Salinispora tropica CNB 440 uid58565

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145592586|ref|YP_001156883.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
    MEIEVYADLVCPWCYLGKRRLERALASYDGAVTVSYRPFQLDPAPVPEPLPLLDALGVKFGGRERARQMADQVTRAAAGD
    GIDFDFDRALAANTFDAHRLVAWATERDRAAETVEALHRAHFHDGVDIGSRPALATIAGKVGLDAAAAHALLESNGQVAE
    VHTRLAAARELGITSVPTFVLAGRYAVTGAQDSPTLLAALTEARRHVATEV

    >gi|145592666|ref|YP_001156963.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MATAPRVRAPELKGRRWLNTGGRHLDLADLRGRITVLDFWTFCCINCLHVLDELRPIEQKYADVLVVIGVHSPKFEHEKD
    PDALADAVERYGVHHPVLDDPELNMWQQYAARAWPTLAVIDPEGYVVATMAGEGHAEGLVRLVDDLIATHEAKGTLRRGD
    GPYVPPAEPETTLRFPGKSVVLDNGNLLVSDSARHSLAELAPDGETLLRRIGTGARGRADGTATAATFAEPQGLCLLPAQ
    VSRLVGYDLVVADTVNHLLRGVRLATGEVVTVAGTGRQWRSTVDDHAHDALSVDLSSPWDLAWYDDRLVIAMAGIHQLWW
    FDPVKRTTGMYAGSTVEARKDGPLAEAWLAQPSGLSVSADGSRLWVADSETSAVRYVENGILTTAVGQGLFEFGHVDGPA
    AQALLQHPLGVCALPDGSVLIADTYNGAVRRYDPESDSVGTVADGLAEPSDLLLTPDGGVLVVESAAHRLTRLAPGALTA
    AGASTVNGPRHRTERKPTELRAGAVTLEVIFTPAPGQKLDDSYGPSTRLVVSASPPELLLSGAGTSTELSRELVISDSVP
    EGVLQVTAQAATCDADVAHAACHLTRQDWGVPIWVVDDAADRLPLVLRGMDA

    >gi|145592739|ref|YP_001157036.1| DSBA oxidoreductase [Salinispora tropica CNB-440]
    MTRNTRLTLAAVVALILVMVGVLAMNRRDAIPSAKTTGGAVEPAVLVREDSHRLTSAPDGRVTLVEFLDFECGPCAAAYP
    TVKEILADYEGQITFVVRYFPISSHPNAELAARAAESAANQDRFAEMYQLLFENQNAWSRQDEPQTEVFLGYARTLGLDI
    DRFQRDLDDPATAARVAKDRTDGEAVGVQGTPTFFLNGEPLSDLRKDDLTTMIDAALAG

    >gi|145592862|ref|YP_001157159.1| rhodanese domain-containing protein [Salinispora tropica CNB-440]
    MHHRLPRAGSPSILTRSDLMSRDSALVSADWAEKNLNTPGVVFVEVDEDTSAYDTGHLPGAIKLDWKTDLQDQVRRDFVN
    KDQFAALLSERGIANGDTVVLYGGNNNWFAAYAYWYFALYGHGDVRLLDGGRKKWELDARPLTTEAVSRPATQYVAQEPD
    HTIRAFRDEVVAAIGTKNLVDVRSPDEYAGRLLAPAHLPQEQAQRAGHVPTAISVPWSKAANEDGTFKSDQELREIYAAA
    GLDDSRETIAY
    CRIGERSSHTWFVLQELLGHRNVKNYDGSWTEYGSLVGVPVTLGDEPGKE

    >gi|145592875|ref|YP_001157172.1| peroxiredoxins-like protein [Salinispora tropica CNB-440]
    MLAPVGRTLVVKVTAGADAPERCAQAFTIAATAAAAGVDVSLWLTGEATWFALPGRAQEFELPHAAPLGELLHVILTTGR
    LTA
    CTQCAARRDIGPGDVLPGIRIAGSAVFLEEIMAEEARALVY

    >gi|145592917|ref|YP_001157214.1| glutaredoxin 2 [Salinispora tropica CNB-440]
    MREPRLTLITRPGCHLCEDAKAALERVVSVTNDRWVEKDVTDDVELEREYGDRLPVVLLDGKEHGYWRVEEERLLRDLTI
    PQL

