Saccharomonospora viridis DSM 43017 uid59055

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257054165|ref|YP_003131997.1| methionine-S-sulfoxide reductase [Saccharomonospora viridis DSM 43017]
    MVLFGRSKTQLVSADEALPGRAEALATPDLHAVFPDRRIKPPFPEGMRTAVFGLGCFWGAERLFWQTPGVYSTAVGYSGG
    YTPNPTYEEVCTSLTGHAEVVLVVFDPQQVSYESLLKVFWEGHDPTQGMRQGNDIGTQYRSAIYYANDEQLKAAESSREA
    FQKALSAAGYGEITTEIAPLREFYYAEDYHQQYLYKVPHGYCGIGGTGVSCPVGTGVSGSE

    >gi|257054173|ref|YP_003132005.1| Rhodanese-related sulfurtransferase [Saccharomonospora viridis DSM 43017]
    MNHSADVPTVSVDDLPSGEEYVLLDVREQDEWAAGHAPSAVHIPLGDLPSRAAELTELADDRPVYVVCRTGGRSARATAW
    LNAAGVVDAVNVAGGMKSWVTSGRPLVGENDGVAAEVL

    >gi|257054360|ref|YP_003132192.1| Glutaredoxin-like domain (DUF836) [Saccharomonospora viridis DSM 43017]
    MPESSSQDTEHTVVVLTRVGCPACEQAERDVERICGELGVRWSTTDVDTDPELRAEYGDRVPVILVDGAEHGYWSVDEQR
    LRSALGA

    >gi|257054371|ref|YP_003132203.1| thiol-disulfide isomerase-like thioredoxin [Saccharomonospora viridis DSM 43017]
    MFAAMAVAVAGCSGGGEGDFNFVSPNGQVDIYYEGEQRQELPEMVGEDLFDPDKRISTADFEGQVLVINIWGQWCGPCRA
    EAPELQQLYEKTKDDGVVVLGVDVRDYDRSAPQDFMRDRGLTYPSIYDPSGRSLVNLSGYPRTAVPSTIVVDRQGRVAAV
    FLRALLASDLQPLIDRLVAEDAA

    >gi|257054641|ref|YP_003132473.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Saccharomonospora viridis DSM 43017]
    MTKIVIMGGGPAGYEAALVAAQHGADVTVVERDGLGGACVLYDCVPSKTFIASSGARASLQSFPELGIQVDSEPRVDLPS
    VHARVRDLALAQSADIRARLQREGVRILTGTARFRDSKPGLATHKIGVTYPETGEEEILDADVVLVATGATPRVLPGAVP
    DGERILDWRQLYSLPELPEHLAVVGSGVTGAEFASAYTEMGVKVTVVSSRDRVLPHEDADAAAVLEEVFSRRGTTVVKQA
    RAERVERTADGVVVHLTDGRKIEASHALMTVGSVPNTSDIGLERVGIEPGPGGFINVDRVSRTSAPGVYAAGDCTGVLML
    ASVASMQGRIAMWHALGQSVTPIRLRTVAANVFTHPEISAVGVSQQAIDSGEVPARTIMLPLATNARAKMEGVHHGFVKL
    FCRPATGVVVGGVVVAPNASELILPIALAVQNQLTVDNLALTFSVYPSLSGSITEAGRQLMRHDDLD

    >gi|257054741|ref|YP_003132573.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Saccharomonospora viridis DSM 43017]
    MSGTGGGKSTLPPLVEPAAELTKEEVERYSRHLIIPDVGVDGQKRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLGVIDF
    DVVDESNLQRQVIHGVSDLGKPKAVSAKESVAEINPFVNFVIHQEQLTKDNALDIFRGYDLILDGTDNFATRYLVNDAAV
    LLGKPYVWGSIFRFEGQVSVFWEDAPNGQGLNYRDLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIMVTEAIKLITGIGEP
    LLGRLVTYDALEMRYREVKIRKDPETPKITELIDYEAFCGVVSDEAQQAASDHTITPQELKAKFDAGEDFELIDVREPHE
    YEIVNIKGAKLIPKDRILSGEALAELPQDKPIVLH
    CKSGARSAEALAALHKAGFRDATHLGGGVLAWARQVDPSLPTY

