Saccharopolyspora erythraea NRRL 2338

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|134096725|ref|YP_001102386.1| peptide methionine sulfoxide reductase [Saccharopolyspora erythraea NRRL 2338]
    MALFGDPFSSHKVRMVEPGDALAGRSTPMPVSEWHAVHPDRRIVPPFPEGLATAVVGMGCFWGAERTFWRTEGVWSTAVG
    YAGGYTPNPTYEEVCSGLTGHTEAVLVVFDPKVISYEQVLKVFWENHDPTQGMRQGNDVGTQYRSAIYYADDQQRQIAEA
    SRDQFQAALTAAGHGTVSTELAPLRDFYYAETYHQQYLSDAKNPNGYCGIGGTGVSCPVGLAMPGDS

    >gi|134096741|ref|YP_001102402.1| rhodanese-like [Saccharopolyspora erythraea NRRL 2338]
    MQPEDLPENLPGEGTALLDVREHNEWAAGHAPGAVHIPMSQIPSRLGDVPEADQLYVVCRSGGRSAKVTAYLNANGWDAV
    NVERGMNGWAASGRPLTGEDPDSEPFVL

    >gi|134096804|ref|YP_001102465.1| organic hydroperoxide resistance protein [Saccharopolyspora erythraea NRRL 2338]
    MNVLYTAEATVTGQGRSGHIRSSDGTLDTGLSMPRELGGAGGAGTNPEQLFAAGYASCFHSALHLVAGRAKVSSEGSSVT
    AHVSIGKDREGFGLAAELVVDLPGVERERAEELVAQAHEV
    CPYSRATRDNIEVRVKVA

    >gi|134096898|ref|YP_001102559.1| thioredoxin-disulfide reductase [Saccharopolyspora erythraea NRRL 2338]
    MDATRYDAVVVGGGAAGLSAATLLARSRRRVVVVDAGEPRNAPSAHLHNFLSRDGMAPAELLAAGRRELAGYGGEVVEAL
    ATSIERAEHGFAVRLASGAELTTRGVLVATGLRDELPDIPGLRDRWGDTVLH
    CPYCHGHEVRDQPLGVLGGDNRPFTVHQ
    AALVRLWSDDVAFFPNRIALEAGERERLTAWGVRIVDGEVARLSSGDGLTVELADGRQVRRQAVFAGPRFVPNDRLLTGL
    GCEVGDNGWVATDASGRTSVAGVWAAGNVVDSPAQLISAAGAGSTAAIALNHHLLAQDVERAATALSRA

    >gi|134096946|ref|YP_001102607.1| redoxin [Saccharopolyspora erythraea NRRL 2338]
    MSGLREYRNEIRWTIVVVVLAVLGIVALWPRGAEQPAEPGAPAPAPVAAQRGADPALRASAALEPCPSGPPTGPPGATGT
    CLADGRPADLAAMVGGRTTLVNVWATW
    CQPCRTELPALQEYSRRPGAVPVVGVQVQSDEDDGLALLRELGVRYPNVHDPD
    NRIRAALNVPAVLPMSYVVTASGEVRRVDPPVAFESADEVRTAVQRTAGGAG

    >gi|134097227|ref|YP_001102888.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora erythraea NRRL 2338]
    MGKAKVRRLNVLAGVLAAAVVFLLGYVLATQNRGDAPPAPEPAPQAQQNPLESLARRDPGDPLAKGRPDAPVVLVNYTDF
    R
    CPFCAKFGRDIEPELQRRYVDTGVLRIEWRDFPIFGEESLSAAEAGRAAARQGRFWEFHDAVFAQAPPTGHPPMPRERL
    VELARQAGVPDIQRFEADMGDPGVYAGIQADAMEGAQLGVSSTPTFVINGQPVFGAQPLEVFTEVIEQARAR

    >gi|134097230|ref|YP_001102891.1| putative iron ABC transporter binding protein [Saccharopolyspora erythraea NRRL 2338]
    MRRLLVVLATTLLLAGCGTAASTGPAWEGMRVENCGRTQVIAEPPRRVVSLNQHATEILLALGLGDRLVGTAYPDDRTPP
    ASVAADYARVPLLAVEYPSAERILEAEPDLVVGGYSSAFDEGEGRGREALESKGIATLLLSES
    CATGPTGMPALLADIDM
    FGSVLGLRERASVLAADIEGRVRAVEQRLAGVPPVDVFVYDSGEQAAFTLGGHGVGNDALTRAGARNVFADVPEGFADVS
    WEQVASRAPRAIVLVDYLAKPVHDKRAYLEGHPLASGTPAVRADRYSTVPLVELTEGIRFPDAVERLARDLHGA

