Salinibacter ruber DSM 13855 uid58513

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161986637|ref|YP_444230.2| mercuric reductase [Salinibacter ruber DSM 13855]
    MTDPVSYDLIVIGAGQGGGPLAGAVAEAGHDVALLERRHVGGTCVNRGCTPTKTMIASARVAHLARRAGDYGVETGDVSV
    DLETVRQRKRDIVGMFRSGSRSSIEEKDTLDLIEGDGRFVDPNTVEVTLNGDANDGGPRALTADRIVINTGTRPAIPPID
    GLDAVDFLTSTSIMELGAVPGHLLILGGGYIGLEFGQMFRRFGAEVTIIDRGEHVLGREDADVAGALEDILREDGIRLLN
    ETSMTAVEEAGGTITAHLEGDDAPARITGDELLVAAGRRPNTDALNPGAAGVATTEQGYVQVDARLATTADGIYAIGDVT
    GGPAFTHVSYDDYRVLQDHWLHGGDRTTEDRLIAYTLFTDPQLGRVGLTEEQARSRGLDVTVAQMPMTRVARALEVDETR
    GLMKAVIDSTTNRLLGAAVLGIEGGEVMSVLQTAMMGDLPVGRLRAAPFAHPTLAESLNNLFAGLDLGPAAERRADG

    >gi|83814309|ref|YP_444309.1| thiol:disulfide interchange protein tlpA, putative [Salinibacter ruber DSM 13855]
    MAPNPFGRVAPLPRRSSFGASFDSMPNPSVPHCYLKARVLVLAVSAASLLGLSAGAARAQPGPAEIGKQVPGFEIEALQD
    SGRAITPSDFEGRYVLLNLWATW
    CAPCIEKLPALREARRRYSPERLAILNVSFDRSRPKATAFLEKREMPGRHAHASGGL
    MGEFGDKFARMPTESGSGKVRGLPNMTLIGPKGKVADIAAGESADLLEMLSERLGR

    >gi|83816696|ref|YP_444481.1| heavy-metal transporting CPx-type ATPase [Salinibacter ruber DSM 13855]
    MPTCTYCDAPTDAPVTAEDVDGVFCCSGCLEAHRVADPDAHDACCHHGDGHGHAGHDPDRDTDETETAFLHVRGMHCTSC
    EDFIETVAASTDGIHEAEASYASDMAKVAYDPSRHHESDLPALLSQAGYEAHLTAPEDETADQNTAARLVFGGFFGMMVM
    VVYIVLLYPVHLGGEGLVDLSTEGGTYVLANVWAFTTFVLLVTGWPTLRGAAVSLRVLQPNMDLLVGLAAVSAYLYSGGA
    VLMGQTDVYFDVTVVIIMAVSLGHYYEDRVKRRATDLLSTLTREQVDEARRVSEGATETVAVDDLEPGDRVQVRAGERVP
    VDGTVAEGRAAVDESLVTGESLPVTRAEGDDVIGGAVVTNNALTVEVGAAAESTLDRLVNLMWNIQSSQPGAQRVADRIA
    AVFVPLVLVLAAVAFGWQWASGAPAATALLTGLSVLIVSCPCALGLATPLAVASGLRTALERGIVIRDVSLFETAPDVDT
    LAVDKTGTLTTGAMQVVDAAADAATWRRARAVEQHAAHPVARAIVEDGERVPAGDGAPARATDVRSRPRGVEGRVDGDRV
    RVGHPEWLRTEGLRMDDTLAERAEAAQENAQVPVAVGWDGAVQGLIVVGDTLRDEGLAVMDALRGDAREVVVITGDSTAA
    ARPLREHDAIDRVIAEVQPAEKSDLVRGLRDAGTVAMIGDGSNDAPALAEADVGIAFGPTALAADSADVVILRGDLTHIP
    AVFSLARAARRRIRQNLAWAFLYNAVAIPLALVGLINPLFAALAMAASSLGVVGNSARSLPVADSRPTDGNEK

    >gi|83816478|ref|YP_444805.1| pyridine nucleotide-disulphide oxidoreductase class-II [Salinibacter ruber DSM 13855]
    MRDVIIIGAGPVGLACGVEAKRRDLDALLIEKGALCNSFIGYPTRMEFFSTPGPLEIGGHPFPTRDYKPRREEALDYYRR
    VATTEDLNLRLYEPMTDLRGQDGHYTVVTENDTYEARKVVVATGFYDVPNQMGVPGEDRDKVRHYFKEPFPYALTDVAIV
    GGANSAVKAALNCYRHEANVTMVVRDSALDDGVKYWLRPDVENRIDEGSIDAYFDTTVSAIESDTLHLDTPDGPQTIDND
    FVLAMTGYRPNYDFLERLGIAIRNDEARTPVHDEEGTFETNRDGLYLAGTICGGCDTSRWFIENGRVHAEKITDHIAATL
    DPEPAVV