    >gi|257055060|ref|YP_003132892.1| mycothione reductase [Saccharomonospora viridis DSM 43017]
    MPHYDLVIVGTGSGNSILDPRFADRKVAIVEKGVFGGTCLNVGCIPTKMFVHPADLAATPESAAKLGVDLELRNVRWRKI
    RDRVFGRIDPIAEGGRRYRIEHEDNANVTVYEGEARFIDHKKLAVQLADEEAILTADNFVLAAGGRAVVPDIPGLADVDY
    HTSDTVMRIDELPRRAIILGSGFISAEFAHVFASFGVDVTVIARSGALLRNEDDDISRRFTELASQRYDVRLNRRTVRVH
    RAGRGGTGVVLELEGPGGEETVEGDLLLIATGRQPNSDLLNVAATGISTRPSGHVVVDEYQRTEVDGIYALGDLSSPYEL
    KHVANHEARVVQHNLLHPDAPIAADHRFVPHAVFTSPQIASVGLTERDAAARGVPYVTATQNYADIAYGWAMEDTTGFAK
    LLADPRSGQLLGAHIIGAQAPTLLQPLIQAMSFGLDARSMARGQYWIHPALPELVENALLALPLKD

    >gi|257055085|ref|YP_003132917.1| Peroxiredoxin [Saccharomonospora viridis DSM 43017]
    MAVEVGTQAPDFTLNDYNKQEVTLSSFRGDKPVLLVFYPFAFSGICQGELCQLRDEFDQYTNVQVLGVSVDTPFALKAWA
    EQQGYQFPLLSDFWPHGEVAKKYGVFNEQAGLALRGTFLIDTEGIVRFAEVNQPGEPRNQEAWKKAVADLV

    >gi|257055101|ref|YP_003132933.1| dihydrolipoamide dehydrogenase [Saccharomonospora viridis DSM 43017]
    MTDAEADLVILGGGSGGYAAAFRAAQLGLSVTLIEKDKLGGTCLHRGCIPTKALLHAAEVADSARDGEQFGVKTVFDGVD
    IAGVHKYKNSVVTRLYKGLQGLAKAHKINYVEGTGTFVGGTTVDVEGTRYTGKHLVLATGSYSKTIPGLELGGRIITSED
    ALSLDFVPKKAVVLGGGVIGVEFASVWASFGSEVTIVEALPRLVPAEDEFSSKQLERAFRRRKIAFKTGVKFTGAKQDEN
    GVTVSLESGETLEADVLLVAVGRGPNTAGHGYDEAGVRMERGFVLTDERLRTNLPNVYAVGDIVPGLQLAHRGFQQGVFV
    AEDIAGLNPTPIDESGIPRVTYSHPEVASVGLTEVQAKEKYGPNITTFTYDLAGNGKSQILKTSGAVKLIKAPDGPIVGL
    HMVGDRVGELIGEAQLIYNWEAFPEDVAPLIHAHPTQTEALGEAHLALAGKPLHVHG

    >gi|257055112|ref|YP_003132944.1| Iron-sulfur cluster assembly accessory protein [Saccharomonospora viridis DSM 43017]
    MTTAEQTGNTSANAGEATHGVTLTEAAAAKAKALLEQEGRDDMHLRIAVQPGGCAGLRYQLFFDERTLDGDLFREFDGLR
    VAVDRMSAPYLEGAEIDFVDTIEKQGFTIDNPNAGGSCACGDSFH

    >gi|257055153|ref|YP_003132985.1| dihydrolipoamide dehydrogenase [Saccharomonospora viridis DSM 43017]
    MSEHFDVVVLGAGPGGYTAAVRAAQLGYDTAVIEERYWGGVCLNVGCIPSKALLRNAELAHLFTREARTFGIHVDGEVTF
    DYGAAYQRSRKVADGRVKGIHYLMKKNAITEFHGRGTFTSDSSIDVATADGVETVTFDHCIIAAGASPRLLPGTSISDRV
    VTYEQQILSSELPESIVICGAGAIGVEFAYILHNYGVKVTIVEFMDRMVPAEDEEVSAELARRYRRLGIDVLTSTKVESI
    DESGEQVRVTVSREGEQQVLEADKVLQAMGFVPNVKGYGLENTGVALTERGAIAVDGRCRTNVPHIFAIGDVTAKLMLAH
    AAEAMGMVAAETIAGVETMELDYRMIPRATYCQPQVASFGLTEEQARAEGYDVQVSKFPFTANGKAHGLADPVGFVKIIS
    DAKYGELLGGHLIGPDVTELLPELTLAQQWDLTVHEVARNVHAHPTLGEAVKEAIHGLAGHMINM