    >gi|134097521|ref|YP_001103182.1| hypothetical protein SACE_0923 [Saccharopolyspora erythraea NRRL 2338]
    MAHRLADATSPYLLQHADNPVDWWQWSPEAFEEARRRDVPVLLSIGYAACHWCHVMAHESFEDEATAAVMNENFVNIKVD
    REERPDVDAVYMEATQAMTGQGGWPMTCFLTPDAEPFHCGTYYPSAPLHGMPSFRQLLDAVASAWRERGGEVRQAATRVV
    EQLSAQRTALPESFLDDEVIATAVSRLHAESDPDHAGFGGAPKFPPSMVLEFLLRHQERQSAPGSGHTALEMAEATCEAM
    ARGGIYDQLAGGFARYSVDSAWVVPHFEKMLYDNALLLRVYAHLARRRESPLAERVARETAAFLLRDLRTPEGGFAASLD
    ADTEGVEGLTYVWTPEQLAEVLGEADGAWAAELFEVTESGTFEQGTSTLQLKRDPDDPARWRRVRDALYEARSRRPQPGK
    DDKVVTSWNGMAITALVEASTALGEPEWLAAAEQAAKLLVERHLVDQRLRRSSRDGVVGAAAGVLEDYGCLADGLLSLHQ
    ATGEPRWLDVACSLLDTALEQFADSDNPGAYFDTAADSEELVRRPSDPTDNASPSGASSLTSALLTASALAGGSAAQRYR
    HAAEQALSRAGLLAERAARFAGHWLSTAEALAHGPLQVAVAGPEDDGDRAALLEAAWRHSPGGAVVLAGEPEATGVPLLA
    DRPLVGGSAAAYVCRGYLCDRPVTGVDDLVETLGRVQVPQS

    >gi|134097666|ref|YP_001103327.1| molybdopterin biosynthesis-like protein MoeZ [Saccharopolyspora erythraea NRRL 2338]
    MSGATSLPPLVEPAAELTKEEVARYSRHLIIPDVGMDGQKRLKNAKVLVVGAGGLGSPALLYLAAAGVGTLGIVEFDEVD
    ESNLHRQVIHGQSDLGRPKAESARDSIAEVNPFVKVNLHQTHLSSENALDIFRDYDLILDGTDNFATRYLVNDAAVLLGK
    PYVWGSIFRFEGQASVFWAEHGPNYRDLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIMVNEAIKLITGIGETLLGRLMIY
    DALEMSYRTVKIRKDPEAEPITELIDYEAFCGVVSDEAQQAAVNSTITPRELKDMFDRGEKFELIDVREPHEYEIVKIEG
    SKLIPKDRILSGEALSELPQDRKIVLH
    CKSGGRSAEALAALHKAGFSDAVHVGGGVLGWANQVDTSLPTY

    >gi|134097806|ref|YP_001103467.1| bacterioferritin comigratory protein [Saccharopolyspora erythraea NRRL 2338]
    MTEQQRLSAGDTAPEFALPDADGKTVSLSDYRGRSVVVYFYPAASTPGCTKEACDFRDSLAVLNDAGFDVLGISPDKPEK
    LVAFRDAEGLTFPLLADQDKSVMTAWGAFGEKQNYGKTVQGVIRSTFVVDPEGKIAKALYNVKATGHVDRLRKDLGV

    >gi|134097927|ref|YP_001103588.1| DsbA oxidoreductase [Saccharopolyspora erythraea NRRL 2338]
    MTAEDRPRVDFYFDPACPFAWVTSRWILEVQQVRDIDLHFRVMSLSVLNEGRDLPEDYLELLAKAWGPVRVAIAAAKHHG
    EEVLAPFYTALGTRIHDQGNHDYDAVIAESLAEVGLPASLAEAANSTDYDEELRASHHAGMAPVGEDVGTPTIHVDGVAF
    FGPVLSRIPRGEEAGRIFDGARLLAGYPYFFELKRTRTENPRFD

    >gi|134098120|ref|YP_001103781.1| AhpC/TSA family protein [Saccharopolyspora erythraea NRRL 2338]
    MTVEVGAQAPDFTLPDYNKEQVSLSGFRGKKNVLLVFYPFAFSGICQGELCQVRDDLGDFQNDDVQVLGVSVDSPFALKA
    WAEQEGYTFPLLSDFWPHGEIAKAYGVFNEKAGMANRGTFLIDKEGEVRFAEVNQPGEARDQGVWKKALADLSA

    >gi|134098222|ref|YP_001103883.1| dihydrolipoamide dehydrogenase [Saccharopolyspora erythraea NRRL 2338]
    MTDTSADLVILGGGSGGYACAFRAAELGLSVVLIEKDKLGGTCLHRGCIPTKALLHAAEVADSARDGDQFGVKTSLEGID
    IAGVNSYKDGVVSKLYKGVQGLFKAHKITVVEGAGTLVDAKTVEVDGTRYTGRNVVLATGSYSKSLPGLELGGRVIASEQ
    ALNLDFVPEKVVVLGGGVIGVEFASVWRSFGAEVTIVEALPHLVPNEDEFISKRLEREFRKRGIKFKTGVKFTGAQQSAE
    GVSVSLENGDQYDADLLLVAVGRGPNTAALGFEEAGVTMERGFVRTDDRLRTSVDGVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGLNPQAIDESGIPRVTYSHPEVASVGLTEAAAKEQYGSVETFNYDLAGNGKSQILKTSGAVKLVRATDGPVVGLH
    MVGDRVGELIGEAQLIYNWEALPEDVAPLVHAHPTQTEALGEAHLALAGKPLHVHG

    >gi|134098237|ref|YP_001103898.1| HesB/YadR/YfhF [Saccharopolyspora erythraea NRRL 2338]
    MTAQDTTIDTEAPAHGVTLTDSAAKKAKALLEQEGRDDMHLRIAVQPGGCAGLRYQLFFDERTLDGDARRDFEGLGVVVD
    RMSAPYVEGATIDFVDTIEKQGFTIDNPNAGGSCACGDSFH

