Bacillus cereus B4264 uid58757

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218235938|ref|YP_002365100.1| FrnE protein [Bacillus cereus B4264]
    MKIEVWSDFVCPFCYIGKRRLEMALEQFPHKKDVEVEFKSFELDQSAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKNQGKEKEITENLLFAYFTESKNLSDVDTLATIAEASGLDKQEALNVINDKN
    AYANDVRIDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPTPKLQELSSEGGSDLSCTDGSCSVPS
    KEQ

    >gi|218235324|ref|YP_002365172.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus B4264]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGENTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNPGITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|218234783|ref|YP_002365173.1| peroxiredoxin [Bacillus cereus B4264]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKDLGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|218234297|ref|YP_002365230.1| hypothetical protein BCB4264_A0452 [Bacillus cereus B4264]
    MTTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNCVLENYDYVEKIEILLQDMQEIAGRYGVFTGPTILLFHNG
    KEILRESRFISLENLERIIQLFEE

    >gi|218236119|ref|YP_002365319.1| bacterioferritin comigratory protein [Bacillus cereus B4264]
    MITVGEMAPEFTLEGSNGEEVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGVFQEKDTVILGVSPDSANRHLKFI
    EKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|218233246|ref|YP_002365341.1| hypothetical protein BCB4264_A0580 [Bacillus cereus B4264]
    MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLK
    EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVNVEQ
    FKKDLHSKDIKEKVSKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK

    >gi|218232206|ref|YP_002365394.1| heavy metal-transporting ATPase [Bacillus cereus B4264]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMILETAQNKENEVVTEAKQLVTKLEPHIKVQEEQK
    NKIAKEVFILEGLD
    CANCAMKIENKVKEMPAVSEATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKN
    DHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMVTIPLFVLAYLLIGGDIVWRAIRNITRGQVFDENFLMAIA
    TVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENIEFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKPVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVKIAKRTRSIVWQNIIFALGVKGIVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|218235416|ref|YP_002365440.1| hypothetical protein BCB4264_A0680 [Bacillus cereus B4264]
    MKLTIKHDDIEADLSYGQLAIGKENGYSPLQLLISSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAENITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|218232275|ref|YP_002365527.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus B4264]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGKITIVDRDYVDWSNLQRQQLYAESDVKNNLP
    KAIAAKKRLEEINSDVTIEALVQDVTAEELEELVINVDVIIDATDNFETRFIVNDISQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDMWKNEYSCMNVQKLRQHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPHKDEMNFEQYKELLEGRVNDLNINPYLLSFSVEDKRLVAFKDGRVL
    VHGTKDISEAKTIYHRYFG

    >gi|218235917|ref|YP_002365548.1| thioredoxin [Bacillus cereus B4264]
    MKKMLIFGGIIIALFAAIFAVTQMEEKNASTSQKIDNATGSQTDGPDYYTNKISLSDLQKNLKEKKEETVYFYQTSCVHC
    QKLSPVVVPMAKDLNVDMKVMDIEKLDAPWDEYKIQGTPTIIHFKDGKEVSRISGEQPKDKLKEWLEQTKK

    >gi|218233479|ref|YP_002365563.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus B4264]
    MFRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVKINKEEKTITIKNVTTDETYNEEYDVLILSPGAKPIVPPIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRYATVIG
    GGFIGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKVHNVELVFEDGVDALEENGTVVRLKSGSVIKTDMI
    ILAIGVQPESSLAKDAGLSLGVRGTIKVNEKFQTSDPYVYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    ESLYKGTMGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGTQALGRDG
    VDKRIDVIATAMKANLAVIDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVETVQWHEIDRIVDNGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLDEVPMDKEIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERVVY

    >gi|218235754|ref|YP_002365565.1| rhodanese domain protein [Bacillus cereus B4264]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEIKATDKGSTVDIQSWANKVGHQYIGTKQEGDVLMHYIRKAHEH
    EVNEVAKYPHTITNAELEEILLSEEECIVLDVREAAEFAFGHIPSAISMPLGELDSAVLDETKQIYVV
    CRTGNRSDVACH
    MLKEKGYANVKNVIPGMLEWQGNIEK

    >gi|218235004|ref|YP_002365566.1| metallo-beta-lactamase family protein [Bacillus cereus B4264]
    MNVKPLQAKDVAEKVLFGELFILDVRNEADYEDWKIEGKQVSSINRPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAVRTAEAYEEFAKE
    HGVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKIVIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQNLVVLPAHYSKISEMNESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYEEIRQTNMGKIHPSVDKEREMEIGPNRCAVHE

