Salinibacter ruber M8 uid47323

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294505897|ref|YP_003569955.1| Mercuric reductase [Salinibacter ruber M8]
    MTDPVSYGLIVIGAGQGGGPLAGTVAEAGHDVALLERRHVGGTCVNRGCTPTKTMIASARVAHLARRAGDYGVETGDVSV
    DLETVRQRKRDIVGMFRSGSRSSIEEKDTLDLIEGDGRLVDPNTVEVALNGDVDDGGPRALTADRIVINTGTRPAIPPID
    GLDAVDFLTSTSIMELGAVPGHLLILGGGYIGLEFGQMFRRFGAEVTIIDRGEHVLGREDADVAGALEGILREDGIRLLN
    ETSMTAVEETGGTITAHLEGDDAPARITGDELLVAAGRRPNTDALNPGAAGVATTEQGYVQVDARLATTADGIYAIGDVT
    GGPAFTHVSYDDYRVLQDHWLHGGDRTTEDRLIAYTLFTDPQLGRVGLTEKAARSRGLDVTVAQMPMTRVARALEVDETR
    GLMKAVIDSTTNRLLGAAVLGIEGGEVMSVLQTAMMGDLPVGRLRSAPFAHPTLAESLNNLFAGLDLGPAAERRTDG

    >gi|294506000|ref|YP_003570058.1| Thiol:disulfide interchange protein dsbE [Salinibacter ruber M8]
    MPNPSVPHCYLKARVLVLAVSAASLLGLSAGAARAQPGPAEIGKQVPGFEIEALRDSGRAITPSDFEGRYVLLNLWATWC
    AP
    CIEKLPALREARRRYSPERLAILNVSFDRSRPKATAFLEKREMPGRHAHASGGLMGEFGDKFARMPTESASMQMRGLP
    NMTLIGPKGKVADIAAGESADLLEMLSERLGR

    >gi|294506144|ref|YP_003570202.1| putative thioredoxin [Salinibacter ruber M8]
    MANKWATWCLPCVEEIGSFHSLHEGTRRGVSVVLAAEEDVETVRRFAEKRGFSVPMYVADEMPAPLREETIPRTYVVKPD


    >gi|294506229|ref|YP_003570287.1| heavy-metal transporting CPx-type ATPase [Salinibacter ruber M8]
    MTRTLSYEDTLGMLNRDPDGHARRERTRRQSPAPAHVSRIDSGPSALYRQIYSSPPVSTMPTCTYCDAPTDAPVTAEDVD
    GVFCCSGCLEAHRVADPDAHDACCHHGDGHGHAGHDPDRDTDETETAFLHVRGMH
    CTSCEDFIETVAASTDGIHEAEASY
    ASDMAKVAYDPSRHHESDLPALLSQAGYEAHLTAPEDETADQNTAARLVFGGFFGMMVMVVYIVLLYPVHLGGEGLVDLS
    TEGGTYVLANVWAFTTFVLLVTGWPTLRGAAVSLRVLQPNMDLLVGLAAVSAYLYSGGAVLMGQTDVYFDVTVVIIMAVS
    LGHYYEDRVKRRATDLLSTLTREQVDEARRVSEGATETVAVDDLAPGDRVQVRAGERVPVDGTVVEGRAAVDESLVTGES
    LPVTRTEGDDVIGGAVVTNNALTVEVGAAAESTLDRLVNLMWNIQSSQPGAQRVADRIAAVFVPLVLVLAAVAFGWQWAS
    GAPAATALLTGLSVLIVSCPCALGLATPLAVASGLRTALEHGIVIRDVSLFETAPDVDTLAVDKTGTLTTGAMQVIDAAA
    DAATWRRARAVEQHAAHPVARAIVEDGAAGPAGDGAPARATDVRSRPRGVEGRVDGDRVRVGHPEWLRTEGLRMDDTLAE
    RAEAAQENAQVPVAVGWDGAVQGLIVVGDTLRDEGLAVMDALRGDAREVVVITGDSAAAARPLREHDAIDRVIAEVQPAE
    KSDLVRGLRDAGTVAMIGDGSNDAPALAEADVGIAFGPTALAADSADVVILRGDLTHIPAVFSLARAARRRIRQNLAWAF
    LYNAVAIPLALVGLINPLFAALAMAASSLGVVGNSARSLPVADSRPTDGNEK

    >gi|294506658|ref|YP_003570716.1| Thioredoxin reductase [Salinibacter ruber M8]
    MRDVIIIGAGPVGLACGVEAKRRDLDALLIEKGALCNSFIGYPTRMEFFSTPGPLEIGGHPFPTRDYKPRREEALDYYRR
    VATTEDLNLRLYEPMTDLRGQDGHYTVVTENDTYEARKVVVATGFYDVPNQMGVPGEDRDKVRHYFKEPFPYALTDVAIV
    GGANSAVKAALNCYRHEANVTMVVRDSALDDGVKYWLRPDVENRIEEGSIDAYFDTTVSAIESDTLHLDTPDGPQTIDND
    FVLAMTGYRPNYDFLERLGIAIRNDEARTPVHDEEGTFETNRDGLYLAGTICGGCDTSRWFIENGRVHAEKITDHIAATL
    DPEPAVV