    >gi|83815453|ref|YP_444871.1| hypothetical protein SRU_0733 [Salinibacter ruber DSM 13855]
    MTPRRVVPECPLAAGRVCSERRRDVKRCGRVWHPGCDCRPGSRPCVVPYPTNKTFRPMHVLTTIGPDNSTKAVLPFIAGK
    GALSRGGSVALFAMQEATYLGAPSHVDLTELKAPGLPTVQAVLETLRAEDALDEFVV
    CKPCAEARGIQAADLAPWATFGG
    ADDLARQAAGHDTTMTF

    >gi|83815755|ref|YP_445002.1| periplasmic binding protein [Salinibacter ruber DSM 13855]
    MPRIVSLIPSATEIVAALGHGDDLVGRSHECDHPPGVEALPALTAPKVPLEGSSREIDDQVRALLDEAMSVYDVDVERLN
    ALRPDLILTQSQCEV
    CAVSLPTVEQAVADRIEGSPTVVALEPRSLADVRDDIRRVAGALGCPARGDRLVRRMRDRMQATS
    NAVAPADATDRPTVAALEWIDPLMGAGGWVPTLLEAAGGTPVFARRRGDLDALHKADPDRIVVMACGFGLSRTDAEMDVL
    RNDNRWAALRAVQAGHVYRADGNHFFNRPGPRLAASLDILAEILHPDRFHAAIDRSHRETAWRREPAPTPSATR

    >gi|83814344|ref|YP_445064.1| putative thiosulfate sulfurtransferase, putative [Salinibacter ruber DSM 13855]
    MRWRSSRLGRAPLLGALAILWFAVLLPRGGTAGAGPGARGIRRSTGVCAGSRPRPAALLRRSAKVVAGFSVFGCPATAFE
    SCVLSPAPSNSLASVFLLCLLPGLMEETIHTVSTEAFALQAEDPDHTILDVRPIAAYNGWPLQDESRSGHVPGAKSLPLQ
    WTQYMDWVEVLDEKGLSQNAPVTVYGYTADAAAEMADKLSRLGFEAVGVYDGFLEDWAPDPDRPLQRMERYQQLVYPEWV
    QRLRTGETPPGMRGDDHVLCHAHFGYRQDYEDGHIPGAIPLNTNALESPETWNRRSPEELKSALEDHGIRHDTTVVLYGR
    FSYPTYDQDDPAQSAGHLGAMRCAALMLYAGVEDVKILNGGISTWESAGYDVSTDDVEPAPVDDFGAEVPAHPEYMLTLD
    EAKALLEADDGDLVSVRSWAEFIGERSGYHYIDKTGRIPGAVFGNCGSDAYHMENYRNFDYTTREFSEIAGKWAEMGITP
    DKHIAFY
    CGTGWRGSEAFMNAYLMGWPNISVYDGGWYEWSSHPDTETATGVPENDVPA

    >gi|83815495|ref|YP_445121.1| rhodanese-like domain-containing protein [Salinibacter ruber DSM 13855]
    MASPAAVSSCTKGPVCLRPPRAHPDCRIPLCFRSTTQHHPSTMSTYANPDVLVSTDWAADRLDDPEVRFVEVDVDTSAYE
    EGHVPGAVGWNWETQLADTQTRDLASKEDFQSLLRSSGIDDDTTIVLYGDNDNWFAAWAFWQLTYYGHEDTKVLDGGRKK
    WLAEDRPLSTEAPDYEAGNWSASAPDNSIRAFSGYVQQTLDRDDVELVDVRSPEEFSGEKLGPDGLNEGAQRGGHIPGAH
    NISWSEAVNEDGTFKSAEELKEIYEERGITPDKETIAY
    CRIGERSSHSWFVLSQLLGHPRVRNYDGSWTEWGNLVGVPIE
    TGADPVAA

    >gi|83815050|ref|YP_445204.1| methionine-S-sulfoxide reductase [Salinibacter ruber DSM 13855]
    MPSTLLCASSGQQGFPACIGKPLSFSQVPTRPVSTLNHATLGGGCFWCLEAVYEEVDGVTEIVSGYAGGHVQAPSYRQVC
    SGTTGHAEVVQLTYDPSVIAYRDLLEIFFTIHNPTTKDQEGADVGPQYRSIILHHDDEQREIAEGLIERLEANGVFGDPI
    VTEVEPLDTFYEAEDKHQDYYERNPAQPYCQSVISPKVAKLRKKHADKLQGQSPRPTS