    >gi|134098358|ref|YP_001104019.1| 3-mercaptopyruvate sulfurtransferase [Saccharopolyspora erythraea NRRL 2338]
    MFVDLPTELASEPGAGGRHPLPGPARLEQTLRRAGVTDGRTVVVYDADNASAAARAWWLLRWAGHTDVRVLDGGYAAWVA
    DGGAVTTEEPAPAPGDFEVRPGAMPVLDADDAARVARAGRLLDARAPERYRGDNEPIDPRAGHIPGAVNAPFSEHVDENG
    RWRSASDLADRFARLGVGPAEQVGVY
    CGSGVTACSVLLALEHAGISNPQRPAALYTGSWSQWSSDPQRPAATGEEPG

    >gi|134098362|ref|YP_001104023.1| protein of unknown function DUF395, YeeE/YedE [Saccharopolyspora erythraea NRRL 2338]
    MSAGTAAPTTSTKPETPPQARPQWLPLLLGIAGSVALVTATAFVAGAKLAALAALGLALGLTLFHSRFGFTSAWRQLVSV
    GQTSGVRAHLLMLAAASVLFAPILAGGVAFFGGTPEGNVEPLGLGLVVGAVLFGIGMQLGGACASGTLFAVGGGNTLLVV
    TLFFFIVGSVIGALHLPMWSSDAITLGSFSLAEDTGLGYGGALVLQLAVLGAIGWVATRWARRHDAPPAGRPPTARGVWR
    VVRGSWPLWVGALVLAVLNAAVLLTRGSPWGITSAFVLWGSKGLQAVGVDVASWPYWQGEKAAALSQSVLTDGTSVLDFG
    IMIGALVASAASGAFVLAKRLPAKVLLAAVVGGLLMGYGARLAYG
    CNIGAYFSGIASFSLHGWAWGLLALVGTWIGLRLR
    PLFGLDVPKPTDSVC

    >gi|134098421|ref|YP_001104082.1| peptide methionine sulfoxide reductase [Saccharopolyspora erythraea NRRL 2338]
    MEPDVGATPKVSKSDEEWRQQLSPTEYAVLREAATERPWTGEYVDTKTQGVYECRACGAELFRSETKFESHCGWPSFYDP
    RDTDAVILREDRSLGMVRVEVLCATCHSHLGHVFEGEGYDTPTDQRY
    CINSIALRHVPKA

    >gi|134098463|ref|YP_001104124.1| bacterioferritin comigratory protein [Saccharopolyspora erythraea NRRL 2338]
    MRPGDTAEDFVLPDQHGAERKLSELATDCPVVLFFYPAAMTPGCTAESCHFRDLSAEFAAVGAAPVGVSTDPVAKQRRFA
    EANSFGFPLLSDFDGQVARAFGVKRRFGPLPVKRHTFVIGTDRTVLEVIRSEFRMTAHADQALAFLRARGQG

    >gi|134098644|ref|YP_001104305.1| putative methylated-DNA--protein-cysteine S-methyltransferase [Saccharopolyspora erythraea NRRL 2338]
    MRTELSWTVVRGPVGEVTAVAGEAGLVQVCFGGPDQVLPHYGEAEPAEAGEPALRAGAQLEEYFAGRRRAFDLPVDWSNI
    EGLRLQVLRTLHEQVPFGRTLSYRELAGLAGRPEAARAVGTIMGSNPVPIVVP
    CHRVVASGGGLGGFGPGLEAKRRLLVL
    EGALDATLLELGMLA

    >gi|134098992|ref|YP_001104653.1| rhodanese-like protein [Saccharopolyspora erythraea NRRL 2338]
    MDTAQVRELRETEPQVRLIDVRTPGEFASAHIPGSSNVPLDLIQKNRHELGAVRHGDPVVLVCASGNRAERARALLEEAG
    LERLSVLRGGITGWERDGGDLSRGRGTWAMERQVRLTAGVLVLTGVVASTAYEPLKWIAGFVGAGLIFAAVTNTCAMARL
    LGLLPHNRTTTTDTSSPLEEISGKAPGARTAG

    >gi|134099907|ref|YP_001105568.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Saccharopolyspora erythraea NRRL 2338]
    MRVNRHSSLEAALADLLDEPPRPLADRIFAEWTRARSRFGPVDVAFNRHGVMFVRTAESEQDDAEFREAFRQVFEQPLRR
    AEREPTGMLTALRRNRTRSIQVDLRHLPDFDQEVLRATRLIPAGQTRPSAWVAREVGRPERAPAVDVVLARNPVPVVVP
    C
    HRVTRGESGEHVFGARAQERMLRSEEVNLDEVRELAESGVHYLGSDTTNIVCFPTCHNARRISAAHRRGFGTVEAAEKAG
    YRPCRHCRPVEMAS