    >gi|294506724|ref|YP_003570782.1| hypothetical protein SRM_00909 [Salinibacter ruber M8]
    MRTGSISCDGGCLSLRLSTGRREGTGPMAPRRVVPECPLAAGRVCPGRRRDVKRCGRVWHPGCDCRPGSRPCVVPYPTNK
    TFRPMHVLTTIGPDNSTKAVLPFIAGKGALSRGGSVALFAMQEATYLGAPSHVDLTELKAPGLPTVQAVLETLRTEDALD
    EFVV
    CKPCAEARGIQAADLAPWATFGGADDLARQAAGHDTTMTF

    >gi|294506867|ref|YP_003570925.1| Periplasmic binding protein [Salinibacter ruber M8]
    MPRVVSLIPSATEIVAALGHRDALVGRSHECDHPPGVEALPALTAPKVPLEGSSWEIDDRVRALLDEAMSVYDVDVERLN
    ALRPDLILTQSQCEV
    CAVSLPTVEQAVADRIEGSPTVVALEPRSLADVRDDIRRVAGALGCPDRGDRLVRRMRDRMQATS
    NAVAPADATDRPTVAALEWIDPLMGAGGWVPTLLEAAGGTPVFARRRGDLDALHEADPDRIVVMACGFGLSRTDAEMDVL
    RNDNRWAALRAVQAGHVYRADGNHFFNRPGPRLAASLDILAEILHPDRFHAAIDRSHRDTAWRREPAPAPSATR

    >gi|294506939|ref|YP_003570997.1| Thiosulfate sulfurtransferase [Salinibacter ruber M8]
    MCATGASKSSTTGSSREHHVHGRLLVCPPTVPFLSLRSFLLWTRPHTRRRQRTPSASAALLRGAVARPPEGPRPGARGIR
    RSTGVCAGARPRPAALLRRSAKVVAGFSVFGCPATAFESCVLSPAPSNSLASVFLLCLLPGLMEETIHTVSTEAFALQAE
    DPDHTILDVRPIAAYNGWPLQDEPRSGHVPGAKSLPLQWTQYMDWVEVLDEKGLSQNAPVTVYGYTADAAAEMADKLSRL
    GFEAVGVYDGFLEDWAPDPDRPLQRMERYQQLVYPEWVQRLRTGETPPGMRGDDHVLCHAHFGYRQDYEDGHIPGAIPLN
    TNALESPETWNRRSPEELKSALEDHGIRHDTTVVLYGRFSYPTYDQDDPAQSAGHLGAMRCAALMLYAGVEDVKILNGGI
    STWESAGYDVSTDDVEPAPVDDFGAEVPTHPEYMLTLDEAKALLEADDGDLVSVRSWAEFIGERSGYHYIDKTGRIPGAV
    FGNCGSDAYHMENYRNFDYTTREFSEIAGKWAEMGITPDKHIAFY
    CGTGWRGSEAFMNAYLMGWPHVSVYDGGWYEWSSH
    PDTETATGVPENDVPA

    >gi|294507000|ref|YP_003571058.1| thiosulfate sulfurtransferase [Salinibacter ruber M8]
    MSTYANPDVLVSTDWAADRLDDPEVRFVEVDVDTSAYEEGHVPGAVGWNWETQLADTQTRDLASKEDFQSLLRSSGIDDD
    TTIVLYGDNDNWFAAWAFWQLTYYGHEDTKVLDGGRKKWLAEDRPLSTEAPDYEAGNWSASAPDNSIRAFSGYVQQTLDR
    DDVELVDVRSPEEFSGEKLGPDGLNEGAQRGGHIPGAHNISWSEAVNEDGTFKSAEELKEIYEERGITPDKETIAY
    CRIG
    ERSSHSWFVLSQLLGHPRVRNYDGSWTEWGNLVGVPIETGADPVAA

    >gi|294507087|ref|YP_003571145.1| Peptide methionine sulfoxide reductase msrA [Salinibacter ruber M8]
    MNPESPLVTSVPSTLLCASSGQQGFPACIGKPLSFSQVPTRPVSTLNHATLGGGCFWCLEAVYEEVDGVTEIVSGYAGGH
    VQAPSYRQVCSGTTGHAEVVQLTYDPSVIAYRDLLEIFFTIHNPTTKDQEGADVGPQYRSIILHHDDEQREIAEGLIERL
    EANGVFGDPIVTEVEPLDTFYEAEDKHQDYYERNPAQPYCQSVISPKVAKLRKKHADKLQGQSPRPTS

    >gi|294507246|ref|YP_003571304.1| rhodanese-like domain protein [Salinibacter ruber M8]
    MRRLFASLLCAVALQAGCSEALTWRAVNHMIAADYPDVTALTTDSLAAQLADSTSPTPVLLDARSPDEYAVSHLRGARRV
    SPSADAYPALDTLASDAPIVVY
    CSVGYRSAGVVQALQTQGFSRVYNLKGSIFRWANEGRPVYRNGEPVSAVHPYDASWGQ
    LLTDSLRASPSSESL