    >gi|218231139|ref|YP_002365568.1| rhodanese-like domain protein [Bacillus cereus B4264]
    MNTILSTLFIVLAAWFVISRFLPVKGVQNINGKELKSIVGKKGKYFIDVRTVGEYRGNHMKGFQNIPLNDLASKANQLDK
    NKEVIVI
    CQSGMRSKQAAKVLKKLGFQQVINVSGGMNGL

    >gi|218231586|ref|YP_002365975.1| transcriptional regulator Spx [Bacillus cereus B4264]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|218233991|ref|YP_002366039.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus B4264]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFREKYGIDAKVRHEV
    TKVDTEKKMVYAEHTKTKDVFEFPYDRLLIATGVRPVMPEWEGRELQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHHIEILTNENVKAFKGNERVEAIETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRKNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPLGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMDLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|218234648|ref|YP_002366254.1| thiol-disulfide oxidoreductase [Bacillus cereus B4264]
    MKKNRLLFRVIILLILCGAVGFTLYQGFFANKEKMQIGKEAPNFIVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQT
    KEQLEGYLKKITP

    >gi|218234117|ref|YP_002366357.1| rhodanese-like domain protein [Bacillus cereus B4264]
    MIVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEGHIPHALYFDLNLDLSSPIAEHGGRHPLPNIEEFADKLSEAG
    IDEHTTVIAYDSQAGANAARLWWLCNYVGHEKVYILDGGFPAWKENGLPTTTEIPVVIRKTFKANIQDHMLVTMETVREN
    IRAGADVTLIDSREPKRYAGVEELVDHKAGHIPTAVNHFWKDGMLQSGQFKNEAGQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|218235053|ref|YP_002366512.1| thioredoxin family protein [Bacillus cereus B4264]
    MKKLIAIILVGALAWAGVNFYNSKKEEKERKAKQAELQEKEVLPQVGFKAPGITLKGLDGKLQSLNDAKGKPYIINFWAS
    W
    CGPCEMEAPDLVHMYDKYKKDVEIFAVNATVSDPVQEASAFANRYGFEFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVDHVRGVLPPDQLEKKFKKLIES

    >gi|218231395|ref|YP_002366566.1| peptide methionine sulfoxide reductase [Bacillus cereus B4264]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYQKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHNETQKGLAEKSKQALAESGMFKDPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|218235153|ref|YP_002366593.1| hypothetical protein BCB4264_A1875 [Bacillus cereus B4264]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEQIEAGK

    >gi|218232405|ref|YP_002366639.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus B4264]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIEDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|218232565|ref|YP_002366746.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus B4264]
    MYQAYYESELGLLEITANQEGITSVIFVDERQEENKNEMIEQCINELDEYFKGKRKEFTVPLSAEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNIKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|218232657|ref|YP_002366833.1| methyltransferase [Bacillus cereus B4264]
    MTKFNWHESAEKKWDSSAEFWNQNSQEMWDSGSRSTIIPFFEQYVKKEAQVLDVGCGDGYGTYKLSSAGYKAVGVDLSEV
    MIQKGKERGEGPNLSFIKGDLSALPFENEQFESIMAINSLEWTEEPLRALNEIKRVLKKDGYACIAILGPTAKPRENSYP
    RLYGKDVV
    CNTMMPWEFEQLAKEQGFEVVDGIGVYKRGVNEKMLGQLPTELQQSLTFLWVFMLKNV

    >gi|218235495|ref|YP_002366848.1| glutathione peroxidase [Bacillus cereus B4264]
    MTVYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|218231521|ref|YP_002366858.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus B4264]
    MQERYSRQVLFSRIGEMGQRKIRKKHVLLIGAGALGAANAEALARMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRKINSEVEIVPVVSDVTLQEIKELTKEVDLILDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDFEALRGTMLSFDIWNNQYLSLKVNRQKKNTCP
    SCGNTRTYPSLTFEAQMKTEVLCGRNTVQIRSGVKRVLHLEEVQKRLQKSVHVQKTPYLLSFVIDEYRFVLFTDGRAFIH
    GTNDVKLAKRLYAKYIG