    >gi|257055237|ref|YP_003133069.1| DSBA-like thioredoxin [Saccharomonospora viridis DSM 43017]
    MTAGAQSERTKVDFYFDPLCPFAWITSRWILEVEKQIDIDLRFRVMSLAVLNEGRDLDPDYRKMLDSAWGPVRVAIALDQ
    HRGEKAVRDFYTEFGVRYHNQGNKDVDAVLREALEEVDGSTELLKAAESTEYDEALRKSHHEGMDPVGMDVGTPTIHVDG
    VAFFGPVLTSIPRGEDAVRVFEGARALASYPDFFELKRTRTGSLKFD

    >gi|257055469|ref|YP_003133301.1| glutathione peroxidase [Saccharomonospora viridis DSM 43017]
    MTQTALTDIGLHTLAGEPATLGGLGAKVLLVVNVASKCGLTPQYEGLERLHRRYVDRGFTVVGFPCNQFAGQEPGSEEEI
    ARFCSTTYGVSFPMFTKIEVNGPNRHPVYAELTRHPDADGEAGDVQWNFEKFLIDDRGRVLARFRPRTEPESAEIIEAVE
    TALARA

    >gi|257055666|ref|YP_003133498.1| Peroxiredoxin [Saccharomonospora viridis DSM 43017]
    MKQKDRAPDFTLPDDDGEPRRLSELLRSGPVVLFFYPAAMTPGCTAETCHFRDLASEFAELGAQPVGVSPDPVDRQRHFS
    EAHGIGFPLLSDVDGTVAAQFGVRRGFGPLRTKRHTFVIDTDRTILAVIRSEFRMSVHADKALDVLRARKGA

    >gi|257055719|ref|YP_003133551.1| selenophosphate synthase [Saccharomonospora viridis DSM 43017]
    MAYRLTQYAHGGGCACKIPPGELENVVRGLLDDPQLTPTSPAGELLVGLDDGDDAAAVRLDGDRAVIATTDFFTPVVDDP
    YDWGRIAATNALSDVYAMGGTPLVAVNLLCWPRETLPFDLAAEVLRGGAEVCAQAGCHLAGGHSVDDPEPKYGLAVTGLA
    LADRLMRNDAGRPGLPLSLTKPLGVGVLNTRHKATGESFDEAVEVMTTLNADASQAAVSAGIRCATDVTGFGLLGHLYKL
    ARASGVTAVVDSAAVPVLEAAREAVRAGYVSGGTRRNLDWVRPYTDLSGVAEETALLLADAQTSGGLLVAGELPGAPVIG
    QLVPRGEHIVVVR

    >gi|257055722|ref|YP_003133554.1| thioredoxin [Saccharomonospora viridis DSM 43017]
    MATVELTSENFNEIVGAPGTVFVDFWASWCGPCRTFAPVFEQASEQHPDITFGKVNTEEQLELAQVFGISSIPTLMAVRD
    GIVLYAEPGALPAPVFEELIDKVRQVDMDEVRAEIERQERES

    >gi|257055840|ref|YP_003133672.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Saccharomonospora viridis DSM 43017]
    MSASVRVDVWSDIACPWCYIGKRKFEAALAEFDGAADVTVTYRSFELAPDTPVDFDGSEIDFLAGHKGMPREQVEQMLRQ
    VSAVAESVGLRYDFDALRHTKTLLAHQALHHAKKHGKQLDLVERLFQAYFTEGRHVGRAEELAELAAEVGLDRDETFRKL
    QEGTYADAVQDDLRQAKAFGIRGVPFYVFNERYAVSGAQQPDVFLQALRKARSEGVSS

