Ruegeria pomeroyi DSS 3 uid57863

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56694942|ref|YP_165287.1| methionine-S-sulfoxide reductase [Ruegeria pomeroyi DSS-3]
    MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCVEADFEKVPGVLGAVSGYTGGTLDNPTYKQVTRGGT
    GHFEAVQILFDPDQVSRERLLHMFFRSVDPTDAGGQFCDRGDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILT
    AGRFYPAEAYHQDYAKGEKLVLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS

    >gi|56694977|ref|YP_165323.1| thiamine biosynthesis protein ThiF [Ruegeria pomeroyi DSS-3]
    MDRGHEMSRYARQMILPQAGGEGQARLAGARVLVVGAGGLAASALPLLAGAGVGQIDIFDGDHIELSNLHRQTLFAEGDV
    GRAKAEVAAERCGALNSGIVLTGTKRSITPENVILACRDTDLVLDCADSYAASYLLSDTCQALGKPLISASVLGLGGYVG
    GFCGGAPSLRAVFPDAPDSAAS
    CATAGVLGPVVSILGSIQAQMALSALLELAPSPLGQMVQIDALSWRNSTFRFDGAPEP
    ATAFRFVAPSDLSADDLIVELRTEGEAPQPAHPSARRMTVSEIEISDTNKEKRLALCCATGLRAWRSAEQLQPIWPGEIV
    LVAAATS

    >gi|56694998|ref|YP_165344.1| glutaredoxin [Ruegeria pomeroyi DSS-3]
    MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMIQRAGGRRTVPQIFIDGQHVGGCDDLYALEQDGKLD
    PMLASR

    >gi|56695171|ref|YP_165518.1| organic hydroperoxide resistance protein [Ruegeria pomeroyi DSS-3]
    MEPQMTVSPVYTAHARATGGRNGQAQVAESGLDLVLATPPAMGGNGKGHNPEQLFAAGYAACYIGAMQFATTQDKTLAKV
    PADISVDAEVGIGPRAEGGFGLTVALKVSMPGVDAAEAQRIADAGHAI
    CPYSNATRGNIVVTTEIA

    >gi|56695246|ref|YP_165594.1| thiol:disulfide interchange protein, putative [Ruegeria pomeroyi DSS-3]
    MKKLLLALVYTAAALGANPSLGLAADRAQIEALRDGDMKKLIVLPETRAVSQVPFQLADGAGEATLGDYKGKVVLLNFWA
    TW
    CAPCRKEMPQLSALQSELGGESFEVLTIATGRNSPAGIEKFFGEIGVDNLPRHQDPRQALAREMAVIGLPITVLIGAD
    GMEVARLIGDADWNSDSAKAIIQAVIE

    >gi|56695257|ref|YP_165603.1| 2-oxoglutarate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Ruegeria pomeroyi DSS-3]
    MATYDVIIIGAGPGGYVCAIRCAQLGLKTAVVEGRETLGGTCLNVGCIPSKALLHASHSLHEAQHNFAKMGLKGKSPSVD
    WKQMLAYKDEVIEGNTKGIEFLFKKNKIDWIKGWASIPAAGKVQVGDDTHEAKNIIIASGSEPASLPGVEVDEKTVVTST
    GALELGKIPKSLVVIGAGVIGLELGSVYARLGAEVTVVEFLDVITPGMDGEVQKTFQRILKKQGLTFVMGAAVQKTEIAR
    GKAKVTYKLLKKDTEHEIEADTVLVATGRKPYTAGLGLDKLGIEMTQRGQIKVGKDWQTNVPGIYAIGDVIEGPMLAHKA
    EDEGMAAAEQVAGKHGHVNYGVIPGVIYTTPEVANVGATEESLKAEGRAYKVGKFMFMGNGRAKANFASDGFVKILADKE
    TDRILGAHIIGPAAGELIHEVCVAMEFGASAEDLALTCHAHPTYSEAVREAALACGDGPIHS