    >gi|134099993|ref|YP_001105654.1| putative pyridine nucleotide-disulphide oxidoreductase [Saccharopolyspora erythraea NRRL 2338]
    MDAEEVDVVVIGLGPGGEDAAARLAAGGLSVVGVESRLVGGECPYFACVPTKMMVRASDALAEGRRVAELAGSAQVSPDW
    TPVADRIRDEATTGWDDTAAVQRLEKSGARFVRGFGRISAPGEVSVSTGNGDRVFRTRRAILLNPGTEPVVPPVDGLRDS
    PYWTNRDAVRAREAPESLLVLGGGPVGVELAQVFSRFGTRVAMVEHEQRLLGPFEPEASELLESVFEAEGIDVRTGERAE
    SVAHDDDSFTVRLGSGAELTAQRLLVATGRRTDLAALGVAAVGLDDRGRTIDVDVRMRAADGVWAIGDVTGRGAFTHTSV
    YQARIAANDILGQGHENADYRAVPAVTFTDPEVAMTGLTEAAAHDRGLPVVTATTGIPASTRGWIHKAGNQGLIKLVADP
    RRGVLVGATVVAPGGGEILGALAVAVHGEVPVERLRHMIYAYPTFHRAIEATLAELPASGI

    >gi|134100098|ref|YP_001105759.1| selenide, water dikinase [Saccharopolyspora erythraea NRRL 2338]
    MDLEAATTHRLTQYAHGGGCACKIPPGELEAMVSGLAEPHPELLVGLDGGDDAAAVRIGVDGAVLSTADFFTPVVDDAYD
    WGRIAAANALSDIYAMGGRPVLAINLLCWPRDVLPVELAREVLRGGADVARAAGCPVAGGHSVDDPEPKYGMAVTGLCDP
    DALLRNDAGRPGLPLSLTKPLGIGVLNTRHKATGEVFPQAVEAMTTLNAKAAADAVAAGVRCATDVTGFGLLGHLFKLAR
    ASGVSAVVDAAAVPYLPGARGALRDGYVSGGTKRNLDWVRPHTDLSAVDEDEALLLADAQTSGGLLVAGEVPGAPVVGEL
    VPRGGHVVTIR

    >gi|134100174|ref|YP_001105835.1| thioredoxin-disulfide reductase [Saccharopolyspora erythraea NRRL 2338]
    MHFCPYCHGYEVRDSALGVIGGEDRAFSLRQAQLIRQWSDDVVFFPHRIDLEAQEREQLVARGVRIVDGEVTRIVSDETG
    VRGVELAEGPMIRRAALFVGPRFVPSDELLTALGCELNDEGWVATDRTGRTSIDGVWAPGNVVDHTAQLINAAAAGSAAA
    IALNNHYLVAADVEKALNGHTEPAPAN

    >gi|134100215|ref|YP_001105876.1| putative methylated-DNA--protein-cysteine S-methyltransferase [Saccharopolyspora erythraea NRRL 2338]
    MRTHTVIDSPVGPLTLVATDGVLCGVYMDQQRHRPPQETFGAPDAGPFAECVRQLEGYFAGRRERIGRPAAARAVGLANG
    RNPVGIVVP
    CHRVVGSSGALTGYGGGLERKRQLLDFEREVVARGRSCPAWSTGGVCGAGVRRAGPRR

    >gi|134100336|ref|YP_001105997.1| assimilatory nitrite reductase large subunit [Saccharopolyspora erythraea NRRL 2338]
    MSRIVVVGNGPAAHRFTERMRHHGHSGPITVLGAESHAAYNRVLLGSVLDGSLTADGIALPPLDADVRLGVSATGIDRAR
    REVHTDTGGVHHYDELVLATGARPRVPDVPGLRDGGSVRTLRTLAD
    CAELPRGRVAVLGGGILGVEAARALAGRGADVVL
    VHPGRYPMDRQLDATAGKLLAERLGTLGVETRLERKAVERQPGKLVLDDGEVLLADEVVVCAGVEPETGLAQHAGLRVAH
    GVVVDDGMATSDPNIHAVGDCAEHGGTVSGLIASAWEQAEALAQRLTGARGRYRGTKTVTRLKARGIDLVSIGSREALAS
    LDAEVVTLSDPARGRYARIALADERVAGAVLFGFPQAIASVTQLHDGDLPVPSDRLGLLLGTAAATRATPVELPDDAVVC
    RCNNVTKKALTTAWHGGARSVADIAQATRATTGCGGCADDVRRICGSLRTRTEEQQEGAA

    >gi|134100574|ref|YP_001106235.1| alkylhydroperoxidase AhpD core [Saccharopolyspora erythraea NRRL 2338]
    MPQEARIELAKAWGEGYRALAGMHATVVNSGLDHTLKELIFIRASQINGCAFCLDMHTKDARAAGETEQRIFALNAWRDT
    DFFTEQERAVLALTEAITLLTEGHVPDDVFDDARKHFDEEDLAKVIMAIVLINAWNRTGVTQRKPVGGYQPPKN

    >gi|134100633|ref|YP_001106294.1| methylated-DNA--protein-cysteine methyltransferase [Saccharopolyspora erythraea NRRL 2338]
    MTSSPDPGAERLFASLPPNDDDAHARLHARLVEAAQREGVLDIGYRTVDSPVGRLLLAATEAGLVRVAYASEDHDGVLAG
    LAAAVSPRILNAPARLDAVARQLDEYFARSRKHFDLRLDLRLSKGFRRQVLAHLPEIGYGRTESYAQVAAASGSPKAVRA
    VGTACATNPLPIVVP
    CHRVVRSDGSFGGYVGGPETKRALLDLEGAA