    >gi|294507312|ref|YP_003571370.1| Peroxiredoxin osmC [Salinibacter ruber M8]
    MPTRSADATWTGNLPDGSGTMQLESGAYEGAYSFRSRFEDGDGSNPEELIAAAHAGCYSMALSNVLAEAGHDPESVNTTA
    DVTLQMVEGDPTITGIHLTTEASVPGLDADTFDEHAAAAKEG
    CPVSKALAGTEITLDASLT

    >gi|294507318|ref|YP_003571376.1| thioredoxin [Salinibacter ruber M8]
    MRRLLTLACTVGLLVLLTACGGDDTAETSDQAAPSASASRGPIPGKVRDVGPEPVPTLTLETLDGASIDLEARDGELLLV
    NFWATW
    CAPCREEIPDLKSLHTDFENLTVIGVALDRKGREVVKPFAQKLEINYPIVIDKSGAAEAEFGPIPGLPTTVLVT
    PDGQVTKRVVGIFPTEEMRPTLKKMLSGEA

    >gi|294507398|ref|YP_003571456.1| Iron-sulfur cluster assembly accessory protein [Salinibacter ruber M8]
    MTISITDRALDQIESVASNEEVDLGETLLRVAVVPGGCSGLTYDLGWETTVKDDDEVEEHDGVPVVFDKKTRLYLDGSEL
    DFTHGLNGDGFHFSNPQASRECACGESFGV

    >gi|294507530|ref|YP_003571588.1| Peroxiredoxin [Salinibacter ruber M8]
    MSTTHSLSKGDRAPRFTLYTDEAQPWALSDHLDQPVVLLFFPGAFTSVCTTELNAVNNDLGSFEPAHVVGISTDAPAVLS
    EFRSTQQFEFPLLSDHDATVCAEYGAKYDQNFTAMGLDRIAKRAAFVVDPAGTIQYAEVLDDAGQQPDFDALKETVQQLK
    GDWDRHEH

    >gi|294507537|ref|YP_003571595.1| OsmC-like protein [Salinibacter ruber M8]
    MPEKVRFENADGNALAARLDRPDGESPCAFALFAHCFTCSKDLRAAGAISRALTRHGIAVLRFDFTGLGESEGEFADTNF
    SSNVEDLIAAADYLSEHHEAPRILVGHSLGGAAVLQAAQRLDSVQAVSTIGAPYDPEHVTQHLQDAVEDIEEKGEARVQL
    AGRTFTIRKQFLDDLAATKMETTIRTLGRALLIFHSPVDQTVGANNAAKIFQAAKHPKSFVSLDDADHLLTDRSDAEYLG
    VVLGAWAEKYVDRSVSVPDTPDEDVVTRTEGTYRTAIQAGQHALVGDEPESVGGDDDGPTPYGFLLSALGS
    CTGMTLRMY
    ADRKEWPLDETIVRLSHEKVHAEDCENCDTEQGQVDRITREIEIRGRLSDDQRERLFEIANKCPVHRTLLGDVDVRSSLR
    SRDDAQ

    >gi|294507561|ref|YP_003571619.1| hypothetical protein SRM_01746 [Salinibacter ruber M8]
    MPNRLADEQSPYLRQHKDNPVDWRPWGDAAFAKAREEDKPIFLSIGYSTCHWCHVMERESFEDDDVAALLNDGFVPIKVD
    REERPDVDSIYMDVCQMMRGQGGWPLTVLLTPDRKPFFAATYLPKEGRFQQTGLMDLLPRVRQLWNSDDRAKLLDDAEQV
    TDRLQRIGDDQTDGDAPGPTLLDDAARQLAQQFDRTHGGFGSAPKFPAPHNLLFLLRHWHRTGEQAALNQVTTTLDRMRW
    GGLFDQVGYGFHRYSTDQQWKLPHFEKMLYDQAMHVLAYTEAYQATGTDRYERTAREVLTYVRRDLQAPDGGFFSAEDAD
    SLNAEGDMEEGAFYVWSIEDIREHLEPALADLVIDVYNMSPAGNYQEERTGERTGKNVLHRDQSLAAAAEQRGMEADVLR
    DHLDTARRVLLDARSERPRPGLDDKVLTDWNGLMTAALAKAARVFDEAQFEEAAVQTGRFVLDTMHDADGRLLHRYREGE
    AGIQATLDDYAFLIWGLLELYETTFDADWLRAAVEHMEAALDRFWDAEGGGFYMTPEDGEALIVRPKEANDGALPSGNSV
    QLMNLLRLARFTGRTEFEERAAALSRWAGATARRRPTGFTAMLSGLHWALGTPREVVVAGEPDSDDTNALIDVLRDDYTP
    TTVTLQRPPGDADITALAPFTESQTPVDGRAAAYVCEAFRCEAPVTDPAALREQVRTDREG