    >gi|145592949|ref|YP_001157246.1| molybdopterin biosynthesis-like protein MoeZ [Salinispora tropica CNB-440]
    MSLPPLVEPAAELTVDEIRRYSRHLIIPDVGVEGQKRLKNARVLCVGAGGLGSPALMYLAAAGVGTLGIVDFDTVDESNL
    QRQIIHGVSDVGRAKAESASASIREINPLVEVKIHNTALDRDNVKEIFAQYDLIVDGTDNFATRYLVNDAAVLLGKPYVW
    GSIYRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLLAGVGESLVGRLMVYDALE
    MSYRKIKVRKDPNCALCGENPTVTDLLADYEDFCGAVSTEAQEAVVDATVTAGELKAWQDAGKEIFLVDVREPAEFEIVR
    IPGSTLIPKGDIVSGHALGKLPQDRQIVLH
    CKSGVRSAEALAALKAAGFRDAVHLQGGVLSWIRQVDPSLPAY

    >gi|145593012|ref|YP_001157309.1| heavy metal transport/detoxification protein [Salinispora tropica CNB-440]
    MVTTTYQVRGMTCGHCVNAVSAEVGGLTGVEKVQVDLEAGRLTVTSQHPMEIEAVRAAVDEAGYDLVDAAPTSRPRPA

    >gi|145593014|ref|YP_001157311.1| heavy metal translocating P-type ATPase [Salinispora tropica CNB-440]
    MTTTSSPKPRAVNQIELSIGGMTCASCAARIEKKLNRMPGVTATVNYATEKARVAYADGVTSDDLIATVEKTGYTAVVPP
    PPAATAAPVAEPADESRGLGTRLWVSAVLTVPVILLAMVPPWQFTYWQWLSLTLAAPVVVWGGLPFHRAAWVNLRHGAAT
    MDTLVSLGTLAAFGWSLWALFLGTAGVAGMTHPFSFAIVRGTGAGNIYLEAAAGVTTFILAGRYFEARAKRTAGAALRTL
    LELGAKEVAVLRGDVETRIPIDQLVVGDRFVVRPGEKVATDGMVVEGSSAVDASMLTGEAVPVEVKAGDAVVGATVNAGG
    RLVVAATRVGGDTQLAQMARLVEAAQSGKAAVQRLADRVSGVFVPVVITLAAGTLGWWLGSGAGPTAAFTAAVAVLIIAC
    PCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRTVDTVVLDKTGTVTTGRMTLVDVVAASGVERAELLRLAGALEAA
    SEHPIAQAVAVGAAEAGPLPPVADFANLEGLGVEGVVDGHRVLVGRPRLLRERGLHVPEEMVTAGATAQAAGATAVLVAW
    DGRARGLLAVADVVRPTSALALRQLRELGLDPVLLTGDNETVARAVAAEVGIDEVVAEVLPAEKVAVVQRLQREGRVVAM
    VGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLTAAVDAIRLSRRTLAIIKGNLFWAFAYNVAALPLAAAGLL
    NPMIAGAAMAFSSVFVVVNSLRLRGFRPLAPVTQGLRSTGHPR

    >gi|145593144|ref|YP_001157441.1| selenide, water dikinase [Salinispora tropica CNB-440]
    MVAVAEEMLRLTRYARGGGCACKIPPGELEASLGGLLSPLTAPAHELLVGLETGDDAAAVRLSGETAIIVTTDFFTPVVD
    DPYDWGRIAAANALSDIYAMGGDPILAVNLLAWPRDLLPMSIASEVLRGGYDIACAAGCHLAGGHSIDDAEPKYGMAVTG
    IGDARRLLRNDAGRAGMPLSLTKPLGVGVLNSRHKATGEVFPAAVATMTALNRDASHAALRAGVTCATDVTGFGLLGHLH
    KLARASGVTAVVDAAAVPYLDGAREAVRDGFVSGGSHRNLDWVQPHTRWGAGVTDSERLLLADAQTSGGMLIAGEIPGAT
    VIGELVPADGEHTLVVG

