    MAAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPDA

    >gi|62182926|ref|YP_219343.1| putative SAM-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
    MMMDISAVIFATHHIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWITRQLPAGARILDLGCGPGF
    YTRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQDIRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQW
    LKPDGKLLVEVHTFDEVKRQGMAQPGWQR
    CPHGLFLAEPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRD
    DEYISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLAEKASTSEGIALSKRNNPMDIPRIFTISESEHRIHNPFTAEKY
    ATLGHALRMKPGMRILDLGSGSGEMLCTWARDYGVTGTGIDISPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYD
    VAACVGATWIAGGVAGTIDLLAKSLKPGGIILIGEPYWRQIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMV
    LADPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIAR