Saccharophagus degradans 2 40 uid57921

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|90019726|ref|YP_525553.1| hypothetical protein Sde_0077 [Saccharophagus degradans 2-40]
    MQRLALILGLTLALAACGESAKTSDAAKEQAPSKPSEAAQVAEQTSEAAQTAKQEVKATAKEIKDDVTAAADMAAEKAQA
    AVEETKEVAKDVKKQVESQALPATMFQEGTHYEVLKQPVRTITPGKIEVTEVFAYS
    CGHCFNFEPIVNAWKKTLPDYVQL
    VKSPAIWNASMEPHARMHFAAIALSVQDTISAAAFNAIHRERKPLSSQADIAKLFVAAGVDEAKFNETYNSFTVSSQVNQ
    ANARARSMMISATPEIVVDGRFRISTRFSGVESQSDMLKVANFLTNQIHHGKL

    >gi|90019739|ref|YP_525566.1| peptidase C60, sortase A and B [Saccharophagus degradans 2-40]
    MNRLMAFLFIVFSIQAFAQEQIEVGVKVGEKAPELSVVDAQGKPQTLASLTGEQGLVVVFFRSADWCPFCKRHLIEIKDW
    VKPLGEKGFNVVGVSYDSPATLAAFSKAKDINFTLLADQNVATVKAYNIVNSGYKPGDDNYGIPYPGAVIIDKAGVVRYS
    YFYEGYKKRVQWQTIEPALNTLTAK

    >gi|90020135|ref|YP_525962.1| response regulator receiver (CheY-like) modulated CheW protein [Saccharophagus degradans 2-40]
    MHHSAFALQLLHSRLISQQSENPMSQPAANTFFVKAAKSVGIFVVLLVGAYIINVEIQSYLGRNAAVATGLPTHTFEQAL
    SLAKQQSKPVLANFSAAW
    CPACRRLDKDVLAKPEVKQRIEQHYIFTRIDYDTEEGQTFMARYQAKGTPTLLILDAQGEQL
    KRLNLTFAPAQFLTQL

    >gi|90020145|ref|YP_525972.1| glutaredoxin [Saccharophagus degradans 2-40]
    MPEVVIYSSNYCGFCFRAKQLLQSKGVKYKEIVVDGDTQLRTELARKAGARTVPQIWIGDNHVGGCDELYTLERTGSLDD
    LLAL

    >gi|90020216|ref|YP_526043.1| glucan 1,4-alpha-glucosidase [Saccharophagus degradans 2-40]
    MFVPPCFKRFCGLLKAFKAVRVLCVVVFAICLAAQAGAQSTAFGDHVKVRWLAPDSLIAGQQEVIGFYFEVDLGWHVYWH
    NPGDSGAAPRFDIQVQGATLGEVMWPYPTRLPIEHLTNLGYESNVAYLLPITADLQTSEVVLNVSLEWLVCKVDCIPGFG
    EMSLRLPITNQSLWLAPDLALRDGYLALVPQQTNSPWQAVKAQAVGDTQLQLTLHANSTRLAQGDFNSVSVFPVDGEVLT
    ATKPQIKSNAAGLELTFNRVPGAALPTATDFVVVDGNRAWRLNDIALVNQAVLLPANSQSQTQPQSFWLLLGAAFLGGVI
    LNLMPCVFPVLSIKLFGLVQQSSAHRAKEGFVYAAGVLCTFTLLGAVLLGLRAGGAALGWGFQLQSPAVILVLITLFWLM
    ALSFSGVFEFGHRLVTLAGSHRGGAFITGVLAVFVATPCTGPFMGAALGAAVVLPPLSAITLFVGLGAGLAAPFVALCLY
    SPLLHKLPKPGPWMETLRQFLAFPLYATVIWLLWVLGRLVGDIGWLVGASLMLSFVVAIWLASTLQWGKLGRSVICLGAV
    VAFVFSLSLLAIPSGNKNSGSETSQWNKFDSQAIAQARAQGRAVFIDYTAAW
    CITCQVNKKLVLDTQPIQDSFKKNNVYL
    VRADWTHRDDAITQSLAQLGRNSVPVYAWYGKGADEVVLLSQILTAGSIDALFEQK

    >gi|90020217|ref|YP_526044.1| alpha amylase domain-containing protein [Saccharophagus degradans 2-40]
    MLYQVAKNSFRLAVVCAAFFASTFAFANAVPGEAAPDFTEVDASGKTQALKDYKGEWLVLEWFNKDCPYVKKHYGSENMQ
    SLQQKYAAKGVKWLTVISSAKGKQGYLEPKQALEEALSHNLNASAALVLDADGSMGKAYGAKTTPHMFIINPEGKVVYAG
    AIDDNDSANPAVIKTSKNYVAAALDEVLAGKPVTVASSRAYGCSVKY

    >gi|90020262|ref|YP_526089.1| adenylyltransferase [Saccharophagus degradans 2-40]
    MNDDQLLRYSRHIMLPQVDIAGQERICHGRVLVVGVGGLGSPAALYLAASGVGTLVLVDDDTVEISNLQRQIAHTEHRIG
    ENKAESAAKAIADLNTSTQVEVYTSRLSEHALGEQIQRADVVLDCTDNFTTRKQINALCVQMQMPLVSGAAIRLEGQITV
    FDKRDAESPCYQCLYQLTDDENLS
    CSQSGVLSPLVGVVGAMQALEALKVLGKFGTPLVGRLGLYDAVFGEWRYMKLKRDT
    QCEVCATI

    >gi|90020325|ref|YP_526152.1| hypothetical protein Sde_0678 [Saccharophagus degradans 2-40]
    MALTESTMMALGSPAPSFSLPSTDGEQVTLANFEGKAGLVVMFICNHCPYVIHIAPALAKLAAEYQQKNIGFVAISSNDA
    STYPADSFELMKEEKAKQGYTFAYLYDESQAVAKAYNAACTPDIYLFDKEQKLVYRGQFDDTRPHRISSGNYDSSAAPAT
    GADLKAALDLLLAGQAIPTKQYPSIGCNIKWKDS

    >gi|90020403|ref|YP_526230.1| hypothetical protein Sde_0756 [Saccharophagus degradans 2-40]
    MQATVKWVDGKMFLGESGSGHTVVMDGPPDHGGRNMGVRPMEMILLGLGGCASFDVISILEKTRQKVSDCRVELSAERAE
    GVPSPFTKIHLKFVVTGVALKEVQVKKAVELSAEKYCSASIMLGAAGVELTHSFEVVEAA

    >gi|90020461|ref|YP_526288.1| C-type cytochrome biogenesis protein [Saccharophagus degradans 2-40]
    MNIMTLKLLYRYVCAIFVSVLLLSAASTQAQGFLSSVDDGFLKVYDAYQVQPQTRQTDTTTALNLEWKAADGYYLYQHQF
    KAVARNATEGYKLALQIEPGIMKYDEYLEKELEVFYNRAFMQAEFPNLAPPYELMITSQGCADAGLCYPPYKHYFMVEAD
    GTILPMEAASFSDATLTTLTLPESAEATLAPKHAEAAPFLPLVMLSAILGGLILNLMPCVFPVLSLKALSFASSHVTPHK
    QHAHGWAYTLGAVLSFVGFAVIMLVAREAGEQLGWGFQLTNPVFVAFMVYLFFFMGLVLSGFVELGGGWMGMGQNLTSGE
    GIKSSFFTGVLAAVVASPCSGPFMATALGIAITQHAAIAIIIFACLGFGMALPFLLLSYNPKLTNRLPAPGVWMDTLKQF
    FAFPLYLTGVWLLWVLGHQVNSDAAAALVMGAVLIAFSFWLFKQTTQSKTWNVIRLATAIASLVIALGIAIAAKWFAAPT
    QYEWEPYSARDLAAYRKEGTPVFVDLTADW
    CTTCKVNEFVALNTEEVQNKAEELGIVMMQGDWTNGEEAITQYLEQFGRN
    SVPLYLMYPATPDTPPVVLPQFLSKSLVLEAMQKAVP

    >gi|90020483|ref|YP_526310.1| hypothetical protein Sde_0836 [Saccharophagus degradans 2-40]
    MSAPQTFVPEPVQVTENALAKVKALIEEEGNPDLKLRVFVTGGGCSGFQYGFAFDEACAEDDAKIERDGVTVVVDAMSYP
    YLVGAQVDYEEGLKGSKFVVANPNASTTCGCGSSFSI

    >gi|90020547|ref|YP_526374.1| arsenate reductase [Saccharophagus degradans 2-40]
    MSKAFTIYHNPRCSKSRQTLQLIEDAGITPTVRLYLETPPTKAELKTLLKQLGISARELLRKGEEAYKELNLKDTTLSDS
    ALIDAMVAHPKLIERPIVVCADKAVLGRPPENVNTLL

    >gi|90020812|ref|YP_526639.1| protein-methionine-S-oxide reductase [Saccharophagus degradans 2-40]
    MSDLTKKDDEYWRDKLDAEQFRICREKGTERPFTGEYCDSKEPGTYLCRCCAEPLFESATKYDSGSGWPSFFQPIKGDAV
    GEIKDTSHGMVRVEVVCHNCGCHLGHVFPDGPKPTGLRY
    CINSASIQLQKEGAE

    >gi|90020827|ref|YP_526654.1| RecJ exonuclease [Saccharophagus degradans 2-40]
    MKTFIKQCTLALSVGLSSALLSATAFSEGTMQGEAAPPIPGLEQYKGKPVLIDFWASWCEPCQESFPWMNEIKAQYPDLE
    IIAINLDEEKATAEAFLKNNTADFKVMFDPEGVLAEKYQVDGMPSSYLVDRDGNIVKHHVGFFADKKGDYENDIKKVLDK


    >gi|90020828|ref|YP_526655.1| thiol:disulfide interchange protein DsbD [Saccharophagus degradans 2-40]
    MYTSILRLTQATIACLLLTLLSPAFAADGNAAQQLSSDEAFIPSIELTEEGLLVASWQIADGHYMYKNKFEFKVASGDFV
    ELGNVSFPEGITKNDKYFGTQEVYKKHVTLEVPVGASALGDFSVRVKYQGCAEQGICFAPKRKTYEFTANSITSLPTSGS
    AIATAGEISQTGLGASSVVQTEESRLTTLLKEGTILTIIGVFFLGGLALTFTPCVLPMIPILSSIIVGQKKELKKTESFA
    LSLSYVIGMATTYATLGVILGVAGNNVIAYLQNPYVITTFAILFVLLSLSMFGLYELQLPSGIQNKLNNLNNKQQGGTYI
    GTLIMGILSALIVSPCVSAPLAGALVYISTTQGGALMGGTALFSLGMGMGTPLLIIGTGGAHLIPRAGGWMDGVKAFFGV
    MLLAVAIWFLDRILPSQVTLALWGALLLGSGVFMGGLDFSSQQGWGQFRKTVGFISVLYGTLMWIGAASGATNPLQPLQN
    LGSTTVVAQSGQPSVKEKFVKVSTLEELDAELAIARENGQPVLLDFFADW
    CVSCKIMEHEVFPSPSVAAQLDNFYLIKAD
    VTDDSLLLEHYNLFGPPSLLFFDNSGNEMSNFHIRSEIHAKELAPHLESVIQIVQQAQPAAVESLAKN

    >gi|90020855|ref|YP_526682.1| thiol:disulfide interchange protein DsbC [Saccharophagus degradans 2-40]
    MKTLLATALLTCATIGGSLAATSALAEKPKAAAEKNEVSAKQDIDLARKNITSALAAARPDLVVTDVVKTPVEGIYKTTI
    SNGPAVYSTADGQFFMAGELFRVQPGGIVNLTEQEMNGERAKLLAGMDVKDMIVFSPKGDVKGVVSVFTDVD
    CGYCQKLH
    QEVPQLNAMGIEVRYMAFPRMGIGSGAYNKIVSAWCAADKQDALTKLKARQSIPENLCKTNPVNEQYATGQQMGISGTPA
    IVLGNGELIPGYVPADRLAARLGL

