Salmonella enterica arizonae serovar 62 z4 z23 RSK2980 uid58191

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161502145|ref|YP_001569257.1| glutaredoxin-like protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MEIRIMSITIYTRNNCVQCHATKRAMESRGFEFEMVNVDLVPDAADTLRAQGFRQLPVVMAGDLSWSGFRPDMINRLHPA
    PHAASA

    >gi|161502248|ref|YP_001569360.1| thioredoxin 2 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATSETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFKDVAEE
    RSGKVRFVKVDTEAERELSARFGIRSIPTIMIFKHGQVVDMLNGAVPKAPFDNWLNEAL

    >gi|161502304|ref|YP_001569416.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFSNPNVKDECGCGESFHV

    >gi|161502312|ref|YP_001569424.1| 3-mercaptopyruvate sulfurtransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MEMPMTTAYFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDHASPLPHMMPRPEAFA
    VAMRELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGDEAHEEGEFEAKFTPQAVVR
    LTDVLLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVFEGELKTTDELNEVFFSHGVSFDRPIIA
    S
    CGSGVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA

    >gi|161502352|ref|YP_001569464.1| hypothetical protein SARI_00385 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MASQGELMTDTIKIYHNPRCSKSRDTLNLLKSNGVEPEVVLYLDTPADGATVRELLRMLGMSSARELMRQKEDLYKTLHL
    ADSQLSEEALIQALVEHPKLMERPIVVANGQARIGRPPEQVLEILG

    >gi|161502358|ref|YP_001569470.1| thioredoxin-dependent thiol peroxidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFNDFKTSNHHDVVLNWLKENA

    >gi|161502367|ref|YP_001569479.1| hypothetical protein SARI_00400 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MITLYGIKNCDTIKKARRWLEEHGIDYRFHDYRVDGIDLSLINTFIAELGWQPLLNTRGTTWRKLDEGDRSGITDADSAA
    ALMVEQPAIIKRPLLCAPGKPMLLGFSESRYQQFFDEV

    >gi|161502578|ref|YP_001569690.1| hypothetical protein SARI_00624 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKESMMKKALLTDDECWQRVQARDASADGCFVFAVRTTGIFCRPSCRSKRALRKNVRFFANAQQALDAGFRPCKRCQPDD
    ARAQRRQLDKIACACRLLEQETPVTLASLAQAVAMSPFHLHRLFKASTGMTPKGWQQAWRARRLREALAKGERVTAAIYR
    AGFPDSSSYYRHADQTLGMTAKQFRKGGDNVSVRYALTDWIYGRCLVAESERGICAILPGDSDDALLAELHTLFPAARHE
    PADVRFQQRVQQVVAAINTRDVLLSLPLDIQGTAFQQQVWQALRAIPCGETVSYQQLAARIGKPTAVRAVASACGANKLA
    MVIP
    CHRVVGRDGALSGYRWGVSRKAQLLKREAQKEE

    >gi|161502596|ref|YP_001569708.1| hypothetical protein SARI_00642 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKRNVLLLPLLIFLLIAAALLWQLARNAEGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNRLAAQGIRVVGLNYKDDREKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNDRVWESEIRPLWDKYSKEAGQ

    >gi|161502913|ref|YP_001570025.1| putative inner membrane protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSWQHFRKTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIHLEGTPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPIFRIPVKMQKVSAASPLTQKPAQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMVFGVGFGLLIERAQI
    CFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPALATNWEKVNLLSTFGPLGGLLVTYLLLFAALMLIIGWEKRFFRRAGLTLAKES
    A

    >gi|161503067|ref|YP_001570179.1| disulfide bond formation protein B [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MALTAFALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIWIYSAWRGLQLAYEHTMIQLH
    PSPFMT
    CDFVARFPDWLPLGKWLPQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIAQAFKPKKRDLFGR

    >gi|161503119|ref|YP_001570231.1| hypothetical protein SARI_01184 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MQNIVIIVNGAAYGSESLFNSLRLAIALREQESHLDLRLFLMSDAVTAGLRGQKPAEGYNIQQMLEILTAQNVPVKLCKT
    CADGRGITPLPLIDGVEIGSLVELAQWTLAADKVLTF

    >gi|161503231|ref|YP_001570343.1| thiol peroxidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSQTVHFQGNPVTVANVIPQAGNKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLATEVENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNNEFLKNYGVEITDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYA
    AALDVLKA