    >gi|145593288|ref|YP_001157585.1| thioredoxin [Salinispora tropica CNB-440]
    MATVELTMANFDEVTGGDGIVLVDFWADWCGPCKRFAPVYERSSEKHPDIVFGKVDTEAQQELGAKFDIRSIPTIMAIRD
    GVIVFAQPGALPESALENLIEQVEALDMDDVRKKLAEHPN

    >gi|145593318|ref|YP_001157615.1| methyltransferase type 11 [Salinispora tropica CNB-440]
    MTTTTGYMFDNSTDEAARQLRFLGEILDSGTRRILTEIGLRPGWKVTDLGAGAGTLTSWLADQVGPGGHVTAVDLDPRYI
    PAGANVTVRAGDIRTMELDGSQQAVVARLVLMHLPEREQVLAQLVHALAPGGAIVVEDWDCTWRDMIRRSPSPRATQLVE
    QFQE
    CLQSFGESRGADMGWAKRAQEAMLRLGLMDVESRIESRSWYGGTGICLLHRSNSIQREPQLLEAGMTHEDLAELRQ
    VLMDPELVLSGYLMHSTVGRRPSPA

    >gi|145593395|ref|YP_001157692.1| flavoprotein disulfide reductase [Salinispora tropica CNB-440]
    MSRIVIIGGGPAGYEAALVAAQLDADVTVVEADGAGGACVLSDCVPSKTFIASSQVVTGYRDTEEFGVHSDGLEAVTVDA
    PAVHTRVKRLALAQSADIHAKLVKAGVTFVAGSARLGEDTLGHTHRVIVTPTDGGAEYRIDAATVLIATGATPRQLPTAI
    PDGERILTWRQVYDLHELPRHLVVVGSGVTGAEFASAYLAMGIEVTLVSSRDRVMPHEDADAAMAIERVFRSRGMSILNN
    SRANAVRRITDGVEVELSDGRRVHGSHALIAVGSIPNTAELGLAEYGVGLARGGYVAVDRVSRTNVPGIYAAGDCTGMLP
    LASVAAMQGRIAMWHALGEAVRPLRLRTVAANVFTDPELATVGVSQDEVDAGKVPARQVMLPLAGNARAKMDEVPDGFVK
    LFCRPASGQVIGGVVVAPKASELILPITMAVENHLTVNELAQTITIYPSLSGSVTEAARQLMLHEPE

    >gi|145593476|ref|YP_001157773.1| peptide methionine sulfoxide reductase [Salinispora tropica CNB-440]
    MFLRRTKAQLISPEEALPGRPVATPVTEPHEVLGTPLTGPFPEGTAVAVFGMGCFWGAERLFWTLPGVLTTSVGYAGGYT
    PNPSYDEVCSGRTGHAEVVHVRYDPTKITYEDLLKVFWENHDPTQGMRQGNDVGTQYRSAIYPTTDEQLTTARASRDAFA
    PVVARAGKGEITTEISPLGDYYLAEGYHQQYLAPTKNPGGYCNHGPNGLSCPVGVARTTD

    >gi|145593487|ref|YP_001157784.1| hypothetical protein Strop_0929 [Salinispora tropica CNB-440]
    MNRLAGATSPYLIQHKDNPVDWWPWCAEAFAEAHRRDVPIMISVGYAACHWCHVMAHESFADEQVAALLNEGFVAIKVDR
    EERPDVDAVYMTATQAMTGQGGWPMTVFAAPDGTPFFCGTYFPKPNFLRLLQSVTTAWQDQRSAVLQQGAAVVEAIGGAQ
    AVGGPSAPLTVDLLDAAADRLGEEYDEANGGFGGAPKFPPHLNLLFLLRRYQRTGDQRSLEIVRHTAEAMARGGLHDQLA
    GGFARYCVDGQWAVPHFEKMLYDNALLLRVYTHLWRLTGDPMARRVARDTARFLADELHRPGEGFASALDADADGVEGLT
    YVWTPAQLVEALGEEDGRWAADLFAVTEQGSFTPHAASPPGEARSGAEAAAQSASVLRLARDVDDATPEVQARWQEIAHR
    LLVVRDARPQPARDDKVVAAWNGLAITAIAEFQQVAAGYAEDAPGPDANLMEGVTIVADGAMRDAAEHLARVHLVAGRLR
    RTSRDGRVGEAAGVLEDYGCVAEAFCAMHQLTGEGRWLILAGQLLDVALERFAAPQGSFYDTADDAERLVSRPADPTDNA
    TPSGRSAIVAALVAYAALTGETRYREAAEAALATVAPIVAAHARFTGYAATAGEALLVGPYEIAVVTADPVGEPLVHAAH
    RHAPPGAVVVAGRPDQPGVPLLAGRQMVDGQATAYVCRGFVCDRPVTGVDALVAQLTGR