    >gi|134100942|ref|YP_001106603.1| ArsR family transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
    MGEQGAKAVLFEQFARVGKALASGKRLELLDILAQGERTVESLARAAQLGMTTASAHLQTLKRANLVVTRGEGTKVHYRL
    AGSDVAALYALVRAVADAHLPDVEAARADYFGAGDGAEHVSREELLRRVELGDVVVLDVRPREEYQAGHIPGAVSVPLDE
    LAGKLGEISADQEVVAY
    CRGSYCVLAHDAVRLLTAHGRPARRLAEGMLEWRLAELPVETT

    >gi|134102127|ref|YP_001107788.1| dihydrolipoamide dehydrogenase [Saccharopolyspora erythraea NRRL 2338]
    MQEFDVLVIGGGPGGYVAAIRAAQRGLSVGVVEKERTGGVCLNWGCIPTKAMLRSAEVYETVLHAADYGVQAENVSLDYD
    AVSRRKDGIVKGLTDGVASLLKANGVTVIYGHARFTGPTTLDVYAVGESALGAGGPKYAADPTGDQPVEQVKARDVIIAT
    GSVPVQLPLPGADLPGVITSDGAFGLTEVPKRIAVIGGSAVGAEWASLFNTFGAEVTIIEMQPTLVPAEDAEIGKALGRS
    FGKAGINVLTGSTVSKIESAGRGKNAGLKVFVDGPKAQEIDADVVLVGVGRKPNTAALDLEKAGVATDARGFVPVDEQLR
    TNVEHVYAIGDVTGRVLLAHVASHQGVTAAEVIAGSDHARMDYDVIPAATFTHPEIASVGLTEAQAVEAGHEVVTGKFPF
    AAIGRTKTYGNSDGFMKIVAGKQYGEVLGVHIIGQSASDLITEGALAINLEATLDELAETVHAHPTLGEIGMEAAMSALG
    LPIHVAPPKKR

    >gi|134102133|ref|YP_001107794.1| DsbA-like thioredoxin domain-containing protein [Saccharopolyspora erythraea NRRL 2338]
    MPKTTNPVTQKSGFSINIILTLIVVVMAVVVIGGVLWINRDGNGSSLSGAVPAETLNKPDSSTLSQSPDGKVTVTEFLDY
    Q
    CPACEQYYRGITKQVEQQYAGRINFVVRNFPLDMHPLARQAASAAEAAGMQGKFKEMYHALYDNYQAWAIAPDGQNVSS
    DSQKAAALIDQYAQQIGLDVNRLHQDMASPQIKAKLDRDLADGEAARVNSTPTLFINGKQFQAPSGDGVTYQQVADKFRA
    EIDQALAR

    >gi|134102190|ref|YP_001107851.1| glutamate synthase, NADH/NADPH, small subunit 1 [Saccharopolyspora erythraea NRRL 2338]
    MADPQGFLKYSRADAPKRPADERLGDWYEVYASLSTEDRKAETSRQAARCMDCGIPFCHSGSAGCPLGNLIPEWNNMVRR
    GQWDQASERLHATNNFPEFTGKLCPAPCEAGCVLSISPDAGGPVAIKRVEEAIAEVSWENDYVEPQLAELATGKRVAVVG
    SGPGGLAAAQQLTRAGHEVTVFERDDRIGGLLRYGIPEFKMEKSVLDRRLAQMRSEGTKFITGCEVGVDLTVEELRAGYD
    AVVLAVGALRGRDDRNVGGRELNGVHLAMEHLVPANKECEGDGPTSISAEGKHVIIIGGGDTGADCYGTANRQGALSVTQ
    LDNYPQPPTSRDDDISPWPTWPYILRTYPAHEEAGERKFAVAVEEFVGDDEGNVRAVRLRQVKVERVDGRRQVVPVSDEV
    EELPCDLALLAIGFEGVEHMDLLDGLGIELTKKGTIGCGSNWETSAPGVFVCGDAHRGASLVVWAIAEGRSVANAVDAHL
    MGDSQLPSPVHPTALPLAVV

    >gi|134102246|ref|YP_001107907.1| rhodanese-like protein [Saccharopolyspora erythraea NRRL 2338]
    MDTGRVRELLDSDPRARLIDVRTPGEFEAERIPGSHNVPLDLLRERRSSISPAHTDPVVLVCGSGARAEQARDLLEDNGF
    QRLTVLSGGVGGWQEQGAPVERGTGKWAMERQVRLVAGSIVLAGVLGSLRYPKLKLLAGFIGGGLTFSALTNTCGMARLL
    SLLPYNRTPAQDAPGLLAALTADNAAGR

    >gi|134102422|ref|YP_001108083.1| mycothione reductase [Saccharopolyspora erythraea NRRL 2338]
    MRHFDLVIIGSGSGNSILDDRFADWNVAIVEKGVGSTGNYGGTCLNVGCIPTKMFVHTADVAGAPSSGTRLGVDLELRDV
    RWHDIRDRIFGRIDEISAGGRRYRAEDNPNVTLFEGVGRFTDVKRLEVETAGGTETITADRFVVAAGGRPAIPDIPGIEN
    VDYHTSDSVMRLDELPRRMIIMGTGFVGAEFAHVFSALGVEVTLVGRSGRALRSQDVDVSERFTELAGRRWDLRLNRKEI
    GVEQDGDLTRLYLEGPDGSEVVEAEALLIAVGRVPNSDVLDAAKGGLALSRNGKIEVDSEQRTSVDGVWALGDISSPYEL
    KHVANHEMRVVQHNLLHPDAPIESDHRYVPAAVFSSPQIASVGLTEQEAQQLGVEYVTSVQDYGGIAYGWAMEDSTGFAK
    LLADPETGKLLGAHIIGPQAPTLLQPLIQAMQFGLDARTMARGQYWIHPGMPELIENALLNLPLR