    >gi|294507588|ref|YP_003571646.1| methionine-S-sulfoxide reductase [Salinibacter ruber M8]
    MGNGRNWEKVCCPAKAEDVFPFTRPVPCVMTPSTQSYWLLGAALLAAVLAGGMFFQGPSSDGNAPSPAPTDSVPAAMADT
    ATFAGG
    CFWCMEPPYDKIDGVASTTSGFAGGEEVDPSYREVASGATRHTEVVQVVYDSTTVSYERLLRVYWHNVDPFDGT
    GQFCDRGSQYRPAIFAHDAQQQRSAERSKVTVAAQFDRDIAVQVQSLDAFYAAEQYHQNYYQKNPADYKRYRQGCGRDAR
    LREIWGEAALSDAPLDGTT

    >gi|294507608|ref|YP_003571666.1| Copper-transporting P-type ATPase [Salinibacter ruber M8]
    MSRPSPETETSPPDAPSHAPSAEGDACAVEPVPSERREGHSSGERGERLTLPIKGMSCASCAKSVEGGLAGVDGVAEARV
    NFATERAQVGLQKGRRVPVGKLAQAVADSGYEVRTAETALTVQGMT
    CASCVSRVEDALGAVEGVLEATVNLATDRATVRY
    VPGATERTDLTRAIRDAGYEGGGTEDGGDRADVENQAREDEQRPMRQRFLWALAFALPVFVLEMGFMHIPAMEAWITDQV
    STQTLYYVLFALTSVVQFGPGRYFYKHGWPALKSGAPDMNTLVMMGTSAAYGYSVVATFLPTVLPEGTVHVYYEAAATII
    TLILAGNYMEALAKGRASDAIRALLDLQATTARVRRDGEEEEIDVRDVVPGDVVRVRPGEKVPVDGEVLDGQSHVDESMV
    TGEPEPVRKAEGDEVVGGTINETGSFTYRATRVGEETVLSQIVEMVEQAQGSAPPIQSLADRVVRVFVPFVLATAALTFG
    VWMVWGPDPVLTYALVSAVSVLIIACPCAMGIATPISVMVGTGRAAELGVYVREGDALQALHAADLVALDKTGTLTKGRP
    EVTDVRPRDGFGETDVLRWAAAVEAQSEHPIGAALAARAEERGLALPDATDFEAIPGHGVRATVEARDVAVGAARLMERH
    DVAIPAGAEETADRLADAAKTPLYVAVDGTLAAVVAVADPIKESTPAALDALHTLGIEVAMVTGDDERTARAIADQLGID
    RVQAEVLPDEKAAAVDDFQAGGRTVAFVGDGINDAPALAQADVGIAIGTGTDVAIESGDIVLMAGDLRGVPNAVHLSRST
    LRNIKQNLFWAFAYNVLLIPVAAGVLYPAFGLLLSPALAALAMVFSDLFVVGNALRLRRLSVPLGGEQAVATA

    >gi|294507618|ref|YP_003571676.1| Dihydrolipoyl dehydrogenase [Salinibacter ruber M8]
    MPSTLFAYTCDQLFLAPMATDYDCVIVGSGPGGYETAIRATQLGMETAIVEKDKLGGVCLNVGCIPTKALLKSAEVMAET
    SHLDDFGLELDGSVSPDFPSVIERSRGAANQMNQGVRFLMQKNDIDVLRGHGRLTAPDTVEIEPSVNMDGEEVGEARTVT
    GEHIILATGARPNELPFLPIDGEKVMSSKEAMLQTEQPDSLVIVGAGAIGVEFGYFYHHMGTDVTIIEVQDRMVPAEDKD
    VSKELEKAYTKMGIEVMTGANVKGVDKDAEPLRVEVEAGGSTEHIECDQVLSAVGVVGNVEDIGLETVGVETEGGDIVVD
    DYYRTNVDGVYAIGDVTGAPWLAHKASHEGILCIEKIAGHDVRPMDPNDIPACTYCQPQIASVGHTEEEAKEAGYDVKVG
    TFPFKANGKAAALGHQEGFVKTIYDEKYGEFLGCHIIGEDATELISEVVTARKLETTGLEIMESMHPHPTLSETVMEATR
    EAYGQPINI

    >gi|294507670|ref|YP_003571728.1| iron transport system substrate-binding protein [Salinibacter ruber M8]
    MRVSSQRPAPRGGRAGCAPPAGQHQFRGAPVQGPARAHAGPRRAAGDRHPPPPPADPVDDQGRPEAPVAAHFLAQFPRPA
    MRIVSLLPAATEWICVFGGEDQLVGRSHECEYPEQVQDVPAVTAPTYASDGDSAAIDDAVQGQLQDGLSLYDVDLERLRA
    LEPDLIVTQDQCEV
    CAVSLPELEVQLGEWAGKRPEVVSMQPQTLKEVLDEALRLARAMEALDTAMEVIANLETGLRVLRD
    QIGVDRSTNPQSLPSVACVEWLEPLMVARHWMPDVVEMAGGRPLIGTAGTPTAPIEWDELRAADPDALALMPCGFTIDET
    RRDLHYLTNRPGWDALSAVEDQRVALLDGNAYFNRPGPRLYRAIEVLASVLHPEALRPEPPIAAWERQWLHASDPTPA