    >gi|90020978|ref|YP_526805.1| putative thioredoxin [Saccharophagus degradans 2-40]
    MSEHIVEITLENAQAQLIEESFNRPVLIDFWAEWCEPCKSLMPVLEKLANEYAGQFLLAKVNADELNMIASQFGVRSLPT
    VMVMKDGQPVDGFNGAQPEQTVRELLNKYLPKPWELALGRAKLLMEEEKYGEAIAELTPAYEESMQAAAVLFALVDCYIN
    IKRFEQAEELLDSVKLVDQQDAEYGNLRSQLDIAKQAGKSPEIETLEAALAADPDNIDTKMQLAAQYTHGEYHKDALELL
    FPLLRKSLNAKDGEVKKQYVDILAVLGKGDPLAVEYQRKLYTLMY

    >gi|90021065|ref|YP_526892.1| ATPase [Saccharophagus degradans 2-40]
    MSVETFSVSDAIQVTPAAAEHFAKQLKQSGKAAVRLSLKESGCTGFMYVIDEIDSPVDGDITITLPNDVTVFVDPAKLDA
    IKGTVVDYRLEGINRNLIMDNPNVKAACGCGESFNV

    >gi|90021074|ref|YP_526901.1| GMP synthase-like [Saccharophagus degradans 2-40]
    MKRKTNTIKQLLAPSFLLACTFTASTHAAEESAQCPSYLDHSFKKLHSTQTVNLCELYTGKPLLIVNTASHCGYTKQFGG
    LEKLYQSYKDQGLQVIGFASDDFKQAAKSEMEAATICYKNYGVTFTMLAPTTVTGEKANAVFSHLNANTSAPSWNFNKYL
    ITKNGQNIEKFNSDVTPLASDLEKKVQKAL

    >gi|90021199|ref|YP_527026.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Saccharophagus degradans 2-40]
    MELHMATVTLKGNAFNTVGNLPSAGSAAPDFKLVKTDLSEVSLADFAGKKLILNIFPSVDTGTCATSVRTFNEKAASLEN
    TAVLCVSLDLPFALGRFCGAEGIDKVDSASGFRSSFGADYGVAFQDGPLAGLYSRSIVVIDESGKVAYVEQVAETVDEPN
    YEAALAAL

    >gi|90021213|ref|YP_527040.1| hypothetical protein Sde_1566 [Saccharophagus degradans 2-40]
    MHTDTFAMKKRNALIVIAFILLAGLQLSTSARATPAPAFTLPEIHSMESLSLADYQGKVIYLDFWASWCGPCRKSLPLMN
    EVYKRLEDKGFMVIAINLDENRELGLKFLENQPLDYPIVFDKTKSVPGKYQLEAMPSAYLIDKKGTIRAIHKGFKEKDLS
    KIETQITFLLDE

    >gi|90021305|ref|YP_527132.1| putative bacterioferritin comigratory protein [Saccharophagus degradans 2-40]
    MALPKVGAKAPAFTLRNQAGEKVRLSSFAGEKNVVVYFYPKAMTPGCTVQACGLRDSKKELEDVDAVVFGISPDPVSRLE
    KFIEKQELNFDLLSDEDHAIAEKYGVWGLKKFMGREFMGILRTTFIVGKDGKIKHVFDKVKTKTHHDDVLAVLKDLAD

    >gi|90021337|ref|YP_527164.1| thioredoxin reductase 1 [Saccharophagus degradans 2-40]
    MTDVQHHQVIVLGSGPAGYTAAIYAARANLKPVVITGMQQGGQLTTTTEVENWPGGVADLQGPDLMVQMQQHAERFDTDI
    IFDHIHECDLSKRPFTLKGNNTYTCDALIISTGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRDKKVIVVGGGNTAVEE
    ALYLSNIASEVTLVHRRDSLRSEKILQERLFAKEKNGNVKIMWNQNLDEVLGDDSGVTGARLKSSIDGSTQEIDASGVFI
    AIGHKPNTDIFQGQLEMKDGYIVIKSGLNGEATSTSVPGVFAAGDVADHIYRQAITSAGFGCMAALDAEKFLDS

    >gi|90021376|ref|YP_527203.1| hypothetical protein Sde_1731 [Saccharophagus degradans 2-40]
    MSVNLVHDNSQQFDDALAMAKTLVPLNGLRESYLADLFNHVSVQTILQGQVLFQFGQVDNQHIYLLHGEVHLQTASGEVV
    SVATEDSILPLAHAQPRQQRGVAITDCMILRVDSDYLDRMVCWSQISDYLLAELCNERDMDEDMEWIQTVLKSNLFYKVP
    PINVEMIFDRLKPVIVMAGDAIIRQGELGDACYFIKEGEAEVTQRSESGKLVKLADINVGRCFGEDALVNETVRNANVTM
    KTDGVLMVLNKQDFLLLRKEPVVEEVTENEAASMLQSPVYVDVRTDEEYNLGHLSFSANIPLGLLSLKKRLLDPAKPYVF
    Y
    CDTGRRSRAAAYLLGKQGYNAMALAGGFIEAGLSENLVQEAGYMLRHGELVAGAE

    >gi|90021445|ref|YP_527272.1| Na(+)-translocating NADH-quinone reductase subunit D [Saccharophagus degradans 2-40]
    MKIKELLFKPLFDNNPIALQILGICSALAVTTSLRVTLVMCLALTLVTAFSNFFVAVIRNHIPNSIRIIVQMTVIASLVI
    VVDQVIQAFAYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKNPPIPSFFDGVGNGLGYSVLLITVAIIRELFGAGSILGIQ
    LLELTTNGGWYVANGLMLLSPSAFFIIGLLIWALRGWKKGQVEPAEYKIAPNTVATAETA