    >gi|83816501|ref|YP_445366.1| rhodanese-like domain-containing protein [Salinibacter ruber DSM 13855]
    MRRLFASLLCAVALQAGCSEALTWRAVNHMIAADYPDVTALTTDSLAAQLADSTSPTPVLLDARSPDEYAVSHLRGARRV
    SPSADAYPALDTLASDAPIVVY
    CSVGYRSAGVVQALQTQGFSRVYNLKGSIFRWANEGRPVYRNGEPVSAVHPYDASWGQ
    LLTDSLRASPSSESL

    >gi|83815510|ref|YP_445429.1| osmotically inducible protein C [Salinibacter ruber DSM 13855]
    MTSDIPNHQPTHPSMPTRSADATWTGNLPDGSGTMQLESGAYEGAYSFRSRFEDGDGSNPEELIAAAHAGCYSMALSNVL
    AEAGHDPESVNTTADVTLQMVEGDPTITGIHLTTEASVPGLDADTFDEHAAAAKEG
    CPVSKALAGTEITLDASLT

    >gi|83814211|ref|YP_445434.1| thioredoxin [Salinibacter ruber DSM 13855]
    MRRLLTLACTVGLLVLLTACGGEDTAETSDQAAPSASASRGPIPGKVRDVGPEPVPTLTLETLDGASIDLAARNGELLLV
    NFWATW
    CAPCREEIPDLKSLHTDFENLTVIGVALDRKGREVVKPFAQKLEINYPIVIDKSGAAEAEFGPIPGLPTTVLVT
    PDGQVTKRVVGIFPTEEMRPTLKKMLSGEA

    >gi|83816158|ref|YP_445512.1| hesB family protein [Salinibacter ruber DSM 13855]
    MTISITDRALDQIESVASNEEVDLGETLLRVAVVPGGCSGLTYDLGWETTVKDDDEVEEHDGVPVVFDKKTRLYLDGSEL
    DFTHGLNGDGFHFSNPQASRECACGESFGV

    >gi|83816794|ref|YP_445638.1| anti-oxidant AhpCTSA family protein [Salinibacter ruber DSM 13855]
    MSTTHSLSKGDRAPRFTLYTDEAQPWALSDHLDQPVVLLFFPGAFTSVCTTELNAVNNDLGSFEPAHVVGISTDAPAVLS
    EFRSTQQFEFPLLSDHDATVCAEYGAKYDQNFTAMGLDRIAKRAAFVVDPAGTIQYAEVLDDAGQQPDFDALKETVQQLK
    GDRHEH

    >gi|83815227|ref|YP_445645.1| OsmC-like protein [Salinibacter ruber DSM 13855]
    MSMPEKIRFENADGNALAARLDRPDGESPCAFALFAHCFTCSKDLRAAGAISRALTRHGIAVLRFDFTGLGESEGEFADT
    NFSSNVEDLIAAADYLSEHHEAPRILVGHSLGGAAVLQAAQRLDSVQAVSTIGAPYDPEHVTQHLQDAVEDIEEKGEARV
    QLAGRTFTIRKQFLDDLAATKMETTIRTLGRALLIFHSPVDQTVGANNAAKIFQAAKHPKSFVSLDDADHLLTDRSDAEY
    LGVVLGAWAEKYVDRSVSVPDTPDEDVVTRTEGTYRTAIQAGQHALVGDEPESVGGDDDGPTPYGFLLSALGS
    CTGMTLR
    MYADRKEWPLDETIVRLSHEKVHAEDCENCDTEQGQVDRITREIEIRGRLSDDQRERLFEIANKCPVHRTLLGDVDVRSS
    LRSRDDAQ

    >gi|83816674|ref|YP_445669.1| hypothetical protein SRU_1548 [Salinibacter ruber DSM 13855]
    MPNRLADEQSPYLRQHKDNPVDWRPWGDAAFAKAREEDKPIFLSIGYSTCHWCHVMERESFEDDDVAALLNDGFVPIKVD
    REERPDVDSIYMDVCQMMRGQGGWPLTVLLTPDRKPFFAATYLPKEGRFQQTGLMDLLPRVKQLWNSDDRAKLLDDAEQV
    TDRLQRIGDDQTDGDAPGPTLLDDAARQLAQQFDRTHGGFGSAPKFPAPHNLLFLLRHWHRTGEQAALNQVTTTLDRMRW
    GGLFDQVGYGFHRYSTDQQWKLPHFEKMLYDQAMHVLAYTEAYQATGTDRYERTAREVLTYVRRDLQAPDGGFFSAEDAD
    SLNAEGDMEEGAFYVWSIEDIREHLEPALADLVIDVYNMSPAGNYQEERTGERTGKNVLHRDQSLAAAAEQRGMEVDVLR
    DHLETARRVLLDARSERPRPGLDDKVLTDWNGLMTAALAKAARVFDDAQFEEAAVQTGRFVLDTMHDADGRLLHRYREGE
    AGIQATLDDYAFLIWGLLELYETTFDADWLRAAVEHMEAALDRFWDAEGGGFYMTPEDGEALIVRPKEANDGALPSGNSV
    QLMNLLRLARFTGRTEFEERAAALSRWAGATARRRPTGFTAMLSGLHWALGTPREVVVAGEPDSDDTNALIDVLRDDYTP
    TTVTLQRPPGDADITALAPFTESQTPVDGRAAAYVCEAFRCEAPVTDPAALREQLRTDRED