    >gi|145593667|ref|YP_001157964.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MTAPARLSPGDTAPDFTLPTDSGDQLALADLRGRKVLLYAYPAAMTPGCTKQACDFRDSLASLQAAGYEVVGISPDKPEK
    LATFRERDAITFPLVSDTDRAVLTAYGAYGEKQSYGKTVTGVIRSTFVIDADGRIEQAFYNVRATGHVAKLRRDLGLD

    >gi|145594007|ref|YP_001158304.1| rhodanese domain-containing protein [Salinispora tropica CNB-440]
    MSATESLLVEVDQLAAEMHGDDPPTLLDVRWRLTGPPGRDDYAAGHLPGAVFVDLDTELCGPPGAAGRHPLPDPAILQAA
    LRAAGVRAGHPVVVYDGGDGMSAARAWWTLRWAGHRQVRLLHGGHSTWVAAGLPTSTELPTPRPGDVEVRTGSLPVLVAA
    EAARLAAAEEGTLVDVRAAPRFRGETEPVDPVAGHVPGAVNLPAPEYVTEGRFPTADVLRERFAAAGVEAAEPIGVY
    CGS
    GVTAAQAVVALHLAGRPDVALYVGSWSNWVADPSRPVAVAQKPGAAPA

    >gi|145594086|ref|YP_001158383.1| redoxin domain-containing protein [Salinispora tropica CNB-440]
    MPTSTRLIPIALTIVLALAACGNSGDESANADPTPAPTTASTSAPASTAASPTGETAPEVPQTLDFTARTIDGDTFTGAS
    LAGKPTVLWFWAAW
    CPTCRGAAKSVAAVQQDNADRVNVVGVAGLGSGDDAMRRFAQDTGIQGFPHLADDAGEVWQRFEVV
    SQEHYVLLDSTGTVVHNGPLSQTDLRERVAELT

    >gi|145594089|ref|YP_001158386.1| methionine-R-sulfoxide reductase [Salinispora tropica CNB-440]
    MRWLRHPTYGWRVSLDDSELPRTEDEWRVRLSPDEFRVLREHGTEAPWSGEYVDTKTPGVYHCRACGLELFASDAKFDSH
    CGWPSFDDAIPGRVREVEDRSMGMVRTEIRCARCDSHLGHVFTGEGFTPKDTRH
    CVNSVSLRLEPRDT

    >gi|145594159|ref|YP_001158456.1| OsmC family protein [Salinispora tropica CNB-440]
    MASGNVNVEHVDGDVYEIHVRGHHLTVDQPVDVGGTDKAPTPTELFAASLAACVSFYAGRYLDRHGDDRTGLRVHADFDM
    ATDRPARVAAIRVTIDPPVGFPTDRIPALTAVARHCTIHNTLLNPPEVTITVE

    >gi|145594211|ref|YP_001158508.1| Na+/H+ antiporter NhaA [Salinispora tropica CNB-440]
    MTGEIPRGRRWSARTTRASRLNSPLRAFLHTETGSARVLLAAAVVALAWVNLDESSYESLWGAVFSVRLGSWQVSHDLRF
    WVNSGLMTFFFLVIGLEVRRDFDLGELRERRRLMLPLLAGIGGILAPIAIYLAFNAGKPTAVGWGVVMATDTALALGMLA
    VLGPRFSDRLRNFLLTVAVVDDLIVIVVLAIAYPEHPSPMALFVAAGIFALVLLIRAAGVRWGPGYLLLGVAAWLAVSES
    GVDPVVVGLVMGLFTYAYVPARTELQRAADRFRLFREQPSPQLARSVRAGLASALSPNDRLQHIYHPWASYLIVPLFALA
    NVGVVVDRELLARAATSPVTLGVLFAYVVGKPAGIVIASMLVPRLSHNQFRAPVGWAAIIGVGTVSGIGFTIALLIATHA
    LHGPALDEAKVGILVATVGASLTTWLVFRLAARLAPARRARALLGASEGIIDLMVPVDPDRDHVRGPREAPVTVVEYADF
    E
    CPYCGQAEPAVRELLVDYTSVRYVWRHLPLTDVHPYAQMAAEAAEAAAEQGAFWEMHDLLLAHQDELRPADLLRYAERL
    DLDLDRFREHLADRRGAGRIAQDVDAADLSSVSGTPTFFVNGRRHHGPYNIEALSAAVMSAFASARLRPEGGREPDHRSE
    AGSEQPDEEPGT