    >gi|134102461|ref|YP_001108122.1| arsenate reductase [Saccharopolyspora erythraea NRRL 2338]
    MEIWVNPACSKCRSAVSLLDEAGADYTVRKYLEDPPNERELAEVLDRLGLEPWDIARTGEETAKRLEISTWERTPAERPR
    WIQALVANPELIQRPIITADDGTAVVGRTPDAVASMLR

    >gi|134102462|ref|YP_001108123.1| methylated-DNA--protein-cysteine methyltransferase [Saccharopolyspora erythraea NRRL 2338]
    MSTVHAAIDSPVGELTAVATDGALVGLYFEDHRRRPGDESMGPRVDTGFEETERQLGEYFAGERTTFDLPLAPRGDEFHQ
    RVWELLTRIPYGETRTYGDLARELGGVGYSQAVGAANGRNPLSVIVP
    CHRVVGADGKLTGYAGGLERKRFLLALEEPSEA
    KEGRLF

    >gi|134102647|ref|YP_001108308.1| rhodanese-like [Saccharopolyspora erythraea NRRL 2338]
    MSAPTTGPYGVEHLLAESRTELERVSPREAAELQRQGGLIIDIRPDANRLAEGEIPGALTVERIVLEWRLDPSSPHRLAG
    LRPHQPVVLV
    CNEGYASSLAAAQARELGLTRATDLDGGFRAWKAAGLPVTTATAAA

    >gi|134102655|ref|YP_001108316.1| thioredoxin [Saccharopolyspora erythraea NRRL 2338]
    MAGAVDLSALKSRADATARAGDQQPAAKGEAGAAPPAGGSVIDVTEATFQAEVVERSMQVPVVVDLWATWCGPCKQLSPM
    LERLAAEAGGSWVLAKIDVDANPRIAQLFQVQSVPMVIAIAGGQPVEAFAGAQPEPQIRQWINSLLDAMRDQLPGIREAE
    AAAGGAAPAEQEDPRFTAAEEALERGDYAAAESAYQQILESEPANEQAKAALAQVRFSARAESADPSAVERADAAPDDLD
    AQLAAADAEVAAQRVEEAFDRLVRTVKRTSGDDRNRVRQHLVEMFELFPDGDERVTAARRALASALF

    >gi|134102746|ref|YP_001108407.1| pyridine nucleotide-disulphide oxidoreductase,class II [Saccharopolyspora erythraea NRRL 2338]
    MEDVVVIGGGAGGLNAALTLCRVRRRVLVVDSGEPRNAPAERVHGFVSRDGTPPAELLAAGRAEVERHGGRFADGEVRTI
    RRRDGVFAVELADRVVSARRVVVATGLRDELPGVPGLRERWGRDVLH
    CPFCHGYEVRDQPLGVMGGLRASVHQALLLRQL
    SDDVVIFAEEVDDRDRARLAARGVRIVRAAIAGLDVEDDALRGVRLADGTVVARSALFVPAPPVPNDALLAGLGCERDGD
    GLVRVDGNGLTSVPGVWAVGNVVDPRAQVVVAAGAGAKAAIAVNADLMEEELVEERAA

    >gi|134102959|ref|YP_001108620.1| flavoprotein disulfide reductase [Saccharopolyspora erythraea NRRL 2338]
    MTRIVIMGGGPAGYEAALVAAQNAAEVTLIEPEGLGGACVLYDCVPSKTFIASSGARSSARDARELGIRSRSEDTDVDVA
    VVHGRVKGLALAQSADVRSRVRREGVRVLTGRARFTSPTKGMAQHHVGVDLADGGFEELLADVVLIATGATPRILKGAEP
    DGKRILTWRQLYDLPELPEHLAVIGSGVTGVEFASAYTEMGVKVTMISSRDRVLPHEDADAAAVLEEVFAERGTEVVKHA
    RAEKVERTDTGVLIHLADGRQVEAGHALMTVGSVPNTADIGLERIGIEPDRGGYIPVDRVSRTSVPGVYAAGDCTGVLLL
    ASVAAMQGRIAMWHALGEGVTPIKLKTVAANVFTHPEIATVGISQQAIDSGEVPARTVMMPLATNPRAKMEGLRRGFLKV
    FCRPQTGVVVGGVVVAPNASELILPIAMAVQNQITVDNLAATFSVYPSLSGSLTEACRQLMRHDDLD