    >gi|56695325|ref|YP_165673.1| molybdopterin biosynthesis protein MoeB, putative [Ruegeria pomeroyi DSS-3]
    MLLVLALAAGLWTMGHVMGVSRRARLVMLCALFAVVLMLQFALPVSHPLRAATGGSPALWLLIGGFALLAFGYGSGVAWL
    KARAQGRPAETTAKPGSFTETELDRYARHIVLRELGGPGQKRLKQARVLVIGAGGLGAPALQYLAAAGVGTIGVIDDDVV
    ENANLQRQVIHRDADIGKPKVFSAEAAMLAQNPAIAVRPYHRRLTEEIAADLFADYDLILDGTDNFTTRYLANQVAVAQG
    KPLISGALSQWEGQLSVFHPAGDTPCYQCIFPEAPAPGLAPS
    CAEAGVIGPLPGVVGAMMAVEAIKLITDAGAPLKGEML
    IYDALYGESRKIRLSRRADCPICGQG

    >gi|56695357|ref|YP_165705.1| thioredoxin [Ruegeria pomeroyi DSS-3]
    MGDKTLTCLACGQLNRVPEARLTAGAKCGKCGDGLLTGQARDVDPAILEKAKKNDDLPLVVDFWAPWCGPCRMMGPEYAK
    AAGVLAGQARLVKLDTQKHQSTGGRYGIRGIPTMVAFERGKEKKRQSGAMQSGQIVGWVRG

    >gi|56695454|ref|YP_165802.1| mercuric reductase, putative [Ruegeria pomeroyi DSS-3]
    MERIETDLLVIGAGSGGLSVAAGASQMGARVVLLEGHEMGGDCLNYGCVPSKALIASAKAAHARMTDAGLGVAGQEPQVD
    FAAVKDHVAAVIAQIAPVDSQDRFEGLGVRVIREYGQFVSRTEVQAGAHLIAARRIVIATGSTPLIPPIPGLDSVPYLTN
    EILFDLRQRPDHLLIIGGGPIGLEMAQAHVRLGCKVTVIEAARALNREDPEAAALVLTRLRAEGVEIAEDTAAAQIRGRA
    GAIEVVSAEGRIFAGSHLLVAVGRKASTDRLNLDAAGVETTRTGIRVDASLRTSNRRVYAIGDVAGGLQFTHVAGYQAGV
    ILRSALFGLPSKARTDHIPRATYTDPELAQIGLTEAEARDRHGDRVEVARFDYLHNDRAIAEGRTEGFIKVMVVRGRPVG
    VTIVGHQAGEHANLWSLALANNLKMSQVAAMVSPYPTIGEISKRAAGAYFSPRLFENQSVKRVVGLVQRWLP

    >gi|56695546|ref|YP_165895.1| alkylhydroperoxidase-like protein [Ruegeria pomeroyi DSS-3]
    MSWNDKLAATRAGLRNLHGAIPDTARAFGALGKTVKEGGTLDFKTKEFVALGISIASRCEPCISLHVEALVKAGASRAEL
    SDVLAMSIQMGGGPSMMYAAKALECFDDLTG

    >gi|56695662|ref|YP_166013.1| alkylhydroperoxidase-like protein [Ruegeria pomeroyi DSS-3]
    MATVPLLSDEEASAQALAVFDDIRATRGTDYVNNFWRALAHDPALLQATWERLKVVMGPGTLDPLVKELIYVAVSTANGC
    AY
    CVHSHTAAARAKGMTQAQYGELLAVIGMAMQTNGMVTGMQVPVDEAFKA