    >gi|83814484|ref|YP_445697.1| methionine-S-sulfoxide reductase [Salinibacter ruber DSM 13855]
    MTPSTQSYWLLGAALLAAVLAGGMFFQGPAPDGNAPSPAPTDSVPAAVADTATFAGGCFWCMEPPYDKIDGVASTTSGFA
    GGEEVDPSYREVASGATRHTEVVQVVYDSTTVSYERLLRVYWHNVDPFDGTGQFCDRGSQYRPAIFAHDAQQQRSAERSK
    DTVAAQFDRDIAVQVQSLDAFYAAEQYHQNYYQKNPADYKRYRQGCGRDARLREIWGEAALSDAPLDGTT

    >gi|83814598|ref|YP_445715.1| cation-transporting ATPase pacS [Salinibacter ruber DSM 13855]
    MSRPSPETETSPPDAPSHAPSAEGDACAVEPVPSERREGHSSGERGERLTLPIKGMSCASCAKSVEGALAGVDGVAEARV
    NFATERARVGLQKGRQVPVGKLAQAVADSGYEVRTAETALTVQGMT
    CASCVSRVEDALGAVEGVLEVTVNLATDRATVRY
    VPGATERTDLTQAIRDAGYEGGGTEEGGDRADVENQAREDEQRSMRRRFLWALAFALPVFVLEMGFMHIPAMEAWITDQV
    STQTLYYVLFALTSVVQFGPGRYFYKHGWPALKSGAPDMNTLVMMGTSAAYGYSVVATFLPTVLPEGTVHVYYEAAATII
    TLILAGNYMEALAKGRASDAIRSLLDLQATTARIIRDGEAVEVDVRDVGPGDVVRVRPGEKVPVDGEVVDGSSYVDESMV
    TGEPDPVSKGEGDEVVGGTINKTGSFTFRATRVGEETVLSQIVEMVEQAQGSAPPIQSLADRVVRVFVPFVLATAALTFG
    VWMVWGPDPVLTYALVSAVSVLIIACPCAMGIATPISVMVGTGRAAELGVYVREGDALQALHAADLVALDKTGTLTKGRP
    EVTDVRPRDGFGETDVLRWAAAVEAQSEHPIGAALAARAEERGLALPDATDFEAIPGHGVRATVEERDVAVGAARLMERH
    DVAIPAGAEETADRLADAAKTPLYVAVDGTLAAVVAVADPIKESTPAALDALHTLGIEVAMVTGDDERTARAIADQLGID
    RVQAEVLPDEKAAAVDDFQAGGRTVAFVGDGINDAPALAQADVGIAIGTGTDVAIESGDIVLMAGDLRGVPNAVHLSRST
    LRNIKQNLFWAFAYNVLLIPVAAGVLYPAFGLLLSPALAALAMVFSDLFVVGNALRLRRLNVPLGGEQAVATA

    >gi|83816057|ref|YP_445724.1| dihydrolipoamide dehydrogenase [Salinibacter ruber DSM 13855]
    MPSTLFAYTCDQLFLAPMATDYDCVIVGSGPGGYETAIRATQLGMETAIVEKDKLGGVCLNVGCIPTKALLKSAEVMAET
    SHLDDFGLELDGSVSPDFPSVIERSRGAANQMNQGVRFLMQKNDIDVLRGHGRLTAPDTVEIEPSVNMDGEEVGEARTVT
    GEHIILATGARPNELPFLPIDGEKVMSSKEAMLQTEQPDSLVIVGAGAIGVEFGYFYHHMGTDVTIIEVQDRMVPAEDKD
    VSKELEKAYTKMGIEVMTGANVKGVDKDAEPLRVEVETGGSTEHIECDQVLSAVGVVGNVEDIGLETVGVETEGGDIVVD
    DYYRTNVDGVYAIGDVTGAPWLAHKASHEGILCIEKIAGHDVRPMDPNDIPACTYCQPQIASVGHTEEEAREAGYDVKVG
    TFPFKANGKAAALGHQEGFVKTIYDEKYGELLGCHIIGEDATELISEVVAARTLETTGLEIMESMHPHPTLSETVMEATR
    EAYGQPINI