    >gi|134103041|ref|YP_001108702.1| putative cation-transporting P-type ATPase [Saccharopolyspora erythraea NRRL 2338]
    MTATTDRVGDRIELAIGGMTCASCASRVERKLNKIEGVQATVNYATEKANVVFPDTVTPDDLVEAVEKAGYTATLPRPQE
    PEQTGEEPRDHEHDALRTRLVVSSVLSVPVILMAMVPPLQFTNWQWLSLTLAAPVVVWGALPFHRATWTNLRHGTATMDT
    LISMGTLAALAWSLYALFFGTAGQPGMTHGFELTVERTAGSGNIYLEVAAGVTAFILAGRYFEARSKRRAGAALRALLEM
    GAKDVAVLRDGREERIPTDQLAVGDRFVVRPGEKIATDGLIEDGSSAVDASMLTGESVPVEVAPGDTVVGATVNAGGRLV
    VRATRVGSDTQLAQMAKLVEDAQTGKAAVQRLADRVSAVFVPVVILLAFATLGFWLGSGGEVAAAFTAAVAVLIIACPCA
    LGLATPTALLVGTGRGAQLGILIKGPEVLESTRRIDTVVLDKTGTVTSGHMSLAGVAVAGGETETEVLRLAGALEDASEH
    PIARAIATGARERAGSLPEVEGFTNAEGLGVHGVVDGHAVLVGRVALLEEWSIRLPGDLAEAKAAAESEGATAVAVAWDG
    HARAVLVVADTIKPTSAEAVRRLRDLGLTPILLTGDNEAAARAVAAEVGIDEVIAEVLPKDKVDVVARLQKEGRAVAMVG
    DGVNDAAALATADLGLAMGTGTDVAIEAGDLTLVRGDLRAAADAIRLSRRTLGTIKGNLFWAFAYNVGALPLAAAGLLNP
    MIAGAAMAFSSVFVVSNSLRLRGFRPS

    >gi|134103054|ref|YP_001108715.1| cation-transporting ATPase [Saccharopolyspora erythraea NRRL 2338]
    MTPTPTRVTPRPQARQVELAVTGMTCAACATRVERKLGKLDGVRASVNYATGRASVEVASATDDAALLDAVRRAGYQAEP
    VTPESAEEPDSGDRSRDLWRRMLVSVLLFVPLCDLSLLFTALPGTRFPGWQWVLAALALPVVGWAALPFHRAALSGARRG
    SSSMDTLVSLGICAAGAWSAYAMFSGHEPAELTGFWALLRADGAIYLEVAAGVTTFVLAGRYFEARAQRRAGHALHALAD
    LRAKTVTVVRDDGTRQEIPVDDLQVGQRFLVRPGETVATDGVVRDGRAELDCAAMTGESMPVGTASGDDVIGGTVLLTGH
    LVVEATRVGRDTRLAAMVRLVEEAQTGKAAVQRLADRISAYFVPAVLVLAVSTSVGWLLAGGTAERAFTAALAVLVIACP
    CALGLATPTALMVATGRGAMLGIFIKGHQALESTRHIDTVVLDKTGTVTEGRMSVVAVECLPGVERAVVLRRAGALEDAS
    EHAVARAVSAFAREELGALPGVAEFRNLTGLGARGVVEDREVLAGRAALFGELGWEVPGDLDAVRREWERQGRTAVLLGW
    DGRAVAVFALADLVRPSAPRAVAGLHRLGLRTVLLTGDNAATADAVAAAVGIGEVVAEVLPDEKVDVVRRLRAQGRVVAM
    VGDGVNDAPALAAADLGLAIGTGTDVAIGAADLILVRDELTVVPDAIRLSRAALRTIRGNLVWAFGYNLAALPLAALGLL
    NPLVAGGAMALSSFFVVSNSLRLRRFAPGGWENADPSR

    >gi|134103360|ref|YP_001109021.1| thiol-disulfide isomerase/thioredoxin [Saccharopolyspora erythraea NRRL 2338]
    MVRAALALSAVALVGGCATAGEDAVEKGGEFTFVSPGGQTRIFYPPQERGRLTGLHGENLLEKGKDLGIADFQGKVVVLN
    VWGSW
    CGPCRSEADDLQAVQDKTAAQGVQLLGVNVRDNRSAAVDFHRDRGLTYPSIFDPSGRSLLALKNFPRSTVPATIV
    LDRQHRVAAIFLTDLLEKDLLPEVQRIAAEP

    >gi|134103375|ref|YP_001109036.1| glutaredoxin 2 [Saccharopolyspora erythraea NRRL 2338]
    MTGTAAHTVTVMVREDCHACHQAVADVERICGELGVGWHAEDVDTDPDLRAEYGDRVPVILIDDVEHGFWKVEEDRFRAA
    LAR

    >gi|134103394|ref|YP_001109055.1| osmotically inducible protein C, OsmC [Saccharopolyspora erythraea NRRL 2338]
    MTERNATTQWTGDLKSGSGNVALESSAAGTFPVTWASRAEAPEGRTSPEELIAAAHSSCYSMQLSGLLTAAGTPPESIST
    SAEVSFGPRGDGFAITGIALTVRARVPSADAASFDEAARKAKDI
    CPVSAALTGTTISLDAALE

    >gi|134103460|ref|YP_001109121.1| heavy metal transport/detoxification protein [Saccharopolyspora erythraea NRRL 2338]
    MSTQTFTVTGMTCGHCVKSVTEELSEIPGVTDVQVTLDSGLVSVTSEQELSRDAATAAVSEAGYDISAWN

    >gi|134103527|ref|YP_001109188.1| thioredoxin [Saccharopolyspora erythraea NRRL 2338]
    MTAGVWALLGAVTVALVFGLVWRSREGRVRVRGGSAEVTLYDKLPDELRRRLDDEPAAPVTLLQFSTTFCAPCRHTRILL
    ADFAGRTEGVRHVEVDLTDHPEWSTPLGVHRTPTTLVLDGAGREVFRVGGVPRRDELDAALRPLLA