    >gi|257055986|ref|YP_003133818.1| YeeE/YedE family protein (DUF395) [Saccharomonospora viridis DSM 43017]
    MGGLYRRVFGRFWNPYAAVVAAGVLSACYFAVTATQWAVTGEFTRFGGHLLGVAGVDVSEWEYFRMIGLTGTPLERTSGW
    VVIGMLAGALLAALLGNDVKLRVPQRKRRLLQGLVGGAIAGFGARMALG
    CNLAAFFTGIPQFSFHAWLFMVSMGVGTVVG
    VRVIRLRFWRGRPELSALQRLTLSSQEVSTRSAAPSRPVQPFVGIGVGVVVAGVAVVLAVRGEGLLAAAAVFGVGFGVLI
    QRGQICFTSAFRDLWVSGRATMSKALAVGLLAATVLTFVVIQAGMPAVIEPASLGTVIGGMLFGFGIVLAGG
    CETGMMYR
    AMEGQVHFVVVFVGNIVGATVLAYGWDHWGIFSAVTRGWPEVDLVAAWGAGGALVATVGLLVAWFVFSHWWERRFRYPAD
    SKSRKGRRSVPTAVS

    >gi|257056058|ref|YP_003133890.1| glutaredoxin family protein, arsenate reductase [Saccharomonospora viridis DSM 43017]
    MEIWINPACSKCRSALSLLDAEKAQYTIRYYLEDPPTVEELREVLAKLGMEPWDIARLGEPAAETLGLATWARDEAHRTQ
    WLEALAAHPSLIQRPIITADDGTAVLGRSPEAVRSVLS

    >gi|257056129|ref|YP_003133961.1| alkyl hydroperoxide reductase, F subunit [Saccharomonospora viridis DSM 43017]
    MLDPALTKQLAQHLELLRQPVELVASLDDSAKSAQLMELLTEVAALSEKITVVRRDDDERRPSFAIVRPGTDISVRFACV
    PLGHELTSFVLALLQVGGHPPAVSEEVIEQIRRLDGDYEFVTYLSLS
    CQNCPEVVQALNLMSVVNPRIKHVAVDGALFKD
    EVEARGVLAVPSVFLNGEHFEQGRMTLEQILSKLDSGAAQRAAQEIGNKEPFDVLVVGAGPAGVSSAIYAARKSVRTGVA
    AGRIGGQVLDTMAIENFISVPYTEGPKFAAALEQHASDYEIDIMDSQQAVRLEPATQPGDLHTLVLENDATLKGRTVILA
    TGARWRPIGVPGEQEYRNKGVTY
    CPHCDGPLFRGKPVAVIGGGNSGVEAAIDLAGIVSHVTLLELGDTLRADEVLQRKLR
    SLTNVDIVLNAKTTEVLGDGTSVTGLTYTDTETGESRRLDVQGVFVQIGLLPNTEWLEGVVELTKHKEIVVDERGATSVP
    GVFAAGDCTTEPYKQIVTAMGSGATAALSAFDYLVRTSAPTDD

    >gi|257056130|ref|YP_003133962.1| peroxiredoxin [Saccharomonospora viridis DSM 43017]
    MALINTEVKPFTTTAFHNGSFVEVSDKDLRGKWSIVFFYPADFTFVCPTELGDLADLYDEFTRIGVEIYSVSTDTHFTHK
    AWHETSDTIRKIRFPMLGDPAGVITRNFDVMREGQGLADRATFVIDPDGVIQIMEITPEGVGRNATELLRKVKAAQYVRE
    HPNEVCPAKWEEGEETLAPSLDLVGKI

    >gi|257056398|ref|YP_003134230.1| methionine-R-sulfoxide reductase [Saccharomonospora viridis DSM 43017]
    MESGTQHTPKVVKSEEEWRAQLSPEEYAVLRQAATEPPFTGEYNDTKTTGVYTCRACGAELFRSDTKFESHCGWPSFYDP
    ADSDAVILREDRSLGMVRTEVLCASCHSHLGHVFEGEGFPTPTDQRY
    CINSIALRLVPTED

    >gi|257056726|ref|YP_003134558.1| rhodanese-related sulfurtransferase [Saccharomonospora viridis DSM 43017]
    MRPVISTAELADLLDSDHPPTVLDVRWRLTGPSGRDSYERGHVPEAVFVDVDTELSGKPGIEGRHPLPEPAVLQRTLRAA
    GVSGSRPVVVYDDGDGSVAARAWWLLRWGGHRRVAVLDGGFAAWSAEGRPVETNIVRPEPGDVVIRPGALPVLDADDAAS
    LARSGVLLDARAPQRYTGEVEPVDPKAGHVPGAINSPFTEHLDENGRWRSAEELARHFAELGVGPETPVGVY
    CGSGITAC
    SVVLALELAGHPRPAALYAGSWSNWVADPDRPVATGPQPG