    >gi|90021446|ref|YP_527273.1| Na(+)-translocating NADH-quinone reductase subunit E [Saccharophagus degradans 2-40]
    MEALLSIFVESVFVKNMALAYFLGMCTFLAISKKIDAAIGLGIAVVVVLTITVPVNNLMFNYLLADGALAWAGLEGVDLS
    FLGLICYIGVIAAIVQIMEMVLDKYFPALYGALGVFLPLITVN
    CAILGAALLMVQREYTFSESVVFGVGSGVGWAFAIVA
    LAGIREKLKYSDVPEGLRGLGITFITVGLMSLGFMSFGGIAL

    >gi|90021450|ref|YP_527277.1| soluble pyridine nucleotide transhydrogenase [Saccharophagus degradans 2-40]
    MAEFQYDFLVIGAGPAGEAAAMAAAKSDLRVGVIESQGMLGGNCTHRGTIPSKSLRHTVKQVIQFGSQPIFRNIGGARPL
    TYPAVLDAASQVIPKQVELHTEFFARNRVRVHSGNARFLSNTQVEVMDSHGVRDVISAERVLIATGSRPYRPDDVDFTHP
    RVYDSDTILDMQHTPRTIIIFGAGVIGCEYASIFAGLGLKVDLINTRERLLEFLDDEISDALSYHLRDNGVMVRHSEECA
    SVDATSKGVTLNLKSGKRIRADALLWCNGRTGNTDMLDLENAGLEANHRGQVKVDNNYCTEVDNIYAAGDVIGWPSLASA
    SYDQGRAVVAAMLQKEMRFVEDAPTGIYTLPEISSVGKTEAELTSARIPYEVGRAFFKDTARGQISGEDVGMLKILFHID
    TLEILGIHCFGAEAAEIIHIGQAIMNQPNGANTVKYFVNTTFNYPTMAEAYRVAALNGLNRVNRHS

    >gi|90021496|ref|YP_527323.1| glutathione reductase [Saccharophagus degradans 2-40]
    MTFDYDFFVIGAGSGGVRASRIAAGLGAKVAVAEDTFMGGTCVNVGCVPKKLFVYASEFAEHFEAAKGFGWQQVDGSFDW
    PTLRDNKTKEIERLNGIYERMLGGANVEVIHGRATLLGNNKVGIGDKVVTAKHILIATGGTPKWPTFEGAEH
    CITSDQIF
    YLETLPKRVLVQGGGYIAVEFAGILNGLGCATELAYRGPLFLRGFDSEVREFVATQMAEKGVQLSFNTDIESIAKNDDGS
    LTVRLNNGEVREVDAVLSAIGREPRINGLGLENTQVKTAKNGFIEVDNNFLTADPSIYAVGDVVGRMPLTPVALAEGMAL
    ARYLFDNKPIELNYSNIPTAVFCQPNIATVGLTQQQAEEQFGEVLVFKSDFKALKHTLSGLAERTLMKLIVDKTTDKVVG
    CHMVGPDAAEIMQGIAVAIVAGATKQDFDNTIGIHPSAAEEFVTMRSPV

    >gi|90021507|ref|YP_527334.1| protein-methionine-S-oxide reductase [Saccharophagus degradans 2-40]
    MSLFYAKPEKAKMPTEKTALKGRNVPIETAAEHFVSGMPLAPPYPSNMQQCVFGLGCFWGAERKFWQLPGVYVTAVGYSA
    GFTPNPTYEEVCSGSTGHNEVVLVVYNPSQVSFKKLLAVFWESHNPTQGMRQGNDLGTQYRSGVYVYSDEQAEQAEHSKQ
    VVQAMLTEKGYGEITTEIIKAKEFYFAEAYHQQYLAKNPNGYCGLGGTGIVVPCD

    >gi|90021517|ref|YP_527344.1| heat shock protein DnaJ-like [Saccharophagus degradans 2-40]
    MERLKLFIPVFVFAFLAVVLMYALIRGDTGHVESALLDKPVPEFTMPSLFDEKPAVSGEEIKGKPYLLNLWGTWCAPCKK
    EHPELVALSKKGVRIIGVNHKDDKELALKWLEEHQDPYEAVIFDDTGRFGLDLGITGLPETFFVDADGVIRYKHTGPISE
    YIWNTKLASQWQALQAPAAN

    >gi|90021562|ref|YP_527389.1| MerR family transcriptional regulator [Saccharophagus degradans 2-40]
    MSTVYWIDVREADEYASGHHPQAVNIPYESIGARIGEVTEDKDADIRVYCRTGRRSGIAKDTLNALGFTKVTNEGGIEDV
    LK

    >gi|90021588|ref|YP_527415.1| hypothetical protein Sde_1943 [Saccharophagus degradans 2-40]
    MHTDKHICPYGLKSRDLLKREGYEVDDNLLTSRKETDNFKQEHDVNTTPQTFIDGKRIGGYDDLKKFFGKSKDESKETTY
    TPVIAIFSITFLMAAALTWSRFQGVNVLYLLETFIALSMCALAIQKLRDLNAFSLQFITYDLLAMQYVPYAYLYALLEAF
    AGIGMLTGMASWLFAPPALFIGTIGAISVFKAVYIDKRELKCACVGGNSNVPLGFISLTENLMMIAMGTWMLIK

    >gi|90021597|ref|YP_527424.1| putative cation-transporting ATPase membrane protein [Saccharophagus degradans 2-40]
    MKPLTDHQSFEFKIEGMSCASCVRRIEKALLATDGVSSASVNFATETGKVEVGADTSQDTIYAAVKNAGYQAIAMEDASS
    VNATNQGGRLFILSGMLTIPLMLPMVGEWFGFNWLLPIGLQLMLASIVQFYFGFRFYRGAYAALKARSGNMDSLVALGTS
    AAYGLSIYNILIGHAGHLYFESSAVIITLVILGKWMEARAKNQTTNAIRALQDLRPENANLIENGIEKIVPANTLQIENI
    ILIKAGERVAADGVILSGNGYLNEALITGESLPVEKQEGDKVIGGSINIDGLLTVKVTSSNAESTLAKIIHLVESAQAKK
    SPLQKLVDRISAVFVPVVLVIALVTLLTWGFVTGDWTQAIISAVAVLVIACPCALGLATPTAIMVGTGLAAKRGILIKDA
    EILESTEHVDVVAFDKTGTLTEGKPRVEQIDAFVGEGKQLLGYLKGLQQGSEHPLAKALLDHATKESIIAERFELIHTLP
    GLGMRGQLEEGNYWFGNKRLMLNVGIEASLLEDYSEEFAIKGNTLSWVARQIKPNTIELCGLVQFQDTLKSSAIEAVSRL
    HELGIQTCLLTGDTQDSADVIAAKLGIDFVRAEVMPEHKADVVSQFQLEGKKVAMVGDGINDTPALATAHVGIAMGAGTD
    VAMQTAGITLMQSDPLRVVEAITIAKKTQQKIRQNLFWAFIYNLVGIPLAAFGLLNPMVAGAIMAVSSVSVVLNALLLRL
    VKIT

    >gi|90021749|ref|YP_527576.1| dihydrolipoamide dehydrogenase [Saccharophagus degradans 2-40]
    MSNKYDVIVIGSGPAGYVAAIRCAQLGLKTACIEKWKDKDGKGVNGGTCLNVGCIPSKALLDSSHRYEDAHKGFASHGIK
    APNVEIDVPSMIARKDKIVKQMSGGITGLFQANKVTSLYGTGKLLAGRKVQYVALDGKEEVLEAENVILASGSIPVNIPV
    APADGDVIVDSTGALEFQAVPERLGVIGAGVIGLELGSVWGRLGSKVVCLEAMDSFLAMMDQQIATEAKKILVKQGLDIR
    LSCRVTGTEVVEAKGKKEVIVTYTDKDGNEAKETFDKLIVCVGRRPFTDGLLSEDSGVKLDERGSIYVNDLCSTSAPGVW
    AVGDVVRGPMLAHKGSEEGVMVAERIAGQKTVMNYDIIPNVIYTHPEIASVGKTEEQLKADGEAYEVGTFPFLAIGRAVA
    ADCAEGMVKMIAHADTDRVLGCHIVGPNAADLVQQVAIAMEFGATSEDIGMTVFGHPTFSEAVKEAALAVHGHAIHMPNR
    KKRK

    >gi|90021866|ref|YP_527693.1| hypothetical protein Sde_2221 [Saccharophagus degradans 2-40]
    MLDTKPLLLNSDFPAINRGALSVLQVNLGYLCNLSCTHCHVNAGPKRTELASLETISAILAYIDLTGVTTLDLTGGAPEM
    NPHFKYLVREASARNVTVIDRCNLTILNEPGYEDLAEFLALHQVVVSASLPCYSEKNVNEQRGKGVFGSSITALQKLNKL
    GYGTSENLSLNLVYNPNGPFLPPSQQALQQDYKQKLAQDFGISFNELLTITNMPISRFGSMLLSKGLYEDYLQLLKDNFS
    AANLAGVMCKNLISIDWQGYVYDCDFNQMLDMPLQTHSAGAKGMIASDAKRTHISDLLQQDITGNPIVIGDHCYGCTAGQ
    GSS
    CGGALA

    >gi|90022044|ref|YP_527871.1| bacterioferritin [Saccharophagus degradans 2-40]
    MTEFAVILLSTVLVNNFVLVQFLGLCPFMGVSNKLETAIGMSTATTFVLTLASICSFMVHSWVLEPLGLTYLKTISFILV
    IAAVVQFAKMFIEKTSPLLNRVLGVFLPLITTN
    CAVLGVALQNTNRAHNFLESTLYGFGAALGFSLVLILFSAMRERLAV
    ADVPTPFKGAAIGMITAGLMSLAFMGFAGLV

    >gi|90022050|ref|YP_527877.1| electron transport complex RsxE subunit [Saccharophagus degradans 2-40]
    MATYSEITSNGLWKNNPALVQLLGLCPLLAVTGSVVNALGLGLATLLVLIGSNVAVSLIRNAVSDAVRLPAFVMIIAAFT
    TCTELVMQAFTFELYQILGIFIPLIVTN
    CSILGRADAFASKNKVLPSAVDGFMMGMGFLLVLLVIGAVREIIGNGTLFEN
    MHLLFGEAARNWRLDLFGEGYKGFLVAVLPPGAFLVTGLLIAVKNMVDAELKRREDARKAKPVKGSKRVRTTGQIA

    >gi|90022061|ref|YP_527888.1| cation transport ATPase [Saccharophagus degradans 2-40]
    MAHSCFHCGLPAHEQYSATVDGELRNFCCVGCQAVAMAIVEGGLGDFYQYRESTNPKVKEVSQAYLEFDLHEVQADIISR
    VSQSTFRVRFYLESIS
    CAACAWLIENYLGQTEAISRVSVNATTQICTIEWDKSKLPLSSLMHKLELIGYSPRPASSQAAA
    ESARNIQRSHLMRLGVAGIGMMQVGMVAVALYAGGIQGIESGWQGFLRWVSFVFATPVMLYSAQPFFYSAWRALKLKSLN
    MDVPVCIALVLAYGASIYATLTNTGEVYFDSVSMFTFFLLLGRYLEMRARHSNQNKSQHNLNLLPLTAQKVQDSQYITVP
    LKSVKVGDTLHIEAGAVFPADGTVIAGSTTADESLLTGESTPVNKTKGCSVIAGSVNGDTAVTICVTAVGDNTALSVIEN
    LVDEAQQQKPAQVAFADKIAGKFVAAVLVVSCVVGGYWLWQDSSRALWVVLSVLVITCPCALSLATPAALTAGTTKLREQ
    GFLVRSKHVLETLAKINHVVFDKTGTLTAGQFSIEQVVCVRESFDEGSVLTLVAALEAHSRHPIASAFKHIPFIEPASQV
    SVIPGLGIEGDWMGARYKFGKKELAAEHVDFPPAISSNSTGLWQCLADSNGVVAWLCLSDTVRPETAEVLNGLQAQGLRT
    SLLSGDRQANVDKFALNLALAHQAGDILPQGKLAYVNEHQQAGDTIMMVGDGINDAPVLSGADVSVAMPKATELAQIKSD
    AVLLHDNLHTLLQALATAKTVQAVIRQNLAWALLYNVLALPAAAMGLIPPYLAAAGMSLSSLVVVVNSLRVART