    >gi|161503255|ref|YP_001570367.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEQYHDRMEQLLDIHYRHEGYERISSTNPGGLSDKIADYFAGNLAVIDNL
    ETATGGTPFQREVWQALRTIPCGQVMHYGQLAERLGRPGAARAVGAANGTNPISIVVP
    CHRVIGRNGTMTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|161503334|ref|YP_001570447.1| hypothetical protein SARI_01407 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MIIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGAQGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDKVDTGFAITKIALQSKVAVPDIDASTFDQIIQKAKAG
    CPVSQVLKAEITLDYQLNA

    >gi|161503448|ref|YP_001570560.1| Na(+)-translocating NADH-quinone reductase subunit E [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLVYLRTLSFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|161503454|ref|YP_001570566.1| electron transport complex RsxE subunit [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALRRWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDG
    ADSLLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAVTAPSAVPAGETGKV

    >gi|161503474|ref|YP_001570586.1| hypothetical protein SARI_01548 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKTQEPDAG

    >gi|161503534|ref|YP_001570646.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MELHSGTFNPEDFPWQGLTLTPAAAAHIRELAAKQPGILGVRLSVKQTGCAGFGYVLDTVREPDKDDLVFEAEGAKLFVP
    LKAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV

    >gi|161503546|ref|YP_001570658.1| hypothetical protein SARI_01624 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTLSFTAHWRDELPATYTALLPTPLKNARLIWYNDKLAQQLAIPASLFDVTNGAGVWGGETLLPGMSPVAQVYSGHQFGV
    WAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDTPVQ
    RETQEAGAMLMRLAQSHMRFGHFEHFYYRREPEKVQQLADFAIRHYWPQWQDAPEKYDLWFEEVAARTGRLIADWQTIGF
    AHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLAQTLTPFIEIDALNRALDRYQ
    DALLTRYGQRMRQKLGFFTEQKDDNVLLNELFSLMAREGSDYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDGWFDRYRA
    RLRTEAVDDALRQQQMQSVNPAVVLRNWLAQRAIDAAEQGDMAELHRLHEILRQPFIDRDDDYASRPPEWGKRLEVS
    CSS


    >gi|161503550|ref|YP_001570662.1| putative glutathione peroxidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MQNSLLNTHVTTIDGEATTLEKYAGKVLLIVNVASRCGLTSQYEQLENIHKAWADRGFVVLGFPCNQFMGQEPGSEEEIK
    TYCANTWGVTFPMFSKIDVNGEARHPLYQKLIAAAPTAVAPDKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQ
    RFSPDMTPEDPIVMESIKIALAK

    >gi|161503603|ref|YP_001570715.1| selenophosphate synthetase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSMSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVDNPF
    DFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIAREVTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVP
    TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLS
    EMCQGAGVQALLRYQDIPKLPGVEEYIALGAVPGGTDRNFASYGHLMSDMPREVRSLLCDPQTSGGLLLAVTPDAEDKVK
    ATAAEFGIDLTAIGELVDARGGRAMVEIH

    >gi|161503609|ref|YP_001570721.1| methionine sulfoxide reductase B [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MANQLSAEELKKKLSEMQFYVTQNRGTEPPFTGRLLHNKRDGVYHCLVCEAPLFHSHTKYDSGCGWPSFYQPVSKEAIRY
    IDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLAFSDEKNGDQLKG

    >gi|161503757|ref|YP_001570869.1| hypothetical protein SARI_01842 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MPVLHNRISNDELKARMLAESEPRTTISFYKYFTIVSPQQTRDALYQMFTALGIFGRVYLAHEGINAQISVPQSKVETFR
    QQLYAFDPALDGLRLNIALEDDGKSFWVLRMKVRDRIVADGIDDPSFDASNVGAYLKAAEVNAMLDDPDAIFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGL
    PVRFIGKNFVFDERMGERISDEVIAHCHQCGALCDSHTNCKNAGCHLLFIQCPLCASKFNGCCSEQCCEELALPEDEQRR
    RRAGREKGNKIFNKSRGRLNSKLGIPDPTE

    >gi|161503797|ref|YP_001570909.1| hypothetical protein SARI_01884 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MAGKLRRWLREAAVFLALLIAIIVVMDVWRAPQAPPAFAATPLRTLTGESTTLATLSEERPVLLYFWASWCGICRFTTPA
    VARLAAEGENVMTVALRSGDDAEVARWLTRKGVDFPVVNDANGALSARWEISVTPTLVVVSQGRVVFTTSGWTSYWGMKL
    RLWWAKTF

    >gi|161503798|ref|YP_001570910.1| hypothetical protein SARI_01885 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKYMIVLLLALFSTLSIAQETAPFTPEQEKQIENLIHTALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIV
    QKYPDVAVIIKPLPFKGESSILAARIALTTWREHPQQFLALHEKLMQKRGYHTDDSIKQAQQKAGATPVTLDEKSMETIR
    TNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLAAANGG

    >gi|161503799|ref|YP_001570911.1| hypothetical protein SARI_01886 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MMILFRRILFCLLWLWLPVSWAAESGWLRSPDNDHASIRLRADTSANGETRLLLDVKLENGWKTYWRAPGEGGVAPSIAW
    KGDMLEVSWFWPTPSRFDVANITTQGYHDEVTFPMIVRGTPPATLNGVLTLSTCSNVCLLTDYPFSVTPTVQNADFAHDY
    ARAMGKVPLRSGLTDSLEVGYRTGELVVTATRAAGWSSPGLYLDTIDDVDFGKPRLRIEGDRLQATVPVTDSWGEKAPDL
    RDKSLTLVLADGAIAQESTQTIGAASALTPDNAALPFWQVVLMALVGGLILNLMPCVLPVLGMKLGSILLVEEKSRSHIR
    RQFLASVAGIIASFMALAAFMTLLRLSNHALAWGVQFQNVWFIGFMTLVMLLFSASLFGLFEFRLPSSMTTKLATYGGNG
    MSGHFWQGAFATLLATPCSAPFLGTAVAVALTASLPTLWGLFLALGLGMSAPWLLVAIRPGLALRLPRPGRWMNVLRRFL
    GLMMLGSAIWLATLLLPHFGFTASKSAQDTVQWQPLSEQAIQSALAQHKRVFVDVTADW
    CITCKVNKYNVLQKEDVQAAL
    QQPDVVALRGDWTLPSDDITDFLKTRGQVAVPFNQVYGPGLPEGEALPTLLTRDAVLQTLKKAKGITQ

    >gi|161503916|ref|YP_001571028.1| thioredoxin reductase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAEKFATEI
    IFDHINSVDLQNRPFRLKGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIVLHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGL
    FVAIGHSPNTAIFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDSLADT
    SE

    >gi|161503966|ref|YP_001571078.1| glutaredoxin 1 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MFTVIFGRPGCPYCVRAKELAEKLSNERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLNLFA

    >gi|161503985|ref|YP_001571097.1| molybdopterin biosynthesis protein MoeB [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDA
    TVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQ
    VTAFTYRENEPCYRCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|161504220|ref|YP_001571332.1| hypothetical protein SARI_02327 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MLDMNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNSRIKHTAIDGGTFQ
    NEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAASEDGLHKIETASGAVLKARSIII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVVGLEYLDRVSGDIHSVALAGIFVQIGLLPNTNWLEGALERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA

    >gi|161504221|ref|YP_001571333.1| alkyl hydroperoxide reductase subunit C [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAA
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|161504222|ref|YP_001571334.1| disulfide isomerase/thiol-disulfide oxidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSVIGIIINTLFALILKGKNMIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYL
    TPDGKHAVSGYMYNEKGENLSNALIEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYIFADPF
    CPYCKQFWQQARPWV
    ESGKVQLRTLLVGVIKPESPATAAAILAAKDPAKTWHDYEASAGKMKLKVPASISPAQMKVINQNQQLMDDLGANATPAI
    YYMNKDNTLQQVVGLPEKAQLDAMMGQP

    >gi|161504268|ref|YP_001571380.1| pyridine nucleotide-disulfide oxidoreductase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCINIGCIPTKTLVHDAEREGDFSAAMQRKAAVVGFLRD
    KNFHNLADLDNVDVIEGRAEFVDNQTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSMSQRPAR
    LGILGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAIARILQEKGVELMLNASVQAVSSQEGVVQVETPEGA
    HLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLRTTAENIWAMGDVTGGLQFTYISLDDFRIVRDGLLGEGKR
    STRDRQNVPYSVFMTPPLSRIGLTEEQARASGATVQVATLPVAAIPRARVMDDTRGVLKAVVDVNTQRILGVSLLCVDSH
    ETINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK

    >gi|161504321|ref|YP_001571433.1| hypothetical protein SARI_02429 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTQTKESDAMSVQNIVNINESNLQQTLEQSRTTPVLFYFWSERSQHCLQLTPVLESLVAQYNGQFILAKLDCDAEQMIAA
    QFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRDLLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSHQNSEIG
    LLLAETHIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQVAENPQDAALATQLALQLHQVGR
    NEEALELLFSHLRKDLAAAEGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|161504327|ref|YP_001571439.1| copper exporting ATPase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTNHKGVFTMSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAGYGATLSYPKAK
    PLTESSIPSEALAAVPHELPVATADEESQQLLLSGMS
    CASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQ
    AVEKAGYGAEAIEDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGVITLAVMVF
    AGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSK
    ALEKLLDLTPPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGT
    VVQDGSVLFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAIFVPVVVAIALISAAIWYFFGPAPQIVYTLVIAT
    TVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAVKTFNGVDEAQALRL
    AAALEQGSSHPLAHAILEKAGDNKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVASDDMTAEITAQASQGSTP
    VLLAIDGKAAALLAVRDPLRNDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQG
    RQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVA
    AGILWPFTGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKA

    >gi|161504412|ref|YP_001571524.1| hypothetical protein SARI_02523 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MVLVTRQAPDFTAAAVLGNGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL

    >gi|161504678|ref|YP_001571790.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|161504716|ref|YP_001571828.1| dihydrolipoamide dehydrogenase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVFTKRIGKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|161504821|ref|YP_001571933.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEDK
    LSFMTQTTLSVDDTSDVIDALRSRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGR
    RAFLIDDAADIQEAWVKEAVCVGVTAGASAPDILVQNVIARLREFGGGEAVTLEGREENIVFEVPKELRVDVREVE

    >gi|161504840|ref|YP_001571952.1| hypothetical protein SARI_02964 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MYYHALKLSRLAMLTLASVAVSGAAIAADSVPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIA
    QQQAYVQLALQYRAELLSSNSPSVGPADAKAAVVMFFDYQ
    CSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGL
    AARVGEQVWLTQGGEKYLAWHNALYATGKVEGALTEQDVYTLAQHYLTPKQLAVVKEAQSRGAVHDALLTNQALAQHMDF
    SGTPAFVVMPQTQNGDVKRVAVIPGSTTQDMLQMAIQKAKG

    >gi|161505088|ref|YP_001572200.1| methionine sulfoxide reductase A [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSLFDKKHLVTQADALPGRNTPMPIATLHAVNEHSMTNVPAGMEIAYFAMGCFWGVERLFWQLPGVYSTAAGYAGGYTPN
    PTYREVCSGQTGHAEAVRVVYDPAVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQSTAAHASRERFQSA
    MADAGDERPITTEIAHATPFYYAEDEHQQYLHKNPYGYCGVGGIGVCLPPDA

    >gi|161505172|ref|YP_001572284.1| thiol:disulfide interchange protein precursor [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MAQRIFTLILLLCSTSAFAGLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQLP
    AGVWHEDEFYGKSEIYRKQLNVPVTVSQATAGATLTVTYQGCADAGFCYPPETKTVPLSEVAAATDTTPAPAVPQANETS
    KPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGRQCLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQA
    ALQHPYVLIGLAVVFTLLALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIA
    QSGNMWLGGGILYLYALGMGLPLILVTVFGNRLLPKSGPWMSHVKTAFGFVILALPVFLLERIIGDVWGLRLWSLLGVAF
    FSWGFITSLQATRAWMRIVQIILLAAALVSVRPLQDWAFGSPSAQTQAHLNFTAISTVDELNQALAQAKGKPVMLDFYAD
    W
    CVACKEFEKYTFSDLRVQQALDNTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFSA
    HLHDRQP

    >gi|161505351|ref|YP_001572463.1| thiamine biosynthesis protein ThiF [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MNDRDFMRYSRQILLSDIAIEGQQKLLDSHVLIVGLGGLGSPAALYLAGAGVGTLTLADDDDVHLSNLQRQILFTTDDIA
    RPKAQAAKLRLARLNPDSKLIVLKQRLAGDALKNAVARADIVLDCTDNVATRQEINAACVALNTPLITASAVGFGGQLMV
    LTPPWAQGCYRCLWPDDGEPERN
    CRTAGIVGPVVGVMGALQALEAIKLLSGMETPSDELRLFDGKTSQWRNLALHRASDC
    PVCGGQHADSV

    >gi|161505502|ref|YP_001572614.1| periplasmic protein disulfide isomerase I [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKKIWLALAGMVLAFSASAAQISDGKQYITLDKPVAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVKKKLPEGTKMTKYHV
    EFLGPLGKDLTQAWAVAMALGVEDKVTVPLFEAVQKTQTVQSAADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    SDLQLQGVPAMFVNGKYQINPQGMDTSSMDVFVQQYADTVKYLVDKK

    >gi|161505567|ref|YP_001572679.1| thioredoxin [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MLHQHARLIPVELYMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPG
    TAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|161505655|ref|YP_001572767.1| hypothetical protein SARI_03831 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKRNVLLLPLLIFLLIAAALLWQLARNAEGDDPTNLESALTGKPVPAFRLESLETPGQYYQAEVLTQGKPVLLNVWATWC
    PTCRAEHQYLNRLAAQGIRVVGLNYKDDREKAVAWLKELGNPYALSLSDSDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNARVWESELKPLWDKYSREAAQ

    >gi|161505762|ref|YP_001572874.1| hypothetical protein SARI_03938 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MQEIMQFVGRHPILSIAWIALLVAVLFTTFKGLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGATNLLPSE
    IKANNVGELEKHKDKPIIVVDGSGMQ
    CQESANALTKAGFEKVFVLKEGVAGWSGENLPLVRGK

    >gi|161505763|ref|YP_001572875.1| glutaredoxin 3 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP
    LLR

    >gi|161505862|ref|YP_001572974.1| glutathione reductase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKIMWHAAQIREAIHLYGPDYGFDATINQFD
    WSKLIASRTAYIDRIHTSYDNVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPGIPGVEYGIDSDGF
    FALSALPERVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTHAVPKAVVKNADG
    SLTLELEDGRTENVDCLIWAIGREPSTDNINLAAAGVKTNEKGYIIVDKLQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEYLDYSNIPTVVFSHPPIGTVGLSEPQAREQYGNEQVKVYQSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTASEEFVTMR

    >gi|161505881|ref|YP_001572993.1| zinc/cadmium/mercury/lead-transporting ATPase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MAGTRYIWKIAGMDCAACARKVENAVRQIRGVNQAQVLFATEKLVVDADVDLRAQIERAVQKAGYTLHSEDSRDAAPESR
    LKENLPLITLIIMIAISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLMKSGSWFAIETLMSVAAIGALFIGATAEAA
    MVLLLFLIGERLEGWAASRARKGVSALMALKPETATRLRHDVREEVAINTLRPGDIIEVAAGGRLPADGKLVSGFASFDE
    SALTGESIPVERATGDKVPAGATSVDRLVTLEVLSEPGASAIDRILTLIEEAEERRAPIERFIDRFSRIYTPVIMVIALL
    VTLIPPLMFDGGWQEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKGGAALEQLGRITQVAFDKTGTLTVG
    KPRVTAIHPASGVGDAELLALAAAVEQGATHPLAQAIVREAQTRDLAIPTAESQRTLAGTGIEAQVNGERILICAAGKQP
    AAAFAGQISELENAGQTVVMVLRNETVLGILALQDTLRDDARDAIRELHQLGVNGVILTGDNPRAAAAIAGELDLAFNAG
    LLPEDKVQAVTVLNQQAPLAMVGDGINDAPAMKAASIGIAMGSGTDVALETADAALTHNRLRGLAQMITLARATHANIRQ
    NITIALGLKAIFLVTTLLGFTGLWLAILADTGATVLVTANALRLLRKK

    >gi|161505915|ref|YP_001573027.1| thiosulfate sulfurtransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREYDFDTAVMVMCYHGNSSKGAAQYLLQ
    QGYDAVYSIDGGFEAWHRHFPADVANGA

    >gi|161505994|ref|YP_001573106.1| sulfur transfer complex subunit TusD [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MRYAIMVTGPAYGAQQASSALQFAHALLNEGHELISVFFYREGVYNANLLTSPAGDEYDLVRAWQKLNTQHGVALNICVA
    AALRRGIIDDTEADRLGLPSANLQPGFTLSGLGALAEASLTCDRVVQF

    >gi|161506240|ref|YP_001573352.1| putative disulfide oxidoreductase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAVAMGGLIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGVIAAINP
    KNIVLKLIGCVAAFYGSIMGIKFSIKLNGIHYAVHNPDPDSLFGVQG
    CSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPV
    VPDGVTLSNVQQWFVDLYQHSEGWYLLPPLHFMNMAQACLLAFGVCLILLLVMSGAWVIKLSRGKTLA

    >gi|161506241|ref|YP_001573353.1| hypothetical protein SARI_04435 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MSSKWITSLFKSVVLTAALVTPFAASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTF
    TPFHLETKGEYGKQASEVFAVLIAKDKATGISLFDAKSQFKKAKFAYYAAYHDKKERWSDGKDPTSFIKTGLDAAGMSQA
    DFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK

    >gi|161506409|ref|YP_001573521.1| thiol:disulfide interchange protein DsbC [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
    MKKRFMMFTLLAAAFSGMAHADDAAIRQSLAKLGVQGTEIQASPVAGMKTVLTNSGVLYVTDDGKHIIQGPMYDVSGTHP
    VNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSI
    W
    CAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIILSNGYVVPGYQGPKEMKAFLDEHQKQTSGK