    >gi|257056826|ref|YP_003134658.1| thioredoxin [Saccharomonospora viridis DSM 43017]
    MDLSAVKARAEAAARQASQGGAGGQATNGAAGGNVIDVTEATFQAEVVERSLRQLVVVDLWADWCGPCKQLGPVLEKLAG
    ESNGAWVLAKVDVDANPRISQLFGVQSIPTVIAIAGGQPVDAFSGALPEPQIRQWLTQLLDALRDKLPGIQAAQQGGAQP
    EEPQDPRFAEAENAFAQGDYAAAKAAYQRILDSEPNNEQAKAALTQVEFAERAANVDPSVVAKADEDPNDLDAQLSAADV
    EVARGEVEQGFARLIAAIRRTSGSDRDRVREHLVGLFELFDPADERVAKARRDLASALF

    >gi|257056882|ref|YP_003134714.1| Peroxiredoxin [Saccharomonospora viridis DSM 43017]
    MTDRIRLAEGDPAPDFTLPDSEGNPVSLSDFRGQSVVVYFYPAAGTPGCTKQACDFRDNLAQLNDAGYQVLGISPDKPEK
    LAKFVENEKLTFPLLSDPDKKVLTEWGAFGEKKNYGRIVQGVIRSTFVVDPEGTIAVAQYNVRATGHVAKLMRDLKLTA

    >gi|257057111|ref|YP_003134943.1| O-6-methylguanine DNA methyltransferase [Saccharomonospora viridis DSM 43017]
    MIADWSTVETPIGPFTAVVDSDGAVLASGWTGDVTSLTGIVSPTLRPTQLRHRTDLGEVTTAVRRYHDGELDVVDDVLVR
    QRSGEFLEHAWNVLRTVPAGKPVSYAEFAALAGRPTAVRAAASACARNAVALFVP
    CHRVLRTGGALGGFRWGTDVKRWLL
    THESTAHHQG

    >gi|257057143|ref|YP_003134975.1| highly conserved protein containing a thioredoxin domain protein [Saccharomonospora viridis DSM 43017]
    MNRLATATSPYLLQHADNPVDWWPWSPEALAEARRRDVPILLSVGYAACHWCHVMAHESFADADVAAFMNEHFVNIKVDR
    EERPDIDAVYMTATQAMTGQGGWPMTCFLTPDGKPFHCGTYYPPVPTQGMPSFKQVLTAVAQAWDERRDELVEGAGRIVD
    HIAEQTRPLSPQPVTADTIASAVAKLRTEVDPENGGFGGAPKFPPSMVLEFLLRHYERTDSMEVLSIVDMTAEGMARGGV
    YDQLAGGFARYSVDAEWVVPHFEKMLYDNALLLRCYAHLARRTGSPLAHRVAGETAEFLLRDLRTPQGGFASSLDADAEG
    VEGLTYVWTREQLVDVLGPDDGAWAAETFGVTEEGTFERGASTLRLPQDPDDPARWMRVTSTLLDARNERPQPARDDKVI
    AAWNGLAITALAEAGVALQRPDWIEAAVAAGSFVLDVHKTDDGLRRSSRDGVVGEADAVLEDYGCFADGLLALHQATGEP
    RWLEEAIALLDIALRRFGVEGMPGAYHDTAVDAEELVHRPSDPTDNASPSGASALAGALLTASALAGPERASAYRAACEE
    ALARAGALIAQVPRFAGHWLSVAEAMLAGPVQVAVVGTDARQRERFVVEAAQNIHGGGVVLGGVPDAEGVPLLTDRPLVD
    GRPAAYVCRGYVCDRPVTTPEALLGSL