    >gi|145594617|ref|YP_001158914.1| rhodanese domain-containing protein [Salinispora tropica CNB-440]
    MSTALDTAQLRELIDSGRAPRLLDVRTPAEFDNSHIPGAYNVPLNLLKEHRTELRGHLDEDVVLICHSGARASQAERTLA
    AIGVPNVKVLTGGMVAWRVAAGPITEGTPRWDLERQVRLVAGAIVLASVVASLFVPGAEWVAGVIGAGLTIAALSNTCAL
    GMLLSRLPYNRNASCDLDTIIGQLSDAAPAGRRS

    >gi|145594724|ref|YP_001159021.1| hypothetical protein Strop_2192 [Salinispora tropica CNB-440]
    MTDDVRTPVDFWFDPTCPWAWITSRWLLEVTQHRPIMPRWHVMSLTLLNEGRDDLPERYRRGLQGALEAVRVCVAAEQKY
    GAPALGRLYTELGTEFHLKNAPRQRSTYEAALVAANLDPGLASAAGSDEFDAALRASHDDGVGRVGTDVGTPVIAVRDVA
    FFGPVVSPAPRGAAALRLWDGVLALAATGGFFELKRSRTQGPIVG

    >gi|145594978|ref|YP_001159275.1| hypothetical protein Strop_2451 [Salinispora tropica CNB-440]
    MHGLLAREGMAPTELLERGRAEVRGYGGHVVNGEVADAAREGDGFTVTLVDGKSVRARRLLVTTGLVDLLPEIPGLRERW
    GRDVLH
    CPYCHGWEVRDQAIGVLATGPMSVHQALLFRQLSGDVTYFTHHSAGPDTEQAEQFAARGIRVVTGAVTAVEVAD
    DRLVGVRLADGTVVRRDALSVAPRLVARAGFLAGLGLRSVDHPSGVGEYVPADPFGRTEAAGVWVAGNVSDLAAQVGAAA
    AGGAVAAAAINTDLIAEDTRQAVAALRSAESR

    >gi|145595121|ref|YP_001159418.1| methyltransferase type 11 [Salinispora tropica CNB-440]
    MTSASEPAAYPKSCCAAVYGSDLVALLLGEAYHPGGSPLTRRLAARLALSSGERVLDVASGRGASALLLASEYGCTVTGV
    DLAGPNVAAATRAARSLGLADRVRFQQGDAERLSADSHTVDVVVCECAFCTFPDKPTAAEELARVLVPGGRLGMADVIAV
    PDRLPSELTGLGAWIA
    CVADARPLDEYVALLADAGLTTTHAERRDHAVTTMIDQIEARLTVLRMTAGDEAAALGLDFARA
    PAVLAAARAAVADGVLGYAMLTARKPESGPR

    >gi|145595171|ref|YP_001159468.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora tropica CNB-440]
    MYDVIVVGGGPAGLNAALVSGRQRRRVLVVDSGSPRNAPASEMHMFLSRDGFSPAELRKVGREELSAYPSVELRMGQVDS
    VMRTEHGFTVALAGGDTHRTRKLVLATGQVDLTDTVDGLAARFGRGVFH
    CPFCHGYETQGMTLAVLGHELPQVMQALYVA
    DRFSEDVIVCTNGHPVPESAVSRLAAAGIPVREEPVTRIEGEEGDMRLVFADGTVLDRQAIYHRAPTRQHSTLAEQLGCE
    LLPDGCVRVDEFQRTSVPGVYAAGDTARLAALPDALTFVITGAADGARAAVWLDQELFREDAGLTG