    >gi|294507681|ref|YP_003571739.1| Conserved hypothetical protein containing vitamin K epoxide reductase domain [Salinibacter ruber M8]
    MEDLRRKAEALPGQDPLRGEGGTCSWLRFWFYGASIPTPIQAAMPLVQTLRERLRGYRPRLEAVVFGLSLLGVLDVVHLL
    IQQARTFENGCLGGSALGGGSSIFDCAAVTAGAGSKLLGVPNTTWGLGFYGMVGVLTVAVFWVVPKVRAWIHGARIGLLT
    GGIAYSAYLTYLQIGPLGTLCLLCLGSALITTLLFAGQVALLASSPTSPPDSMSSRLVKRQVALFVYCAAAAAVLVGMDL
    VYFDETSAAAPQPRSASESAAPAQCELDDSKTPLQDQGASLVGFQDITAGSNEAGVTVIEYFDPN
    CPHCKDFHQVMKQVV
    EAHRDEVRFVYKPFPLRRSSLPEIQALYVAAQSDKFNEMLEAQYARQGPGGIGMQDLRAIAEEIDLDPSVLSERVEQNEY
    RDQVLQQRKRAVKVGVDSTPTVLINGHFVESRTQKCLNTFIEQAKSGTLGGTASG

    >gi|294507842|ref|YP_003571900.1| peptide methionine sulfoxide reductase [Salinibacter ruber M8]
    MAEIDSSRPSNDTLRDELTEEQYHVTQEAGTEKPFSGQYWDHKGDGLYRCVVCETPLFDSDTKFESGSGWPSFYDVVEDG
    NVHLTSDHSLGMRRTEVVCDECGAHLGHLFDDGPEPTGQRY
    CINSAALAFDGDE

    >gi|294508072|ref|YP_003572130.1| Molybdopterin biosynthesis protein moeB [Salinibacter ruber M8]
    MPTTTTDPNQKQAELSPDELQRYSRHLTLPEFGREGQEALKNASVLLVGAGGLGSPAATYLAAAGVGRIGLVDFDSVEAS
    NLQRQILYGTSDVGRPKLDAASERLEDLNPHVDVETHEVRLTSDNALDIIDQYDVVADGTDNFPTRYLVNDACVMTGTPN
    VYASIFRFEGQVSVFATEDGPCYRCLYEEPPPPGLVPS
    CAEGGVLGILPGFIGTLQATEVIKVLTGVGEPLVGRLLMSDA
    LNMDFRTVNVPTNPECPVCGDDPTVTELIDYEAFCGLPQSDESSPNGTADSDVSDTDDAVPETSVHDLKQRRDAGDAPFV
    LDVREPYEAEIASLDADQLIPVDDLEARLDELDAGPEEEIVVH
    CRSGARSAKATAFLREQGYDASNLEGGVLAWSEEIDD
    SVPQY

    >gi|294508103|ref|YP_003572161.1| Peroxiredoxin [Salinibacter ruber M8]
    MALRARAGCRHVLRHDSPTPMALTESTMMDLGQSAPDFSLPVANPEVDDRGDAQRSLADYDEADALVVVFMCNHCPYVQH
    IEGALIDVAQEYQDRGVQFVGICSNDPERYPDDSFDNMAERAREKGYPFPYLQDETQEVATAYKAACTPDIYVFDDDRAL
    AYRGRFDDTRPDGDEAHGDDLRQALDELLADGAVTMEQAPSMGCNIKWKPNSTPAHAAQ

    >gi|294508144|ref|YP_003572202.1| Methionine-R-sulfoxide reductase [Salinibacter ruber M8]
    MDQPAPPVSVSFSVFSWRQGHTETFWPPVPHTLHTTVALIPHASMDRKTFLKHLGWAAVAPLALTACTPSRSTPASTSAP
    DTLGVHTLPEDFPPLDKSEEEWRRLLTKSEYQILFEAGTEPRRSSPLLDETRTGTYICAACRLPLFSSKTKYESGTGWPS
    FWAPLDGQVDTKKDTKLGYTRTEYHCARCGGHQGHIFEDGPDPTGLRY
    CNNGLALSFVPADASLPDLRT

    >gi|294508193|ref|YP_003572251.1| Thioredoxin [Salinibacter ruber M8]
    MSYEVNDFETDVLDASADTPVLVDFWAPWCGPCQQLSPVLESLAEATDDWTLVKVNVDDHPSAAQEYGVRGIPAVKLFVE
    GDIEAEFAGVKPKPQLESWLDEHLPSEEKSRIEEAKEALEAGSHQEAEHLLWPVLEDNPDHDEAQVLMARALAFKDPNRA
    QVLAQEAEVADPTLRQMRDGVETIARLLELAEDPSALPENGVKDTYVAALDALADQDFDAALDQFIDVVRTDRNYDDDGA
    RKACVALFTLLGEQHPVTQEHRRTFDMALY

    >gi|294508217|ref|YP_003572275.1| Methylated-DNA--protein-cysteinemethyltransferase [Salinibacter ruber M8]
    MGSINPPSSFYDSVWRVVAQIPVGRVTTYGDIAAHLGRRGAARIVGWALKDAVGGDLPCHRVVNRNGVLTGRRHFETPHV
    MAERLRSEGVTFVAEDQVDLDAHRWRPGKR