    >gi|257057456|ref|YP_003135288.1| Zn-dependent hydrolase, glyoxylase [Saccharomonospora viridis DSM 43017]
    MHVEVVRTDALGDRSYLVHDGAVGVVIDPQRDFDRIERLARDRGVRISHVAETHLHNDYVTGGPELARRHGAVYLVGETE
    GLDYEATRLESGDRVDVGALSLTAVATPGHTDNHLAYIVDHDGEQAVFSGGSLLYGSVGRPDLVDPERTTELAKAQYRSA
    RRLVDSVSDDAVLYPTHGFGSFCASDTAATTESSTIGEQRRTNRALTDTDEDHFVERLLANLTDYPSYYAHMAPLNRAGL
    AAPRLELPEPVDLETLRKRLADGEWVVDLRDRVAFAAKHVEGTVSFEYGDGTRFTTFLGWTLPWLDPVTLVGSEEDVRAA
    IRDLSRIGIDDPDVALGDPTERFADELPMSSYPSVGWEELAAEFRRGAAPTVLDVRRIDEYENEHIDGAVNIPLHELLTR
    ISELGDERIWVH
    CGSGYRASTAASLLDRAGYDVVHIDSDFADVVKAGIPLSRR

    >gi|257057560|ref|YP_003135392.1| thiol-disulfide isomerase-like thioredoxin [Saccharomonospora viridis DSM 43017]
    MTTATKWALAAGALALALIVALLPRAENVPGQDGADLASVRQQAALESCVPEEGGDEAGGEALSGVETYCLGDDSRVDFA
    DTLGKGPTLVNLWATW
    CEPCREELPLLADYAAQADAVRVVTVQVQSSAADGLGLLAELGVRLPTVHDGEGGNGPVREALR
    APKALPASYLVVDGEARLVTEPRLFTSLDEIRNAVERVR

    >gi|257057619|ref|YP_003135451.1| copper/silver-translocating P-type ATPase [Saccharomonospora viridis DSM 43017]
    MSSNVASSSAQRDIELAIGGMTCASCARRVERRLNKLDGVSATVNYATEKAKVSFPAALDPAELVRTVEAAGYSAELPRQ
    RAEDDADESAGALRRRLVIAAVLSVPVILLAMIPALQFDYWQWVSLVLATPVVTWAAWPFHRAAWTNLRHRAATMDTLVS
    MGVVAAFAWSLYALVFGSAGTLGMTHAFELTIERTSGDGNIYFEVAAGVTTFILAGRYFEARSKRRAGAALRALLELGAK
    DVSVLRDGEEHRVPVDSLTVGDVFVVRPGDKIATDGVVEEGNSAVDVSMLTGESVPVEVGPGDTVVGATVNSGGRLLVRA
    TRVGSDTQLAQMARLVEQAQTGKAAVQRLADRVSGVFVPIVIVLALGTLGFWLLTGAAAAAAFTAAVAVLIIACPCALGL
    ATPTALLVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTITTGRMTLVDVRVAEGEDVDKVLRLAGSLENASEHPIA
    RAIAKGAAERVGALGSVEDFINVEGLGVRGIVDEHVVLVGRTALLDRWSQHLPPELARAKADAEAEGKTAVAVGWDGKAR
    AVLVVADTVKPTSAEGVARLRGLGLTPVLLTGDNEAVARSVAAEVGITEVIAEVLPQQKVDVVKRFQTDGRVVAMVGDGV
    NDAAALAQADLGLAMGTGTDVAIEAGDLTLVRGDLRVAADAIRLSRRTLATIKGNLFWAFAYNVAALPLAAAGLLNPMLA
    GAAMAFSSVFVVSNSLRLKGFRGTVTDTPHAQGDRDRTEAAEERAAVAG

    >gi|257057620|ref|YP_003135452.1| copper chaperone [Saccharomonospora viridis DSM 43017]
    MVQQTYTVTGMTCEHCARSVREEVGEITGVTDVAVDVPTGKVTITSDTEIAVDDVRNAVEEAGYTLHA

    >gi|257057644|ref|YP_003135476.1| glutaredoxin-like protein [Saccharomonospora viridis DSM 43017]
    MAIDEIEFYWRPGCPFCAILRGRLRESGLPVREINIWEDSEAAARVRSVTGGDETVPTVFVGQRALVNPNMDELAEVVRR
    EAPHLFDLAQPAVQGYGSRH

    >gi|257057647|ref|YP_003135479.1| predicted redox protein, regulator of disulfide bond formation [Saccharomonospora viridis DSM 43017]
    MATRDATTHWTGGLNSGTGTLTLDSSNSARFTVSFPRRIGEPEGTTSPEELIAAAQASCLAMNLAGTLEKEGLTANSIDA
    NASVTVEPSNGGLSINNVDVTLRASVDGIDEERFSTIAQKAKDT
    CPVSRALAGTTITLHASLA