    >gi|83816184|ref|YP_445773.1| hypothetical protein SRU_1654 [Salinibacter ruber DSM 13855]
    MRIVSLLPAATEWICVFGGEDQLVGRSHECEYPEQVQDVPAVTAPTYASDGDSAAIDDAVQGQLQDGLSLYDVDLERLRA
    LEPDLIVTQDQCEV
    CAVSLPELEVQLGEWAGKRPEVVSMQPQTLKEVLDEALRLARAMEALDTAMEVIANLETGLRVLRD
    QIGVDRSTNPQSLPSVACVEWLEPLMVAGHWMPDVVEMAGGRPLIGTAGTPTAPIEWDELRAADPDALALMPCGFTIDET
    RRDLHYLTNRPGWDALSAVEDQRVALLDGNAYFNRPGPRLYRAIEVLASVLHPEALRPEPPIAAWERQWLHASDPTPA

    >gi|83814846|ref|YP_445780.1| vitamin K epoxide reductase family protein [Salinibacter ruber DSM 13855]
    MPLVQTLRERLRGYRPRLEAVVFGLSLLGVLDVVHLLIQQARTFENGCLGGSALGGGSSIFDCAAVTAGAGSKLLGVPNT
    TWGLGFYGMVGVLTVAVFWVVPKVRAWIHGARIGLLTGGIAYSAYLTYLQIGPLGTLCLLCLGSALITTLLFAGQVALLA
    SSPTSPPDSMSSRLVKRQVALFVYCAAAAAVLVGMDLVYFDETSAAAPQPRSASESAAPAQCELDDSKTPLQDQGASLVG
    FQDITAGSNEAGVTVIEYFDPN
    CPHCKDFHQVMKQVVEAHRDEVRFVYKPFPLRRSSLPEIQALYVAAQSDKFNEMLEAQ
    YARQGPGGIGMQDLRAIAEEIDLDPSVLSERVEQNEYRDQVLQQRKRAVKVGVDSTPTVLINGHFVESRTQKCLNTFIEQ
    AKSGTLGGTASG

    >gi|83816782|ref|YP_445931.1| methionine-R-sulfoxide reductase [Salinibacter ruber DSM 13855]
    MAEIDSSRPSNDTLRDELTEEQYHVTQEAGTEKPFSGQYWDHKGDGLYRCVVCETPLFDSDTKFESGSGWPSFYDVVEDG
    NVHLTSDHSLGMRRTEVVCDECGAHLGHLFDDGPEPTGQRY
    CINSAALAFDGDE

    >gi|83815308|ref|YP_446148.1| MoeZ/MoeB domain-contain protein [Salinibacter ruber DSM 13855]
    MPTTTTDPNQKQAELSPDELQRYSRHLTLPEFGREGQEALKNASVLLVGAGGLGSPAATYLAAAGVGRIGLVDFDSVEAS
    NLQRQILYGTSDVGRPKLDAASERLEDLNPHVDVETHEVRLTSDNALDIIDQYDVVADGTDNFPTRYLVNDACVMTGTPN
    VYASIFRFEGQVSVFATEDGPCYRCLYEEPPPPGLVPS
    CAEGGVLGILPGFIGTLQATEVIKVLTGVGEPLVGRLLMSDA
    LNMDFRTVNVPTNPECPVCGDDPTVTELIDYEAFCGLPQSDESSPNGTADSDVSDTDDAVPETSVHDLKQRRDAGDAPFV
    LDVREPYEAEIASLDADQLIPVDDLEARLDELDAGPEEEIVVH
    CRSGARSAKATAFLREQGYDASNLEGGVLAWSEEIDD
    SVPQY

    >gi|83816619|ref|YP_446177.1| hypothetical protein SRU_2071 [Salinibacter ruber DSM 13855]
    MALTESTMMDLGQSAPDFSLPVANPEVDDRGDAQRSLADYDEADALVVVFMCNHCPYVQHIEGALIDVAQEYQDRGVQFV
    GICSNDPERYPDDSFDNMAERAREKGYPFPYLQDETQEVATAYKAACTPDIYVFDDDRALAYRGRFDDTRPDGDEAHGDD
    LRQALDELLADGAVTMEQAPSMGCNIKWKPNSTPAHAAQ

    >gi|83816586|ref|YP_446215.1| methionine-R-sulfoxide reductase [Salinibacter ruber DSM 13855]
    MDRKTFLKHLGWAAVAPLALTACTPSRSTPASTSAPDTLGVHTLPEDFPPLDKSEEEWRRLLTKSEYQILFEAGTEPRRS
    SPLLDETRTGTYICAACRLPLFSSKTKYESGTGWPSFWAPLDGQVDTKKDTKLGYTRTEYHCARCGGHQGHIFEDGPDPT
    GLRY
    CNNGLALSFVPADASLPDLRT