    >gi|90022075|ref|YP_527902.1| response regulator receiver domain-containing protein [Saccharophagus degradans 2-40]
    MGVLVGKQAPDFTAPAVLGSGEIVDSYNFAEATKGKKAVVFFYPLDFTFVCPSELLAFDHRIAEFEKRGVEVIGVSIDSH
    FSHNAWRNTPVNEGGIGPVKYTLVADMTHAICKAYDVESEGGVAFRGSFLIDEDGLVRHQVVNDLPLGRNVDEMLRMVDA
    LAFHQEHGEVCPAGWKDGDKGMTASPEGVAAYLSENASNL

    >gi|90022083|ref|YP_527910.1| glutaredoxin-related protein [Saccharophagus degradans 2-40]
    MDIIETIKKQIEENSIILYMKGSPNAPQCGFSAKASQAVMACGQRFAYVDILSNPDIRANLPKYANWPTFPQLWVNGELV
    GGCDIIVQMHESGELKPIIDAAAPKEEASE

    >gi|90022159|ref|YP_527986.1| hypothetical protein Sde_2514 [Saccharophagus degradans 2-40]
    MLEHLKFDNSFDKLGSDFATRVNPRPLVNPKLVCVDSKTCELLGISKDSVSSENGVNMFSGNRVPPQFAPLAMVYAGHQF
    GGYSSQLGDGRGLLLGELNTHSGKYDLHLKGAGKTPYSRFGDGYAVLRSCIREYLAGIAMRGLGIPTSHALCVVRGDNAV
    TRETIEPAATLTRVARSHIRFGSFEYFYYTQQHTQLEQLADYAVEQYIPEYVDKDGRFNALLHYTTEQTAKLIAAWQAVG
    FCHGVMNTDNMSIIGETLDYGPYGFMEAYNPTHICNHSDTYGRYAYDQQPSIGLWNLNALAAALSPLIDRDQARASLESY
    EGILTKEYNSRMTKKLGFLSAKQGDAKLINTMFIQLEQLQLDYTLFFRLLALAKADDLQSSFIQPLLGCDNIAKGEQLAA
    WAAEYLTRRQLEDVPQATITADMNHHNPIYCLRNYFAQQAIDEAYQQGTYSTLEKLAAVLAAPFTSHPNASEFETPPPSE
    LANIAVS
    CSS

    >gi|90022161|ref|YP_527988.1| soluble pyridine nucleotide transhydrogenase [Saccharophagus degradans 2-40]
    MIESQYDLVVIGSGPAGQKAAIQAAKAGKSVALIEQTRELGGSCVHRGTIPSKTLKENALRVKNMRSNAELSHFQLREDV
    ELATLIDRLNEVLAEHDSYMRRQLERNEITLIHGRAKFLSPNQLEVTKLQQEAECISAANIIIASGSHPRQPPNIHIDHE
    YIFDSDSILSMMYLPKSLTVLGGGVIASEYASIFQALGVKVTMIDRYPRPLGFLDDDLTDVFIQAFEQMGGTWVGNTVVE
    ECHWNNVDSVETVCADGNIYKSEKLLCAAGRLANVKDLHIEQAGLALNDAGLISVDGQLRTSVPHIFAAGDVIGPPSLAS
    ASMEQGRRASCNALDISVGKMHSMIPTGIYSIPELSSVGLSETQARKTHGDVLVGKAKFDEIARGQISGVQNGMLKIVCD
    AQGEKVLGVMIVGEGATELVHVGQMALLHEADVDLFVDCIFNFPTLAEAYRVAALQIIGQRNAKR

    >gi|90022250|ref|YP_528077.1| hypothetical protein Sde_2605 [Saccharophagus degradans 2-40]
    MANTSTPPVLYGIKNCDTVKKARKWLDANNIEYVFHDFRSDGLHANQLKKWFSQADITTVVNKRSTTWKQLDHADQQALE
    AGHGQAIIMANPTLIKRPVLELNGEVTFGFKPEHYQTIFDQ

    >gi|90022323|ref|YP_528150.1| fused rhodanese domain-containing protein/phosphatidylserine decarboxylase [Saccharophagus degradans 2-40]
    MPDRLPLIAEPAAVHAFLKTHREAVSTYPVCIVDLCSEQTYRHGHIEGAISIPVGILMSGQPPAAGKIASQDQLSRLFSY
    LGTTSDTHFIVYDDEGGGWAGRFVWTLDVIGHKHVTVIDGGLIAWQGDGLPLVTEPFSPEPENYPVTIDSTQIVTAQNIV
    ASLGAPDFAIWDARSRAEYTGMNKFAARGGHIPGATHCEWTTLMDPARNYRIRTDAKAHLDKLGLNAEKNIVTH
    CQSHHR
    SGYTYLVGKYLGLNIKAYDGSWSDWGNTDGLPIEGI

    >gi|90022413|ref|YP_528240.1| VCBS [Saccharophagus degradans 2-40]
    MARIPTLPVGEAEGKTKSLYETVQRQLGIVPNIFLTFGQAPAVLEAYLGQVSALAGGALSSDLREQIAVATAALNACDYC
    ASAHTLLGKKAGVSEAELAANLALRSDHPHTQAVLTFVKAIVTKRGHIADSDLLAIRAANYSEEEIVEIIAHVGLNMFTN
    YFNHIAQTDIDFPLVETQKSKVA