    >gi|257057708|ref|YP_003135540.1| thiol-disulfide isomerase-like thioredoxin [Saccharomonospora viridis DSM 43017]
    MSVTGLWVLVATLVAGVLTGGLLRSRQGRVRRSAEEATGPPSLPGPVSDALVADAVTLVQLSTTFCAPCRHARAVLARVA
    ETTDGVAHVELDITDRPEVAEALRVLRTPTTIAFDPTGRELLRISGVPKPATLRTALAPHIRPTE

    >gi|257057710|ref|YP_003135542.1| rhodanese-related sulfurtransferase [Saccharomonospora viridis DSM 43017]
    MSREDVLVTVEWAEQNLDTPGVVFAEVDEDTTAYDSGHIPGAVKFDWKNELQDPKRRDIVDRQGFEELLSAKGIANDDLV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLTTEVVERERTNYTAKEQDHSLRAFRDEVVEAINVKNL
    VDVRSPDEFSGKLLAPAHLPQEGALRAGHVPSAINVPWSKAANEDGTFKSNEELEQLYKEAGLDPSKPTIAY
    CRIGERSS
    HTWFALHELLGLKDVKNYDGSWSEYGSLVGVPVETGEQS

    >gi|257057817|ref|YP_003135649.1| Peroxiredoxin [Saccharomonospora viridis DSM 43017]
    MSAVPSQPPSGAASRPHVRAPELVGDAWWNTGGRPLTLAGLRGKIVLLDFWTSGCINCLHVLDELRPLEAEFADVLVTVG
    VHSPKFAHEGDRESVAAAVARYGVEHPVVSDPDMSLWQQYAVKAWPTLVLIDPEGYVVHVAAGEGHGDALRRVIQELVSL
    HEGKGTLRRGPLDWTEAACVAAESAASTGADGLRFPAKAVVTAEGRILVADTANHSVAEFASDAETLLRRFGDGRRGAVD
    GAFDVARFAEPSGLTLLPTHIADEVGYHLLVADTANHLLRGVDLRTGAVRTVAGTGRQWRDGDDSGAALEVDLTSPWDVR
    WWDVAGGVVVAMAGNHTLGLFDPIRGTISRFAGTTVEGLRDGPVDEAFFAQTSGLAVAGERLWLVDAETSALRYVERDPG
    SADEDTPRFVVGTAVGHDLFTFGHRDGSAAEALLQHPLGATVLPDGAVAVADTYNGAVRRFDPATGEMTTLRRGLAEPSG
    LVVTDSGVLVVESAAHRLRPLADGGGDEAATARGETMAGDELAVRRPPTVLAPGQVRLSVTFVPPPGEKLDDRYGPSTRL
    EISASPPELLVEGGGVGTELERTITLAEGVESGVLQVVAQAASCASDVEHPVCRITRQDWGVPVRLDPDGARGLPLVMAG
    TPSE

    >gi|257057903|ref|YP_003135735.1| thioredoxin-disulfide reductase [Saccharomonospora viridis DSM 43017]
    MSEDIRNLIIVGSGPAGYTAAIYAARAQLEPLVFEGTQFGGALMTTTEVENYPGFRSGIQGPDLMQEMREQAKVFGADLR
    QEDVEELELTGPIKYVTAHGKRYAAHAVILAMGAAARHLHVPGEQKLFGRGVSS
    CATCDGFFFRDQDIAVVGGGDSAMEE
    ATFLTKFARSVTIIHRREEFRASKIMLERARANEKIKWKLNSEVIEVLGDDKVSGLKLRDTVTGEESTLDVTGFFLAIGH
    DPRSELVRGQVDTDEDGYVLTKGRTSHTNLDGVFAAGDLVDRTYRQAITAAGSGCAAAIDAERWLAEHTTVAEASESSEF
    VGGGYATRAN

    >gi|257057904|ref|YP_003135736.1| thioredoxin [Saccharomonospora viridis DSM 43017]
    MTNTVEVTDSNFADEVLAHDKPVLVDFWATWCGPCKMIAPVLEEIAAEHGDKLRVAKLDTDANPNTTRDYQVMSIPTMIL
    FQDGKPVKQIVGAKPKAALLNDLADVLQ