    >gi|83815507|ref|YP_446262.1| thioredoxin [Salinibacter ruber DSM 13855]
    MLWALGVRNSRGGRKHFPALLVKSTGLCILLHSRLPPMSYEVNDFETDVLDASADTPVLVDFWAPWCGPCQQLSPVLESL
    AEATDDWTLVKVNVDDHPSAAQEYGVRGIPAVKLFVEGDIEAEFAGVKPKPQLESWLDEHLPSEEKSRIEEAKEALEAGS
    HQEAEHLLWPVLEDNPDHDEAQVLMARALAFKDPNRAQVLAQEAEVADPTLRQMRDGVETIARLLELAEDPSALPENGVK
    DTYVAALDALADQDFDAALDQFIDVVRTDRNYDDDGARKACVALFTLLGEQHPVTQEHRRTFDMALY

    >gi|83815168|ref|YP_446284.1| 6-O-methylguanine DNA methyltransferase [Salinibacter ruber DSM 13855]
    MGSINPPSSFYDSVWRVVAQIPVGRVTTYGDIAAHLGRRGAARIVGWALKDAVGGDLPCHRVVNRNGVLTGRRHFETPHV
    MAERLRSEGVTFVAEDQVDLDAHRWRPGKR

    >gi|83816306|ref|YP_446288.1| putative 6-O-methylguanine DNA methyltransferase family protein [Salinibacter ruber DSM 13855]
    MSVSGPCLSCDTPGCTMQAHSDSDESFFERAWAVVAQIPVGRVTTYGDIAAHLGRRGAARIVGWALKDAVGGDLPCHRVV
    NRNGVLTGRRHFETPHVMAERLRSEGVTFVAEDQVDLDAHRWRPGEAE

    >gi|83815658|ref|YP_446384.1| redox protein [Salinibacter ruber DSM 13855]
    MVQIDTDYIGDLRCEAEHGPSGVTLTTDAPEDNHGEGRSFSPTDLVATALGTCIATILGIQAEKHALDLDGIEISVEKEM
    ASNPRRIASLRTDVTMPTALDAQTRERVERAARH
    CPVDESIHPDIEVPITFHWPGGGAAS

    >gi|83816179|ref|YP_446491.1| mercuric reductase [Salinibacter ruber DSM 13855]
    MFFETKALGPTALSPVWGHERPVGTSPVRTTGGSRGLRPSFCSGRSPAWPVGRVTRGRVSGGPVVTTEAPSSTVHHPEVS
    SSSLVSMTTDYDVLVIGGGAGGLSAAGIATNLGAKTAMIERDALGGD
    CTWTGCVPSKTLLKAATVVHQARTASKYGLTDQ
    SVDVDFGGVMDHVRQVRQEVYEEADAPEIFEDLDIDVREGDAHFIDAHTVGVERADGSTEQVTGRYVIVAAGARPLVPPI
    EGLGEVDVLTNESLFELEEQPERLAIVGGGPIGTEMAQAFARLGTEVVVLDMADRILSNDDAELAATLRETLEEEGVEYV
    LGAQVEKVAQSGGTITISAGEQGPVEADALLLATGRTANVDGLHLDAAGIDYTRQGITVDDRCRTSQGHVYAVGDVTGRY
    QFTHMSNHMAKVAVTNALLKVPSKIDADHVPWVTYTEPELAHVGAHAADLDEQGVSYETYRFPYDQLDRAITESETTGQI
    KVHATSLTGKILGASVLGERAGELITAFTIAMRNGVTLRNIGDTIHPYPAYGEGVRRVADQWYVQKQSPTVTKMLQTVFG
    YRGPVLKYGPDEIV

    >gi|83815942|ref|YP_446531.1| SoxW precursor, putative [Salinibacter ruber DSM 13855]
    MREGARLVGRFRGRGGRNLLLLNPIGQGTFHPQRCFVTMRLLFAVRSFVLVAVLVLAMGPGRAHAQMEMPPRSLGAVIEQ
    AEAQEAPILLEVYAPW
    CPYCQRMQENVYADAEVRSYLDRRFTYARLNRDTTGGTHRFNGRTLSSKELGMALGARGVPTTV
    FMKPDGTPIAKQPGYIKRPVFLQMLRYFGSGAYEEQSFEAFRARASE