    >gi|90022452|ref|YP_528279.1| alkyl hydroperoxide reductase, C subunit [Saccharophagus degradans 2-40]
    MQTIINTKILPFKATAFSKGDFIPVSEQDLLGKWSVVMFYPADFTFVCPTELGDMADHYAQLQEMGVEVYSVSTDTHFTH
    KAWHDSSDTIGKINFPMIGDPTGTISRNFGVMIEEDGLALRGTFVINPEGEIKVAEIHDLGIGRSAKELVRKIQAAQYVA
    EHDGEVCPAAWQPGEATLAPSLDLVGKI

    >gi|90022453|ref|YP_528280.1| alkyl hydroperoxide reductase, F subunit [Saccharophagus degradans 2-40]
    MLDQTLINQLKQYVQHIKRPVELVLTLNSSDKSEELQALGEQLASLSDLISLQIDAASSKRSPTLLVRSPDTKSEIRFSG
    IPLGHEFTSLVLALLHTGGHDTKQEQAILDQIKTLELPKGAEYFEFETYISLS
    CQNCPEVVQALNILAAINPQIKHTMID
    GALFEQEVSERKVMAVPSVFLNGKLFGQGRMNISQILAKLDSGSAEKQKNALNEKPNFDMLIVGGGPAGASAAIYAARKG
    IKTGIAAERFGGQVADTLAIENFISVKATEGPKLVSSLESHVRDYDVDIMQGQQAAKLTPASESQSGLVEITLTNGAVLK
    SRSVLLATGARWRELGVPGEQEYRGKGVAY
    CPHCDGPLFKGKPVAVIGGGNSGVEAAIDLAGITSHVTLLEFGETLRADD
    VLVRKLKSLPNVKIITSAQTTEVHGDGEKVTGLRYTNRETNIEHSVALAGVFVQIGLIPNSEWLGEPSGNAVKRTRYGEI
    ETNSKGETSVPGVFAAGDVTTAPYKQIIVAMGSGASAALGAFDYLMRQETDESKSVAA

    >gi|90022573|ref|YP_528400.1| glutathione peroxidase [Saccharophagus degradans 2-40]
    MASIYDINIQSLQGQLIGFSDFKGKALLIVNTASKCGFTPQYEGLQQLHQQYASEGLVIIGCPCNQFGKQEPGDAKAISE
    GCLINYGVDFLITEKIHVNGANTHPLYRYLKTALPGFMGNNIKWNFTKFLIGKDGTPIKRFAPFTKPASMEGAVKKALG

    >gi|90022624|ref|YP_528451.1| hypothetical protein Sde_2982 [Saccharophagus degradans 2-40]
    MDKFKDKDMEYCKKIVWLFGLLYACSINAAPAVGEMPYGVLGRDNNGDVIELSAYQNKVVIVTFWATWCGPCMRELPVLS
    GVQKKLGTDKLQVIAVTYKESRKLYKAIAKELADYPLILGYDHKGRVAKKYGVEAIPHMVIIGKDGKIRAVHVGYSEASL
    PGFVDEINLALSES

    >gi|90022827|ref|YP_528654.1| protein-methionine-S-oxide reductase [Saccharophagus degradans 2-40]
    MAKSIGTLLAVSSVVAIAAVFSQVGLVSQTIADEINAEPDMSMTVAQAQQLVARGENLTSIPKHIWRQLLTKHEYNIMWE
    KGTERAFTGDLLEVQQPGVFVTAGCKLPVFKTEHKFKSGTGWPSFWDVVDKNNIILKDDSSWGMRRIEVLSACGEHLGHV
    FDDGPEPTGLRY
    CINSAALDFIAADTAEPEE

    >gi|90022998|ref|YP_528825.1| hypothetical protein Sde_3358 [Saccharophagus degradans 2-40]
    MPNVSQSDQCKPSVVIHYCTLCQWQLRSAWMAQELLQTFADELYQVALRPGTGGVFEIWVDEHLVWERKRDDGFPGPKEL
    KQRIRDVVSPDKSLGHVDRARKGEQN

    >gi|90023071|ref|YP_528898.1| hypothetical protein Sde_3431 [Saccharophagus degradans 2-40]
    MSRINTPQTIQEAPKASQSILDTVNQQLGSVPNLFRITSNSPHTLEGYIALNSALAKGTLPAATRERIALAIAEINGCDY
    CLAAHNYLGRNLAKLSSEEININRRGSSLDAKAAAAVEFAATIVKQRGRTSKADFEAVRAAGYSDAQIIEIVGHTALNTL
    TNYLNETLKTVIDFPAVVPLGAS

    >gi|90023191|ref|YP_529018.1| thiol:disulfide interchange protein DsbE, putative [Saccharophagus degradans 2-40]
    MFIRSFSRIACFVIALGVLAQPATAKEKTTALSGPAPDFTLKSNTGKNIRLSELRGQVVMLNFWASWCGPCKQEMPLLDA
    LYQRYQPAGFTLLGINAEEDIGAAKALLAKDPVAFPVLFDTDSKTSETYGVDAMPSSVLIDCNGNMRHLHRSYVPGDEKI
    YKKLIKSLLKECK

    >gi|90023225|ref|YP_529052.1| disulfide bond formation protein B [Saccharophagus degradans 2-40]
    MKITKLPSYRQTALIIFAGCVGLILAALYMQEVLGLHPCPLCITQRIFIIGVGLISLIAAIHNPAALGRKVYGCLATLSG
    VIGAGVSARHVWLQNLPEDQVPA
    CGPDLAYMFDAFPLLDALKLLFAGDGNCADVVASFLGLSIPGWTFVAFVGLIAISVW
    QGLRKA