    >gi|134103529|ref|YP_001109190.1| thiosulfate sulfurtransferase [Saccharopolyspora erythraea NRRL 2338]
    MSREEVLVSTDWAEQNLNTDGVVFAEVDEDTTAYDGGHIPGAIKLDWKNELQDHVRRDFVNREGFEKLLSAKGIGNDDTV
    ILYGGNNNWFAAYAYWYFKLYGHSDVKLLDGGRKKWELDGRELTKEEPNRAATAYKAQEPDASIRAFRDEVVDAIGNKNL
    VDVRSPDEFAGKLLAPAHLPQESAQRAGHIPSAINVPWSKAANEDGTFKSDEELKQVYGEAGLDTDKDTIAY
    CRIGERSS
    HTWFVLRELLGHTNVKNYDGSWTEYGSLVGVPIENPQEQGA

    >gi|134103740|ref|YP_001109401.1| NHL repeat-containing protein [Saccharopolyspora erythraea NRRL 2338]
    MSAEQQKRRARVRAPELVGRRWLNTGGREMSLHDFRGKVLVLDFWTFCCINCLHVLDELRPLEEEFADEVVVVGVHSPKF
    EHEADPDAVAAAVQRYAVHHPVLDDPELTTWQHYAVKAWPTLVVVDPEGYVVHVAAGEGHVETLRGVVAELVAEHDAKGT
    LHRGDGPYVPAETENTTLRFPAKVLPLDGGTLLVSDSAHHSLVEFTADGETPVRRIGSGERGRADGAADEASFAEPAGLA
    LLPEDVAAEVGYDVVVADTVNHLLRGVQLADGEVVTVAGTGEQWRDGSDAGPALETPLTSPWDVAWWEPAGGVVIAMAGN
    HTLGLFDPRAGQVRRFAGTTVEGLRDGDADEAFFAQTSGLADGGDRLWLADSETSALRWVEAGGDGFAVRTAVGAGLFDF
    GHADGAADQALFQHPLGVAVLPDGSVAVCDTYNGAIRRYDPASDEVSTLADHVAEPSGAAVVDGELVVVASASHRLERPV
    PPGVAAKLVRGTSQQVKRPDTEVGPGELELAVVFTPPPGTKLDDRYGPSTRLEVSSSPEGLLVEGAGVGTDLNRRLVLAD
    DIAHGVLHVVAQAASCDDDPSVEHPACRLTRQDWGVPVRVAAGGPNRLPLVMGGLDDEA

    >gi|134103790|ref|YP_001109451.1| hypothetical protein SACE_7370 [Saccharopolyspora erythraea NRRL 2338]
    MSQEVVVYTRPGCPFCTSLRAGLRREGLEFTEVDIWQDPEAAAVVRSIADGNETVPTVVVGSWSAVNPSSRAVLEAVAQH
    APELLPAQRPSAVRGALNALGFSKSKDSTHG

    >gi|134103804|ref|YP_001109465.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
    MTGDVRNVIIVGSGPAGYTAAVYAARAELEPLVFEGTQFGGALMTTTEVENYPGFREGIQGPDLMEQMRSQAERFGAELR
    AEDVESLELSGEIKTVHANGRTYRARAVILAMGAAARYVGVPGEERLLGRGVSA
    CATCDGFFFRDHDIAVVGGGDSAMEE
    ATFLTRFARSVTIIHRREEFRASRIMLERARANDKIKWITNTVVDEVVGDGAVSGLKLRNTVTGETSELGVTGMFVAIGH
    DPRSALVRDQVDVDDEGYVLVQQPTTHTKLPGVFAAGDLVDKTYRQAVTAAGSGCAAAIDAERWLAEQESVPAAEVASEF
    VGGGYAAQTLITP

    >gi|134103805|ref|YP_001109466.1| thioredoxin reductase [Saccharopolyspora erythraea NRRL 2338]
    MAGNTVTVDTDSFKSVVLDSDKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTVAKLDIDKNPSLQSEYQVMSIPTLL
    LFSGGEPVKQIVGAKPKAALLSDLQDYL

    >gi|134102245|ref|YP_001107906.1| beta-lactamase-like protein [Saccharopolyspora erythraea NRRL 2338]
    MMEPPDRPTGDPAVEVIETSSLGDRSYLATDGDAAVVVDPQRDVDRVIAAAGRLGVRITLVLETHVHNDYVSGGLELARL
    TGADYGLAAADEVPFRHVPVRDGDVLAASDRLRVRALATSGHTFHHLSYVLELDGKPAGVFTGGSLLYGTTGRTDLLGQD
    HSAELARHQHASARKLAAALPDGAAVWPTHGFGSFCPASQSGADSSTIGDEKRANPALTLAERDFVETTLSGLDDYPAYY
    AHMGVLNLAGPEPLDLRPPDEATPRDIEAALERGEWVVDLRSRKAFAASHLLGTVALGLDGQLATWLGWLIDWGAPVTLL
    GESTEQVAQAQRELARVGIDRFAGAAAGSPEELATDDARLRSTRTASFADLARALSGADGELPAPDVVLDVRTGTEWRES
    HVDDAVHVPLHELRDHMGDVPAGTVWVN
    CGSGYRATTAASLLEAAGRHVVIVDDAFDSAGEAGVPLTA