    >gi|145595819|ref|YP_001160116.1| iron-sulfur cluster assembly accessory protein [Salinispora tropica CNB-440]
    MTTPAQTESTEASTAVILTDVAAQKVKALIEQEGRDDLRLRVAVQPGGCSGLRYQLFFDERSLDGDVVTDFDGVEVVVDR
    MSAPYLGGATIDFADRIDAQGFTIDNPNAGNSCACGDSFS

    >gi|145595834|ref|YP_001160131.1| dihydrolipoamide dehydrogenase [Salinispora tropica CNB-440]
    MSAFPHRDPRCNQATWELDVSEPNETFDIVILGGGSGGYAAALRAAELGLSVALVEKGKLGGTCLHNGCIPTKALLHAAE
    VADQTRDSEQFGVKAELVGIDMAAVNSYKDGVVARLYKGLQGLLGGAKNITIVAGAGRLVAPNTVEVDGKRYTGRNVILA
    SGSYAKSLPGLEVDGERIITSDHALVMDRVPASVIVLGGGVIGVEFASVWKSFGVDVTIIEALPRLVAAEDEESSKALER
    AFRKRKINFKVGKPFEKVEKTDSGVRVTIAGGEAIEAELLLVAVGRGPNTADLGYEEQGVRMDRGYVLTDERQRTNVPNV
    YAVGDIVPGLQLAHRGFQQGIFVAEEIAGENPAVIDESGIPRVTYSDPELASVGLTEAKAKEQYGTDKIKTYNYNLGGNG
    KSQILKTTGFVKLVRVEDGPVVGVHMVGARVGELIGEAQLIYNWEAYPAEVAQLVHAHPTQNEALGEAHLALAGKPLHAH
    A

    >gi|145595882|ref|YP_001160179.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MPIDVGAQAPDFVLKDQNNQEVRLADFRDKRAVLLVFYPLAFSGVCQGELCEVRDNLNQYVNDDVQVLTVSVDSVYSHKI
    WANQEGYEFPLLSDFWPHGAVAQAYGVFNDIGGIANRGTFVIDKAGVVRFAEMNMPGEARDQQGWRKVLAEVTAA

    >gi|145596028|ref|YP_001160325.1| hypothetical protein Strop_3516 [Salinispora tropica CNB-440]
    MSERVTVDMWFDPICPWAWITSRWLLEVERVRALDIRFHVMSLSVLNTGRDLPADYQALMRTGWGPVRVCVAAEQRYGTG
    ALRDLYTALGTRIHLQSEQLTRELFTAALTDAGLDPELAQAADSTEYDGALRASHEAGMRPVGTDVGTPVIHAPGPDGNP
    VAFFGPVVTPAPRGEAAGRLWDGVLLVAGTPGFFELKRSRELAPIFD

    >gi|145596119|ref|YP_001160416.1| thioredoxin domain-containing protein [Salinispora tropica CNB-440]
    MSDPRITPSIFTRGAVDLSALRTPAPSPAPAPAQSGPSDDGVGSTAAVIDVSEATFQAEVLERSLSTPVVVDFWAEWCEP
    CKQLSPVLERLAVEGAGAWVLAKVDVDANPRLAQMFRVQGIPMVYAVVGGQPVDAFSGVVPEAQLRQWIQAVLKAGGATV
    AETADPRLDEADESLLNGDLDTAEQAYRKILAETPSDAAAEAGLAQVGLARRVAGADPQAVLTAAAAATDDVDAQLLAAD
    VEVLGGMAEQAYQRLVGLVRRTAGEDREKVRQHLVGLFTIAGPDDSAVALARRALASALF