    >gi|56695696|ref|YP_166047.1| copper-translocating P-type ATPase [Ruegeria pomeroyi DSS-3]
    MSAQTTSLKITGMSCAGCVGRVERALLAVPGVAEASVNFATKTAQVHHDSPVAALTQAAAGAGYPAEVSETTLTVEGLSC
    ASCVGRVERALNAAPGVVEAQVNLATRTARVSYVTGSTDPAALAAVSTAAGYAARPEGGAEDGGEEPSDEAAILKRQTLL
    AILLALPVFLIEMGGHMIPALHHWIMATIGQQTSYLIQFALTTVLLFGPGRVFYAKGFPALLRGAPDMNALVALGTGAAY
    GFSLVATFAPGLLPAGTANVYYEAAAVIVALILLGRWLEARARGRTGAAIEALVGLQPRHARIERNGQPVEVEIADIQPG
    DTLLIRPGDRIPADARVLDGQSHVDESMITGEPVPVTKSAGDTLVGGTVNGAGALRARAEKVGADTVLAQIIRMVEQAQG
    AKLPIQSVVDRITLWFVPIVMGVAALTVLVWLAFGPSPALGHALVAGVAVLIIACPCAMGLATPTSIMVGTGRAAELGVL
    FRKGDALQRLQEARVIAFDKTGTLTLGRPELTDLTTADGFERDSVLRLAAAVEAQSEHPIAEAITRAAEGDLLAAEAFES
    LTGLGARARVAGQDVLIGADRLFDREGIALGPLRETGAALAAEGKTPLYAAIDGRAAAVLAVSDPVKPGTAEAIERFHRM
    GLSVAMITGDNTRTAQALAAKLGIDAVTAEVMPEGKVAALDALRADHGALAFVGDGINDAPALAHADTGIAVGTGTDVAI
    EAADVVLMSGDLRGVANALEVSRATMRNIRQNLGWAFGYNVLLIPVAAGVLYPFGGPMLSPVLAAGAMALSSVFVVTNAL
    RLRRVRAALPATRQAAAPAPAAAPAPAE

    >gi|56695805|ref|YP_166156.1| thioredoxin-disulfide reductase [Ruegeria pomeroyi DSS-3]
    MAETRHTKVLIIGSGPAGYTAGVYASRAMLEPILVQGIEPGGQLTTTTEVENWPGDTEVQGPDLMVRMEAHAKAMGCEII
    GDIITSLDTSARPFVAKGDSGTTYTADAVILATGARAKWLGMESEEKFKGFGVSA
    CATCDGFFYRGQEIVVIGGGNTAVE
    EALFLTNFASKVTLIHRRDELRAEKILQDRLFKNEKIVPLWFNQLEEVYGTDAPLGVEGVKVRNVKTGEITDIPCKGVFV
    AIGHAPANELVKDVLELHNGGYVSVKPGTTETSIPGIFAAGDLTDHKYRQAVTSAGMGCMAALDAERFLAEQE

    >gi|56695889|ref|YP_166240.1| YeeE/YedE family protein [Ruegeria pomeroyi DSS-3]
    MLVWLSDSQAVALVGLVGGIALGLAARLGRFCTLGAIEDLLYGGSDVRMRMWVLAIGAAMAGSFGLMGLGWLDPGQSYYL
    SIRWMPLASILGGLMFGYGMALAGN
    CGYGSIARLGGGDLRAFVIVLVMGVFTYVTLAGPLAPLRNLLFPQIEVAGDLPPG
    LAHHAHALTGLPVHVIGIGIGLILCLGALSSRDMRQEPKSIFWSLVVAAAIVGGWAGSYWVYQHGFDGLQVVSHSFSAPV
    GESILYAMTGSVRPLSFAVGSVAGVWAGAFIGSLIKGHFRWEACEDPRELRRQILGAAIMGTGAVIAMGCTVGQGLTAFS
    LLAISAPVTFLAIFAGAALGLRQLIEGFSAAE

    >gi|56695893|ref|YP_166244.1| thioredoxin SoxW [Ruegeria pomeroyi DSS-3]
    MRRFLAILGLLALTSGAQAELGDDGLHKTAWMRDTFKDLREDLDEANAEGKRLVLFFEQRGCVYCAKMHKEVFPRPEVSS
    YIEENYFVVQLNLHGDIEVTDFDGEALSEKDMARKWGILFTPTILFLPEEVAEDQSAQQAAVAMMPGAFGAGTTLDMFTW
    VAEKRYALDNGEDFQRYHARRIQERSNGSTD