    >gi|83815355|ref|YP_446545.1| hypothetical protein SRU_2446 [Salinibacter ruber DSM 13855]
    MHPALLLAVGLALLTGGAHPASAQSQDTIRVAGTVLAPDEAAQARRLLRAELGPTSRHWTRLQDSTKRFAAAKTAFQIGR
    VAYPRAWSDSVLTFLREAGTRHPDPAVRAEFLFGGLQVASSAERGETQDQFYRRLTDGHEGTHYATKARRLFDPDSQIQA
    GKPLPDFEIPALSDPTATYTKRDFEGQTVLIDIWGTW
    CGPCIRAMPHLHEAYRTHGGEDFTILSVAMRDTREAVKQFRAH
    KWEMPWDHAFVPKGSDLQKKLRGRFDIQGLPATILVGPDGQILRVHRGVGSGKKMARAISEVLAQDLDSENAPSEGAHSE
    DASGQESNASL

    >gi|83815482|ref|YP_446560.1| arsenite S-adenosylmethyltransferase [Salinibacter ruber DSM 13855]
    MTRPHASADDLKSTVRAKYAALATADDSCCGPSGSGEAGLDVDMSEDYADAIATDADLDLGCGRPTDHAGLQPGERVLDL
    GSGAGMDAFVARRTVGPDGHVHGVDFAEEMVAKARANADTLDYDNVTFEVGDIEALPVESGAFDVILSNCVLNLVPDKEA
    AFAQMHRALRPGGRFSVSDVVHAGALPDGLREAAELYVG
    CVAGAMERDMYLDRLREAGFSDVHIATEKPISLPDELLAEH
    LGAAELDRFRAGDAALQSVTVVGRRPDATA

    >gi|83816367|ref|YP_446755.1| thioredoxin [Salinibacter ruber DSM 13855]
    MAESANVITLTDDNFEDEVIGADQPVLVDFWATWCGPCRQIAPIVEELADEYEGQAKIGKVDVDENPQTAQEYGVRSIPT
    LLFFKDGEAKEQVVGAAGKQPLKENLEALLGQPA

    >gi|83815356|ref|YP_446756.1| thioredoxin-disulfide reductase [Salinibacter ruber DSM 13855]
    MPAPFARSVLTFSTALMHENGALANGNQTNGHQHPDLAAFEDVDFSEAEMRDVVVIGTGPAGWTAALYTARADLSPLIFM
    GPEPGGQLTTTTDVENYPGFPEGLMGPEMMDRFQDQAERFGTESRYGTVTHVDFRERPFRLLIDGETPVYAQTAIISTGA
    SARYLGLENEQRLIGKGVSA
    CATCDGSFFRGETVAVVGGGDSAMEESTFLTKFAEKVYVLHRREELRASEIMQQRAFEND
    KIEFVWNTEVIDVLGESAVEGIEVINNETGETRLMGDVTGFFLAIGHTPNTGPFEGWVQMDETGYIQTEGASTYTDVPGV
    FACGDAQDSTYRQAVTAAGTGCKAAIDAERWLSEHGAAEAPRADANRQPVEA

    >gi|83816550|ref|YP_446802.1| hypothetical protein SRU_2710 [Salinibacter ruber DSM 13855]
    MSMTTRHPRVLCAALVVGLLTAAALPATSMAQTNQAEVGEPAPNFTLQAADGDEHSLADFEGQYVVLEWLNFGCPFVGKH
    YGSGNMQRLQDTYTDEGVVWLSIVSSAPGKQGYYPPGEMVEQKKKHDGNMTAILMDPEGEVGKTYDATVTPHMYVISPEG
    ELLYRGGIDDKPTTDEADIEGATNYVRMALDAAMNGEEVRPKRAEPYGCTIKYASK

    >gi|83814748|ref|YP_446803.1| thiol:disulfide interchange protein DsbD, putative [Salinibacter ruber DSM 13855]
    MNHSGKLGYTQSARRLPARRPQPLMTSFQRSSGRRCLVLGVWLLVVLWGSGAATPLQAQSQASDDPSPHSEATLVSEQDA
    IVPGEPLTVGLRLNMEEGWHSYWKNPGASGEPTSIDWALPEGYETSGFQWPYPHQIEFGSLISYGYSDEVLLIATVTPPD
    TLTPGTTATLGGRAKWLICEEICLPAHSDVEVTLPVAEEASPKPGRASAFEAARAKHPKRVSDWSVGAGRSEGRYTLILG
    APDGARPDLEGAYFFPAEKSVVDPGAPQPVTRNGDTYTIALRQSEYAQAPADRLRGVLVAPEGTGWDPDGRVRAMQVDVP
    VDSTLSAADAMGAGASSAGGGLSLPWALAFALVGGVLLNLMPCVFPVLSVKILGFAEEAGGEAGAMRRHGLLFGAGVLGS
    MWILAGGLLALRAAGSQIGWGFQLQSPIFIALMTMLFFGIGLNLLGAFEVGTTLMGWGGRMEAAASGGGNLSAFLTGVLA
    TVVATPCTAPFMGAALGVALTLSTVGALLIFTALGVGMAAPYVVLSTTPALLDRLPDPGAWMETLKQAFAFPMFATAIWL
    VWVFGQQTSTGGVAFLLAGLLLLGVAAWIVNRWSAPQLSQTATLVTRGLAGAALVGGIAVAVIGAGSAPAEQQATATATD
    ASGTDTTWRSYAPETIESLRAEGRPVFVDFTAAW
    CLTCQVNKRRVLTAESVQNAFDEKDVALVRADWTSRDPEITRALES
    HGRSGVPVYVLYAGDGSEPELLPEVLTEDAVLNALDDLSSTVAATHEPH