    >gi|294508222|ref|YP_003572280.1| Conserved hypothetical protein containing methylated-DNA-[protein]-cysteine S-methyltransferase domain [Salinibacter ruber M8]
    MSVSGPCLSCDTPGCTMQAHSDSDESFFERAWAVVAQIPVGRVTTYGDIAAHLGRRGAARIVGWALKDAVGGDLPCHRVV
    NRNGVLTGRRHFETPHVMAERLRSEGVTFVAEDQVDLDAHRWRPGEAE

    >gi|294508321|ref|YP_003572379.1| predicted redox protein [Salinibacter ruber M8]
    MVQIDTDYIGDLRCEAEHGPSGVTLTTDAPEDNHGEGRSFSPTDLVATALGTCIATILGIQAEKHALDLDGIEISVEKEM
    ASNPRRIASLRTDVTMPTALDAQTRERVERAARH
    CPVDESIHPDIEVPITFHWPGGGAAS

    >gi|294508426|ref|YP_003572484.1| mercuric reductase [Salinibacter ruber M8]
    MTTDYDVLVIGGGAGGLSAAGIATNLGAKTAMIERDALGGDCTWTGCVPSKTLLKAATVVHQARTASKYGLTDQSVDVDF
    GGVMDHVRQVRQEVYEEADAPEIFEDLDIDVREGDAHFIDAHTVGVERADGSTEQVTGRYVIVAAGARPLVPPIEGLGEV
    DVLTNESLFELEEQPERLAIVGGGPIGTEMAQAFARLGTEVVVLDMADRILSNDDAELAATLRETLVDEGVEYVLGAQVE
    RVSQADGTITISAGEQGPVQADALLLATGRTANVDGLHLDAAGIDYTRQGITVDDRCRTSQGHVYAVGDVTGRYQFTHMS
    NHMAKVAVTNALLKVPSKIDADHVPWVTYTEPELAHVGAHAADLDEQGVSYETYRFPYDQLDRAITESETTGQIKVHATS
    LTGTILGASVLGERAGELITAFTIAMRNGVTLRNIGDTIHPYPAYGEGVRRVADQWYVQKQSPTFTKVLQSVFGYRGPVL
    KYGPDEIV

    >gi|294508465|ref|YP_003572523.1| conserved hypothetical protein containing thioredoxin type domain [Salinibacter ruber M8]
    MRLLFAVRSFVLVAVLVLAMGAGRAHAQMEMPPRSLGAVIEQAEAQETPILLEVYAPWCPYCQRMQENVYADAEVQSYLD
    RRFTYARLNRDTTGGAHRFNGRTLSSKELGMALGARGVPTTVFMKPDGTPIAKQPGYIKRPVFLQMLRYFGSGAYEEQSF
    EAFRAQASE

    >gi|294508484|ref|YP_003572542.1| probable thioredoxin related protein [Salinibacter ruber M8]
    MRSFGLDADGLCTSARVSTMHPALLLAVGLALLTGGARPASAQSQDTIRVAGTVLAPDEAAQARRLLRAELGPTSRHWTR
    LQDSTKRFAAAKTAFQIGRVAYPRAWSDSVLTFLREAGTRHPDPAVRAEFLFGGLQVASAAERGETQDQFYRRLTDGHEG
    THYATKARRLFDPDSQIQAGKPLPDFEIPALSDPTATYTKRDFEGQTVLIDIWGTW
    CGPCIRAMPHLHEAYRTHGGEDFT
    ILSVAMRDTREAVKQFRAHKWEMPWDHAFVPKGSDLQKKLRGRFDIQGLPATILVGPDGQILRVHRGVGSGKKMARAISE
    VLAQDLDSENAPSEGANSEDVSGQESNASL

    >gi|294508496|ref|YP_003572554.1| methyltransferase [Salinibacter ruber M8]
    MRSTNAGAGGHVPAAAATQRGGPEAPEGIQPPSTRPGLRVQWRRHEGEPEGGPRAPPVDRPATRDRHVHFDAVWQEHGAQ
    HGLQRGIRAPLPVHLPNEGGPVEGRPVEPGPPRELVGPILFVHPPDVLVGGEAGPEVLTNDAVPVDTGRSIPGHAELADA
    HPADGRDPNPVRRPWAKKQFSLRAVLHGPPVLDPGCEKRGARGQLQGWVHPQGRGHPGLLHAVPRLQLGRAARNARRVVD
    QHLLGTKRGGGESQAETSEEKQNADGARKHGWAGHSGRCTIHSRRKTSWIVRFPTVPLGGVASGDSAEHPRLLFLSYIDD
    KRSKYLLPHARDRRRRLHGCGSPPCPGLQSPGAPGPCGHRPAAGRARRVRMRRNRGRPAARPVDRFPALEGAEGGRADSG
    DHRGTADLLLPQPGGDAGPQRRHGRLFRRPVALAAPSTLLLVAMTRPHASADDLKSTVRAKYAALATADDSCCGPSGSGE
    AGLDVDMSEDYADAIATDADLDLGCGRPTDHAGLQPGERVLDLGSGAGMDAFVARRTVGPDGHVHGVDFAEEMVAKARAN
    ADTLDYDNVTFEVGDIEALPVESGAFDVVLSNCVLNLVPDKEAAFAQMHRALRPGGRFSVSDVVHAGVLPDGLREAAELY
    VG
    CVAGAMERDMYLDRLREAGFSDVHIATEKPISLPDEVLAEHLGAAELDRFRAGDAALQSVTVVGRRPDATA