    >gi|218234224|ref|YP_002367010.1| thioredoxin [Bacillus cereus B4264]
    MKEIKTEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|218231489|ref|YP_002367490.1| dihydrolipoamide dehydrogenase [Bacillus cereus B4264]
    MSKLVVIGGGPAGYVAAITAAQNGKGVTLIDEAELGGTCLNVGCMPTKSLLESAEIHDIVRKANDYGVTLNTGSISIDWD
    QIQARKSQIVMQLVQGIQYLMKKNKIKVVKGKAKFETDHRVRVVQGNKEEVVDGESFIIASGSEPTELPFAPFDGKWILN
    SSHAMSLESVPSSLLIVGGGVIGCEFASIYSRLGTKVSIVEMAPQLLPGEDEDIANILREKLEKDGVKIFTGAVLKGLNN
    YKKQASFEYEGITHEVTPEFVLVSVGRKPRVQQLGLEKAGVQFSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLSEKGAREQYGDILIGEFPFTANGKALILGEQVGKVKVIVEPKYQE
    IVGISIIGPYATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALMQAVGHAVHA

    >gi|218233815|ref|YP_002367549.1| carboxymuconolactone decarboxylase [Bacillus cereus B4264]
    MEHEQHSSINDILHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGALTKREKQLIALGISLATQDEYCTIYHTKGCLDQG
    CSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|218231257|ref|YP_002368115.1| transcriptional regulator Spx [Bacillus cereus B4264]
    MVILYTTASCASCRKAKAWLEEHQIDYIEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY
    TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN

    >gi|218233289|ref|YP_002368212.1| hypothetical protein BCB4264_A3508 [Bacillus cereus B4264]
    MTKNNETGWNLDNSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGLTPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLKSLADYTIKRHYPEIESHENQYTALLQEVIKRQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQAHSLIEQLLKMMEKYKADYTNTFRSLTLDAIENTALFESPEFKEWY
    KLWQSRLDRQEQSKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNDDYSVMEKLLEALSNPYAYSTDQEEYCIPPAPTNR
    PYRTF
    CGT

    >gi|218233109|ref|YP_002368227.1| hydroxyacylglutathione hydrolase [Bacillus cereus B4264]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPSRYIEQYIEFAKKEGMEVIAAAETHIHADFLSGSRELSNLYHANLYVSD
    EGDCDWKYQYLNEGRYKLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGIKDTAKIGAKQLFDSIQKIKILPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFRCNEESDFISTLL
    TGQPEPPKYFSLMKNLNKYGPPIRKKRKSTAINTVEELQEILKSVYQIVDIRDVESFAAGHIEKSINIPYNNSFTTWCGW
    LLDYKKETLIILDEEKVKVEAVIREFESIGLDNIIAFAPLKVIQRLDRFESYKEKTSIELYPHIKGGSVKVIDVRSKKEW
    EEGHLHDAIHITLGNLFEQLDYIPKDFPIVLQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWKEEGLPYTTCNLKV

    >gi|218234160|ref|YP_002368379.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus B4264]
    MADRYSRQQLFKPIGSKGQEKIRNKHVLIVGAGALGSASAESFVRAGVGKLTIIDRDYVEWSNLQRQQLYSEQDAREKMP
    KAIAAKNRLEQINSEVQIHAFVMDATSENMEGLLKNVDVIIDATDNFDIRFVINDLSQKHNIPWVYGSCVGSYGMSYIII
    PQETPCLHCMLKNIPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFSAIRKTFFMFDIWSNQNHFIKLGKIKTDAC
    LSCGLNRTYPYLSYENQTKAAVLCGRNTVQIRTVDNRKYNFDDIEKVLKKLGKVDRNPYLLSCQFDDYRIVFFRDGRVFI
    HGTNDISKAKQLYYRVFG

    >gi|218231635|ref|YP_002368424.1| ahpC/TSA family protein [Bacillus cereus B4264]
    MWRKLTIIVVLLCLAGYAAYEQFGNKEQAVKVKQEKSEAAMKEIIARNGIEIGKSAPDFELTKLDGTNVKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAINYTPSEKGGGEEKVSNFIKEKGITFPVLLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRVAKLK

    >gi|218234304|ref|YP_002368533.1| copper-translocating P-type ATPase [Bacillus cereus B4264]
    MNEKKEANLQISGMTCAACANRIEKGLKKVEGVHEANVNFALEKTKIMYDPTKTNPQQFKEKVESLGYGIVSEKAEFTVS
    GMT
    CAACANRVEKRLNKLDGVNKATVNFALESATVDFNPDEVNVNEMKSAITKLGYKLEVKPDDQDASTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSKHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEIKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKSIGDVVIGSTINKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNENELLRLVGAAERNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKHLLIGTRRLMKKFNIDIEEVSKSMEALEREGKTAMLIAIDKEYAGIVAVADTVKDTSKAAIAR
    LKKMGLDVVMITGDNTQTAQAIAKQVGIDHVIAEVLPEGKAEEVKKLQANGKKVAMVGDGINDAPALATANIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNALGIPIAALGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLKS

    >gi|218233766|ref|YP_002368534.1| copper-ion-binding protein [Bacillus cereus B4264]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSAVTLKDIVAVIEDQGYDVQ

    >gi|218235164|ref|YP_002368545.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus B4264]
    MNSYKNNYIYWTLLTHKNWRFHIAATENGLCFIGSQDENFEELNIWARKKLPQHILIHSPDYLQIYTKEVIEYLENKRET
    FTFPIDAYGTNFQLSVWNTVREIPYGKTYSYTEIAERIQKPKAVRAVASAIAANPLLITIP
    CHRVIGKNGKLTGFRGGLE
    MKKKLLTLEKLQVEFI

    >gi|218233948|ref|YP_002368770.1| dihydrolipoamide dehydrogenase [Bacillus cereus B4264]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVNIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|218236113|ref|YP_002368789.1| glutaredoxin family protein [Bacillus cereus B4264]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVAYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|218233026|ref|YP_002368966.1| dihydrolipoamide dehydrogenase [Bacillus cereus B4264]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIAAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGRALHA

    >gi|218235422|ref|YP_002369013.1| rhodanese-like domain protein [Bacillus cereus B4264]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLIKTLTEEEFRAGYRKAQLIDIREADEYNAGHILGARNIPLSQIRLRHKELR
    QDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKSWTGKIKKK

    >gi|218232820|ref|YP_002369275.1| organic hydroperoxide resistance protein [Bacillus cereus B4264]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|218233638|ref|YP_002369316.1| thioredoxin [Bacillus cereus B4264]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|218231825|ref|YP_002369434.1| thiol peroxidase [Bacillus cereus B4264]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYAEYVSEGTSHPNYEAALE
    AAKSAK

    >gi|218234302|ref|YP_002369492.1| thioredoxin family protein [Bacillus cereus B4264]
    MKSLESMEQFQQLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|218233956|ref|YP_002369506.1| conserved hypothetical protein TIGR00275 [Bacillus cereus B4264]
    MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|218235554|ref|YP_002369522.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus B4264]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLRAINSEVEITPVVTDVTVQEMEELVNDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIL
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFGALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEGQTKTEVLCGRNTVQIRPGVRKNFNLEEIKKRLQRSVEIKATPYLLSFPVEEYRFVLFTDGRAFIH
    GTNDMNVAKSLYARYIG

    >gi|218235144|ref|YP_002369527.1| rhodanese-like domain protein [Bacillus cereus B4264]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPHKVDFFNKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|218234729|ref|YP_002369569.1| hypothetical protein BCB4264_A4884 [Bacillus cereus B4264]
    MYVTVTEAAYKKIMDTIPSEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSTMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|218235194|ref|YP_002369735.1| hesB/yadR/yfhF family protein [Bacillus cereus B4264]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|218233631|ref|YP_002369738.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus B4264]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAREYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVNIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGLLWMYKYHKG

    >gi|218230936|ref|YP_002369791.1| putative thioredoxin [Bacillus cereus B4264]
    MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEGLKIGMLDLNYAPHLAKEYGIESVPCLLVFENGT
    LMKKIYAFHSVEYLYTELK

    >gi|218230987|ref|YP_002369795.1| hypothetical protein BCB4264_A5136 [Bacillus cereus B4264]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ

    >gi|218235468|ref|YP_002369912.1| glutaredoxin family protein [Bacillus cereus B4264]
    MKVVLYTKKDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEMDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|218230847|ref|YP_002369933.1| thioredoxin-disulfide reductase [Bacillus cereus B4264]
    MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELIVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKIPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|218235061|ref|YP_002370214.1| peptide methionine sulfoxide reductase [Bacillus cereus B4264]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDIGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELEQSGRFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQYYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLILFGNK
    K