    >gi|83814774|ref|YP_446861.1| peroxidase-related protein [Salinibacter ruber DSM 13855]
    MAWIDVIDPDDATGDLKELYDTIAEQRGKVSNVLTVHSQNPAALKEHLDLYDAVLFGASPLSRADREAIAVVVSAANECD
    Y
    CVRHHAEALQAYWQDEDRVHQLADDYTKLDALDDRLRTACAVAEKLTAAPGAMAEADVHALRDAGWSDRAVLDIVLVTS
    YFNFVNRITNGLGVEATEEEAAGYNY

    >gi|83814281|ref|YP_446866.1| hypothetical protein SRU_2774 [Salinibacter ruber DSM 13855]
    MATTTAEETAAEQVHEKAEQALGFVPNLITEITDENPAVADAYLTSQALVEEGGVLSAAEQQAVILAVSSYNDCHYCTKA
    HAVAGQQAGLDAETVETINEGGLPSDDRLKSLVRATRRIFGKRGWLSDVDEAEFADLGLERPELYEIVALAGIKTISNYV
    NHIADTEVDEPFQT

    >gi|83816490|ref|YP_446867.1| putative methionine sulfoxide reductase [Salinibacter ruber DSM 13855]
    MSETACRKLLDAPTKTAAMNRRRPSAPASPLGGRSAFFVGATPRSSGPEPTRPDCAINVPVRTFDEHPAAPMAPPTDAAM
    QPPPMDQTAPTDLEAAVVALG
    CFWNVEAAFGALDGVVRTTVGYAGGQAPDPAYATLGDHAEAVRVEYAPARLRYTALLDR
    FWSLFDPTLTPAKRRYQPLLVPQNAEQAEQARAAWADAVAQDERAERVEIVGDGNFCAAALRHQKHLLRRHDDVTAALQA
    RLPDARALARSPAATLATGYLGGHRHPSRLADDQDRLGLPADALSTLRAAARRHGSWNAFVQAGRST

    >gi|83815577|ref|YP_446868.1| peptide methionine sulfoxide reductase [Salinibacter ruber DSM 13855]
    MSPPWTRRTLTGATRDFSCPPFHASFLPMPSSSTPPADASMDMPPMDRRAPADLSHAAFGLWCFWGPDALFGAQEGVVRT
    TVGYAGGGTPAPTYEDIGDHIETVRVAYDPDQISYADLLALFWTAHDPTRAPLKRQYQSALFPATPEQAEQARASRSDVA
    AAHDGALSTEIIADAPFTRAEPYHQKHKLRRHSAVADPLRAVYPADRAFADSPAAALANGYVGGHRSPTRLTDDAARLGL
    PTTATEALRTIAADRHRA

    >gi|83815428|ref|YP_446909.1| cytochrome c biogenesis protein, thiol:disulfide interchange protein [Salinibacter ruber DSM 13855]
    MPDSDRDRSPWHIVWTYVRAYWHWPVLLVMGIYVYQQYMPSIELAAEGRPAPTVAAETLEGDRFRLEDHRGAVVVVNVWA
    TW
    CPPCRVEMPGFVDLQREFEDAGVQFVGIAVDRGGAEAVRPFVEEKGVNFPQIVDPGLAARHFPGEAVPRTYLIDKQGR
    IRYEHSGVILKWALDDALERLVDESMRSDLKQSRLRR

    >gi|83815854|ref|YP_446910.1| thioredoxin, putative [Salinibacter ruber DSM 13855]
    MRSGPRHRPSRQRWTPCVRSSSKFSRLRPPSAGAGGSFAGRPVGSFLVRFFGDDSCIPMLSFSFPNWVGSFAAGLLVVGG
    LVALVMAEQPASPAQTTGGDTAQDAPDFSLNTLDGGTFRLDDQRGDVVVLNFWATW
    CPPCRREIPDFVSLQNDLGDRGLQ
    FVGVALERSAGPEEVRAFADKMNINYPIGLGDGSIAEKYGGVRGLPVTFVIGPEGTIRKHIPGMTTEDRIRPLLEALLRE
    RS