    >gi|294508582|ref|YP_003572641.1| conserved hypothetical protein containing thioredoxin domain [Salinibacter ruber M8]
    MLSRPASRVAETMISDCLTWLAVLFVVGGLGAETVERAAGQQPAWHDFEEALAVADSTGRFVMVAVYAPWCGWCHKMKDD
    VYSSTEVRQCLAKNFVTTRLNRDDTDTVYQYQGRRLTPRKLAATFRAEGVPTTVLLSPRGGYVMHLSGFIGPTRLRSLLA
    YVSTRAYRSVPYEEFRPGAMNCNDRLRRRPD

    >gi|294508688|ref|YP_003572747.1| Thioredoxin [Salinibacter ruber M8]
    MAESANVITLTDDNFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGKVDVDENPQTAQEYGVRSIPT
    LLFFKDGEAQEQVVGAAGKQPLKENLEALLGQPA

    >gi|294508689|ref|YP_003572748.1| Thioredoxin reductase [Salinibacter ruber M8]
    MPAPFARSVLTFSTALMHENGALANGNQTNGHQHPDLAAFEDVDFSEAEMRDVVVIGTGPAGWTAALYTARADLSPLIFM
    GPEPGGQLTTTTDVENYPGFPEGLMGPEMMDRFQDQAERFGTESRYGTVTHVDFRERPFRLLIGGETPVYAQTAIISTGA
    SARYLGLENEQRLIGKGVSA
    CATCDGSFFRGETVAVVGGGDSAMEESTFLTKFAEKVYVLHRREELRASEIMQRRAFEND
    KIEFVWNTEVIDVLGESAVEGIEVINNETGETRVMGDVTGFFLAIGHTPNTGPFEGWVQMDETGYIQTEGASTYTDVPGV
    FACGDAQDSTYRQAVTAAGTGCKAAIDAERWLSEHGAAEAPRADANRQPVEA

    >gi|294508732|ref|YP_003572791.1| Conserved hypothetical protein, secreted, containing thioredoxin-like fold [Salinibacter ruber M8]
    MPMTTRHPRVLCAALVVGLLTAAALPATSMAQTNQAEVGEPAPNFTLQAADGDEHSLADFEGQYVVLEWLNFGCPFVGKH
    YGSGNMQRLQDTYTDEGVVWLSIVSSAPGKQGYYPPGEMVEQKKKHDGNMTAILMDPEGEVGKTYDATVTPHMYVISPEG
    ELLYRGGIDDKPTTDEADIEGATNYVRMALDAAMNGEEVRPKRAEPYGCTIKYASK

    >gi|294508733|ref|YP_003572792.1| thiol-disulfide interchange protein DsbD [Salinibacter ruber M8]
    MNHSGKLGYTQSARRLPARRPQPLMTSFQRSSGRRCLVLGVWLLVVLWGSGAATPLQAQSQASDDPSPHSEATLVSEQDA
    IVPGEPLTVGLRLNMEEGWHSYWKNPGASGEPTSIDWALPEGYETSGFQWPYPHQIEFGSLISYGYSDEVLLIATVTPPD
    TLTPGTTATLGGRAKWLICEEICLPAHSDVEVTLPVAEEASPKPGRASAFEAARAKHPKRVSDWSVGAGRSEGRYTLILG
    APDGARPDLEGTYFFPAEKSVVDPGAPQPVTRNGDTYTIALRQSEYAQAPADRLRGVLVAPEGTGWDPDGRVRAMQVDVP
    VDSTLSAADAMGAGASSAGGGLSLPWALAFALVGGVLLNLMPCVFPVLSVKILGFAEEAGGEAGAMRRHGLLFGAGVLGS
    MWILAGGLLALRAAGSQIGWGFQLQSPIFIALMTMLFFGIGLNLLGAFEVGTTLMGWGGRMEAAASGGGNLSAFLTGVLA
    TVVATPCTAPFMGAALGVALTLSTVGALLIFTALGVGMAAPYVVLSTTPALLDRLPDPGAWMETLKQAFAFPMFATAIWL
    VWVFGQQTSTGGVAFLLAGLLLLGVAAWIVNRWSAPQLSQTATLVTRGLAGAALVGGIAVAVIGAGSAPAEQQATATATD
    ASGTDTTWRSYAPETIESLRAEGRPVFVDFTAAW
    CLTCQVNKRRVLTAESVQNAFDEKDVALVRADWTSRDPEITRALES
    HGRSGVPVYVLYAGDGSEPELLPEVLTEDAVLNALDDLSSTVAATHEPH