    >gi|145596187|ref|YP_001160484.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Salinispora tropica CNB-440]
    MAERLIVIGGDAAGMAAASQARRRRGPDDLEIIAFERGRFTSYSACGIPYWISGLVPQRDQLVARDPTTFRDRFDIGVRL
    RHEVTTVDLDRREVVARDLANGGEVRERFDTLVYATGAHPLRPAWARTGVDGVFGVQTLDDGAALRDWLDADPRPSQAVV
    VGGGYIGVEMAEALIQRGLAVTLVEKAKQPMSTVDPDMAKLVNDAMRGVGVQIQTDLEVTGLQERNGRVCAVLTSDGPIP
    ADLVVLGLGVRPNVALAEAAGLPIGPSGALRVDRRMRVPGVDDVWAAGDCVECLHRVSGLPVHIPLGTHANKQGRVAGVN
    IGGGYATFPGVIGTAVIKVCDLEVGRTGLREQDAAAAGFEFVSVITESTNRAGYFPGSRPMTVKLIAERPTGRLLGAQIV
    GWSEAAKRIDALAVALWNGMTVDDMTALDLGYAPPYSPVWDPVLIAARKAVEALGR

    >gi|145596252|ref|YP_001160549.1| glutaredoxin-like protein [Salinispora tropica CNB-440]
    MLTMYSTPWCGYCHRLKSQLDREGIGYEVVDIEQEPEAAAFVMSVNGGNQTVPTLRFADGSALTNPTIRQVKEHLSEISA


    >gi|145596296|ref|YP_001160593.1| methylated-DNA--protein-cysteine methyltransferase [Salinispora tropica CNB-440]
    MNTIDATVADTPAGPLGILAGPDGAVRAAGFTTDLTTLLALVHPHLHAPLRERRDLGPITAAVTAYLDGELSAVDGVPVE
    QHTDGVFLAHAWDILRDLKPGDPVTYTELAGLAGRPAAVRAAAAACARNAAALFVP
    CHRVLRTDGTLGGYRWGLDVKKWL
    LSHERQLTAS

    >gi|145596609|ref|YP_001160906.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MTARRWAASLLATMIVVALAACATPDWRKACGTNSDGVIECAPDQRSAAPELAGELLDGGSYDVSQDRGQVVVVNFWGSW
    CAPCRAEADDLEATYQATKGSGVTFLGINVQDSRDKAIAFEEGRVTYPSIFDPGSRLALELEIPPNTIPATVVLDRDGRI
    AAVIRAAVKQEGLQPIVERVAAESPASTGDT

    >gi|145596663|ref|YP_001160960.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora tropica CNB-440]
    MSEHDVVIVGGGAAGLSAALVLGRARRRVAIVDAGEPRNAPAQHMQGFLSRDGMPPAELLAAGRAEVTGYGVELIAGTVD
    RIELGFAVQLGGGRMLAARRVLVATGLRDEIPDIPGLRQRWARTVLH
    CPYCHGYEVRDQPLGVIASAEHALLVCQWSPDV
    VYFPHTSTVSDEDRARLTARGVRIVEGEIACIADGEAQMADGTTVDRQAFFVRPRFVPTSNLLSGLGAAVDAGGWAVIDS
    TGRTSVPGVWAAGNAVDPRAQVITAAGQGSAAAIAINNDLVNDDVAQALTVLGSDPEPTFSKGIATS

    >gi|145596737|ref|YP_001161034.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Salinispora tropica CNB-440]
    MEEWDLAVLGGGTAGIVAAKTAGRFGARVLLVESARTGGDCLWTGCVPSKSLIAAAHAAQSVRTADQYGVHTSPTTIDDA
    AVLAYVRSSITRIEPVDSPAAISAAGATVVAGRAEFTGPATLRVTDDAGTRLARFRWALIATGSAPALPTVPGLAQADPL
    TTDTLWDLTELPRRMAILGGGPIGCELGQALARLGVEVTLVELADRLLGKEEPEVGALIAERLRAEGVTVVTGTGVDRVT
    DGTLHLHGGETIEVDRILVAAGRRPRTTDLGLAAAGVRCDEQGHVVIDDRMRTSNRRIYAAGDVTGTLPFTHVAGVQGGY
    AATNALLGLRRRIDYAAVPWVTFTDPEVARVGATLAQARHRHGTRAHAQRLSHDHVDRAITDRRTDGFTQLVSGPGGRLL
    GATVVSPRAGESIAELAAAIRRGAKVRDVAGTVHPYPTYADGPWNASLAQLRADLTAPLPARATAALRALRRALHPIRSG
    NR