    >gi|90023260|ref|YP_529087.1| hypothetical protein Sde_3620 [Saccharophagus degradans 2-40]
    MKESVQNYYGEVLAHSDNLQTNACCTGDAPPAYMRDILSKIHDEVSSRYYGCGLVMPEALSGARILDLGSGAGRDCYALS
    ALVGEQGSVVGVDMTPQQLAIANKHRDFHAQAFGFNKPNVTFIEGELEHLDKLDLAPNSFDVIISNCVINLCTDKTAVLK
    HAWHLLKEGGEFYFSDVYADRRIPTNLSQDPILYGE
    CLSGAYYWNDFINAAKTAGFIDPRLVESSPITIENEQLEQRVGN
    IKFYSATYRLFKLAGLEPACEDYGQAVIYNGGIAHHPDSFSLDGHHIIEKGRIFPV
    CGNTFRMLNESRFKQYFTFIGNFD
    NHFGIFPGCGTAIPFADELSAAANCC

    >gi|90023293|ref|YP_529120.1| mercuric reductase, membrane-associated [Saccharophagus degradans 2-40]
    MTPKKIGVLLVVALCVCAFFYFDLDRYIAVGLMRDWVAQSPVMASTIFALLYFMVAALSLPGTGAMTLLAGAVFGLWWGF
    LLVSFASTIGATVNMLVSRLLLRDWVTRRFRTSLERVNEGVEREGSFYLFSIRLIPLVPFFVVNPVFGLTNMRATTFYWV
    SQVGMVPGTLLYVNAGVALGALDSISMGAIFTPQIIGSLVLLALFPWVAKAIVEAVKRKRTLAKYKKPKHFDANLIVIGA
    GSGGLVAAYIAAAVKAKVILVEKDLMGGD
    CLNTGCVPSKALIKAAKVAHQTRNAQHLGINAQPEIDFAKVMQHVKGAVKQ
    IEPHDSVERYTSLGVDCVQGEAEIISPYEVRVNGKVLAAKNIIVATGAAPSVRPIEGLDTINYLTTDTVWNLTQLPNRLV
    IAGGGPIGCEMAQAFARLGSQVTVVQRGDQLLPKEDADVAEFALNTLRNEGVEVLLNAELTAVAAGEGKSVLTISQNENT
    QHLECDQLLLALGRTPRLQGFGLENIGVAISEQGKLLVDRFLRTSIPTVYACGDVIGPYQFTHAASHQAWYASVNALFGG
    FKSFSVDYSALPWVTFTDPEIARVGASEMDLKKRGVHYEVTRYSLVELDRAIAEGEAHGFVKVLTEEGKDRILGAVIVGS
    HGGEMITEFVSAIKHGKGLNAILGTVHSYPTWSEANKAAAGKWKQAHAPQRLLQWVEKFHRWQR

    >gi|90023295|ref|YP_529122.1| thioredoxin [Saccharophagus degradans 2-40]
    MSEAIVQVSDASFEQDVLSSDIPVLVDYWAAWCGPCKMIAPVLDELAKEYEGKIKICKMDVDANKETPAKYNIRGIPTLI
    MFKGGNAEGTKVGALSKAQLKEFIDASL

    >gi|90023467|ref|YP_529294.1| putative glutathione S-transferase [Saccharophagus degradans 2-40]
    MLRIYGDIQSGNCYKVKLLCLLLDIQHEWVHMDIVAGDTRNELFLQKNPNAKVPVISLDSGRNLWESNAILNYLAEGSPL
    LPQDPLQRATILQWQFFEQYSHEPYIAVARYINKYLGLPAERADEYHAKQAGGHKALAVMEQHLAICPYFVGEAMTIADI
    SLYAYTRVAHEGGFDLSAYPGINRWFARIEAQPKFQSMQQLLIADGGY

    >gi|90023519|ref|YP_529346.1| transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Saccharophagus degradans 2-40]
    MPHPATRVAIENSEQHAHYKIVERAITYLVANQREQPSLALVAKQVGLSESRLQRVFTDWAGVSPKQFLQFLTKEHAKQA
    LTHAPVLEAALASGLSGSGRLHDLMVRCESITPGEYKKQGAGLTIEYGAHSSPFGFCFIAVTPRGVCKLAFYDQQREHAL
    LVDELQADWPNATLVHSPTGTEYSFRQIFGNGQSRGDIKLLLKGTPFRLQVWEALLRIPSGQLLSYQQVADAIGKPNSVR
    AVASAIASNHIGYVIP
    CHRVIRNTGGLSEYRWGAYRKRSLIGWEQAQIVKRVD

    >gi|90023619|ref|YP_529446.1| glucose-inhibited division protein A subfamily protein [Saccharophagus degradans 2-40]
    MLDKIQKANVPVLVSFSICPFVQRSAILLEEKLQAYERINIDLANKPEWFLQLSPTGRVPALVVKDDNANPTTLFESAVI
    NEYLDEAFGTPLLAGTSLEKASMRAWISYSETLIGLQYKLMLATQSDDFADKLTQFVSALKKLKPAPGKPFFNGVAFSLV
    DAAVAPVFTRLKWLPHVTLQLQQEAKTQPDSAALLNWINHLSNYPAVKQSVSQSFDNDFVNYFKQRNSFALK

    >gi|90019694|ref|YP_525521.1| GGDEF [Saccharophagus degradans 2-40]
    MTEQTNKQQKGIKYTVIAAVAFMVIVLSLFMNKILQPRILSDQQLRANGAIEFDTARIIRDFNLVDQNNQPYTLEALKGK
    WTLIYFGFTHCPDI
    CPTTLMQLSKVVNSLEPEIKANTQVLMVTADPARDTPEKLKIYIEHFNKDFNAITGEFLAVKRLAG
    DLNVAFNKVMLDNGDYTIDHSGNLILINPHGHYHGFFKPPFELAKLKLTYQSIVSSAEL

    >gi|90021313|ref|YP_527140.1| hypothetical protein Sde_1668 [Saccharophagus degradans 2-40]
    MKITLVKKILADGSPCKKCGDVLNKLEQSGQMVRIDQVLVADERDETSEGMVLAKQYSVDRAPFFIVENEGQEPVIYTVY
    MKFVKEVLDQKTEETDELKEIMADNQDLDFL