    >gi|294508759|ref|YP_003572818.1| protein E (rhodanese-like domain protein) [Salinibacter ruber M8]
    MSDTLATISADDLKDKLEGEHPPVLINALPRKAHAATHIPGSVNVPVDEIDRVEALVPNTDEPVVVYCANAGCDVSLKAA
    HALEEKGYTNVIDFEDGYAGWRQAGYPLVGEKR

    >gi|294508795|ref|YP_003572854.1| uncharacterized peroxidase-related enzyme subfamily [Salinibacter ruber M8]
    MAWIDVIDPADATGDLKELYDTIAEQRGKVSNVLMVHSQNPAALKEHLDLYDAVLFGASPLSRADREAIAVVVSAANECD
    Y
    CVRHHAEALQAYWQDEDRVHQLADDYTALDALDDRLRTACAVAEKLTAAPGAMAEADVHALRDAGWSDRAVLDIVLVTS
    YFNFVNRITNGLGVEATEEEAAGYNY

    >gi|294508802|ref|YP_003572861.1| hypothetical protein SRM_02988 [Salinibacter ruber M8]
    MATTTAEETAAEQVHEKAEQALGFVPNLITEITDENPAVADAYLTSQALVEEGGVLSAAEQQAVILAVSSYNDCHYCTKA
    HAVAGQQAGLDAETTATINEGGLPDDDRLRSLVRATRRILGKRGWLSDVDEAEFADLGLERPELYEIVALAGIKTISNYV
    NHIADTEVDEAFQT

    >gi|294508803|ref|YP_003572862.1| Peptide methionine sulfoxide reductase msrA [Salinibacter ruber M8]
    MLGRRPVPPGRNHPDRTAQSTSPSARSTSTPPPPMAPPTDAAMQPPPMDQTAPTDLEAAVVALGCFWNVEAAFGALDGVA
    RTTVGYAGGQAPDPAYATLGDHAEAVRVEYAPARLRYTALLDRFWSRFDPTLTPAKRRYQPLLVPQNAEQAEQARASRAD
    AVAQDERAERVEIVGDGNFCAAALRHQKHLLRRHDDVTAALQARLPDARALARSPAATLATGYLGGHRHPSRLADDQDRL
    GLPADALSTLRAAARRHGSWNAFVQAGRST

    >gi|294508804|ref|YP_003572863.1| Peptide methionine sulfoxide reductase msrA [Salinibacter ruber M8]
    MSPPWTRRTLTGATRDFSCPPFHASFLPMPSSSTPPADASMDMPPMDRRAPADLSHAAFGLGCFWGPDALFGAQEGVVRT
    TVGYAGGGTPAPTYEDIGDHIETVRVAYDPDQISYADLLALFWTAHDPTRAPLKRQYQSALFPATPEQAEQARASRSDVA
    AAHDGALSTEIIADAPFTRAEPYHQKHKLRRHSAVADPLRAVYPADRAFADSPAAALANGYVGGHRSPTRLTDDAARLGL
    PTTATEALRTIAADRHRA

    >gi|294508848|ref|YP_003572907.1| Thiol-disulfide oxidoreductase resA [Salinibacter ruber M8]
    MPDSDRDRSPWHIVWTYVRAYWHWPVLLVMGIYIYQQYMPSIELAAEGRPAPTVAAETLEGDRFRLEDHRGEVVVVNVWA
    TW
    CPPCRVEMPGFVDLQREFENAGVQFVGIAADRGGAEAVRPFVEEKGVNFPQIVDPGLAARHFPGEAVPRTYLIDKQGR
    IRYEHSGVILKWALDDALERLVREGQ

    >gi|294508849|ref|YP_003572908.1| Thiol:disulfide interchange protein dsbD [Salinibacter ruber M8]
    MRCRRSGQRIRSTARRGARRLEMPPPSFSPSAWMRSGPRHRPSRQRWTPCVRSSSKFSRLRPPSAGAGGSFAGRPVGSFS
    VRFFGDDSCIPMLSFSFPNWVGSFAAGLLVVGGIVALVMAEQPASPAQTTGGDAAQDAPDFSLNTLDGGTFRLDDQRGDV
    VVLNFWATW
    CPPCRREIPDFVSLQNDLGDRGLQFVGVALERSAGPEEVRAFADKMNINYPIGLGDGSIAEKYGGVRGLPV
    TFVIGPEGTIRKHIPGMTTEDRIRPLLEALLRERS

    >gi|294505925|ref|YP_003569983.1| Protein sco1 [Salinibacter ruber M8]
    MIQNRLAVFGGGLFAFFLAAGALLLYLFGTDTYTVDGRVAGIQNEGRTLVVEHEKIPGYMPPMIMPLPVADSSMTAPLEK
    GDAVQFRLAVGDSASIIALRTLPDTAVARNPARTTTPIKSAADGGAQMLQQGDRVPAVLTLTNQAGESLQIGDYRGQTLV
    LTFIYTR
    CPLPTYCPLMSKQFAALQPQLRERYGEEAQLLSISFDPAYDTPQVLREYASKYTDRLDTWTFATGDSSQVERA
    TGLFGVHAQKTGSEEITHNLTTALIGPEGHVRRLWRGNDWTPEDVRQAVAQVAEAS