    >gi|145596827|ref|YP_001161124.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MRTRLVALLVPALLAVAGCTGTGPENTPVTRDEAAQSRPSPFADCSGLTADRPSAPSATPAPGGTPLPELTLTCFTGGAS
    VDLHQLRGPAVINLWASW
    CAPCRAELPAFQRLSERAEGQLTVVGVNMRDTRSGAQSIGEDFGVRFPILIDQGEALQRALE
    RKAIPMTVLVDANSQIQHVDVSGALDDARLAELVGVHLSVAVPE

    >gi|145596866|ref|YP_001161163.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Salinispora tropica CNB-440]
    MARLSNGQRFPNLQVPAVGGGTLNLPDDLAGQFGVVLIYRGSWCPYCNAQLAAFQRANDTLTALGVRVAALSSDDEEASR
    QLVESRRLGFPVGHSADIATVAEATGAYVNDEPHHLQSTGFVLAPDGTVLTAVYSSGAIGRLVPDDVAGLVRYIQEHS

    >gi|145596951|ref|YP_001161248.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Salinispora tropica CNB-440]
    MEPELVDLVVVGLGVGGEEVAGQLAKAGLSVVGIERDLVGGECPYWGCVPSKMMIRAANTLAEAHRVHQFAGSARVSPDW
    APVAERIRAEATDTWDDQVAVERFVNQGGRFIRGSGRLDGPGRVRVNDQVFQARHGIVLSTGTRPFAPPIDGLAETPYWT
    NHQAIEVERLPESLLVLGGGAIGLELTQVFARFGVRVTVVEALDRILATEEPESSEVVAAALRADGVDINTGVIADRVDH
    DGQQFTLRANDVRYTADQLLVVTGRRAHLDELGLDTVGVRADQRFLPVDDRLRVTEGIWAVGDVTGAGAFTHVATYQAGI
    VVADLLDRVRRSEAGAALDGTGAALDDTVPRADYRALPRVTFTDPEVGGVGLTESQARQQGINVQVGSVPLGSSARGWIH
    RADGLIKLVADADRGVLVGGTSIGPAGGEVLSGLAVAVHAAVPLAELRDMIYAYPTFYRAISDALRDLG

    >gi|145597021|ref|YP_001161318.1| rhodanese domain-containing protein [Salinispora tropica CNB-440]
    MFGPRVPTVTVPEITDDAYLLDVREDDEWLAGHAPNAHHLPMTQLPTRLAEVPDNREVAVICRSGGRSAQVVTYLLRNGW
    EQVRNVEGGMGEWAATGRPVVGGDGQPGKVL

    >gi|145597079|ref|YP_001161376.1| methylated-DNA--protein-cysteine methyltransferase [Salinispora tropica CNB-440]
    MRWTVLDSPIGEFSLATDGEAVCGAHFARVADAADQPTDSLSARAVDELRAYFAGELTAFTVPVRIPRGSEFERAVWREM
    TAIGYGETLTYGEVARRLGDASAARAVGVACNRNPVPVIVP
    CHRIVGSGGKLVGFGGGLDRKVKLLELEAGVALRRRWSS
    AG

    >gi|145597088|ref|YP_001161385.1| thioredoxin reductase [Salinispora tropica CNB-440]
    MDDVRNLIIIGSGPAGYTAAVYAARANLAPLVIEGAQSGGALMTTTEVENFPGFADGILGPELMDSMRKQAERFGAEFLT
    DDVTRVELKNTGEVGSDAVSTVWVGETSYRAKAVILATGSAWRPLGVPGEQEYLGHGVSS
    CATCDGFFFRNQHIIVVGGG
    DSAMEEANFLTRFAESVTIVHRRDTFRASKIMAERALGNDKIKVEWNSAVEEILGADGKVSGVRLRNVHTGDTRVLDVTG
    VFVAIGHDPRSELFRGQVDLDDEGYVKVDAPSTTTSIPGVFAAGDLVDHTYRQAITAAGTGCAAALDAERFIATIQG

    >gi|145597089|ref|YP_001161386.1| thioredoxin [Salinispora tropica CNB-440]
    MGATKSVTDASFTTEVLKSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMGDQVTIVKLNIDDNPETARTYRIMSVPTLTV
    FKDGKPVQSIAGAKPKGELVKLIQSAL