    >gi|56696144|ref|YP_166500.1| alkylhydroperoxidase [Ruegeria pomeroyi DSS-3]
    MSLGAIRVHVRPVQMGQRGQSGMSWIRTVPFEEATGKLRKLYDRVTGPGGNVDNIMMVHSLRPHSMEGHMALYKNVLHHT
    GNAIPKWFLEVLGVWVSALNGCAY
    CVEHHFAGLTRLLGDRARSDAIRAAIEAGAPEQAPLEARERAAMAYVRKLTETPAD
    MVEADVTALRAAGWEDGEILEINQVCAYFAYANRTVLGLGCSTAGDVLGLSPGNSEDPDDWGHR

    >gi|56696165|ref|YP_166521.1| ArsC family protein [Ruegeria pomeroyi DSS-3]
    MLIYGLKNCDTCRKALKSLPDARLVDVRADGVDPAVLSRAWAQFGADLLNTRSTTWRGLDAAERAGAPLELIAQYPALMK
    RPLIEAGGEFYLGWTPATRQALGLG

    >gi|56696214|ref|YP_166571.1| glutathione-disulfide reductase [Ruegeria pomeroyi DSS-3]
    MSFDYDLFVIGGGSGGVRAARVAAGETGAKVALAEEDRYGGTCVIRGCVPKKLMVFASEYSGMVEDAQAYGWNIQPGAFD
    WDVFRSKLYTELDRLEGVYRNILKNNGVETFDMRARLVDAHTVELSDGTRKSAKHILIATGGRPVKPEIKGAELAITSNE
    IFHLDKLPERMLIVGGGYIACEFVGIMNGMGVEVTQYYRGAQILRGFDDEARGLVSEEMCQNGIKLHLGTNVLEMEREGD
    RIRVKATNGDEELFDQVMFATGRVPNADHLGLEGLGVELGRKGQIVVDDYSQTAVPSIYAIGDVTDRVNLTPVAIREGMA
    FVDTVFRGKPTPVDHALIPTAIFTQPEMGTVGLSEEEAAAQEPVEIYATSFKPMQTAFAGRSQRVLMKLIVSKATRKVLG
    CHIVAPGAGEMIQLVGIAVKMGATKEDFDRTVAVHPVMAEELVTLRQPVRSA

    >gi|56696275|ref|YP_166632.1| thioredoxin domain-containing protein [Ruegeria pomeroyi DSS-3]
    MTAHPPRPELQIDIVSDVVCPWCIVGFRQLDQALAATGVLARLRWHPFELNPQMGPEGQNLREHIMEKYGSTPEQSAEAR
    ARLTAIGAELGFTFNFTDDSRIVNTFAAHQLLDWAEGQGRQHPLKQALFAAYFTDGRDVSDLSVLLDAVEAAGLDREAAQ
    TALTSGAHQAPVREKQKFWAQHGISGVPSMVFGGKYLLTGAQGADTYAQVIQRCLAEAA

    >gi|56696276|ref|YP_166633.1| alkylhydroperoxidase-like protein [Ruegeria pomeroyi DSS-3]
    MKGHATMRFNFTKETPQVYDAMLALNTAISQANPDSRLVHLTKIRASQINGCAYCVNMHVKEAQQDGLPDMLLHLIAVWR
    ETSAFTARDRAALAWAETLTRLEDSEVSQADFDAARAEFSEQEVAALTASIAMINLWNRMAISAHLPV

    >gi|56696316|ref|YP_166673.1| rhodanese domain-containing protein [Ruegeria pomeroyi DSS-3]
    MAQKITKGIKTLLAEANAQVATLPVAEAKALYDDPDHVFVDLRDIREVQRSGMIPGAFSCPRGMLEFWIDPDSPYHKPVF
    DQDKTYVFY
    CASAWRSALAAQAAQEMGLTPVMHLEGGFSAWVKQDGPVAEKT

    >gi|56696744|ref|YP_167105.1| glutaredoxin-related protein [Ruegeria pomeroyi DSS-3]
    MTDAKTRIDETVKANDVVLYMKGTKEMPQCGFSSRVAGVLNYMGVAYADVNVLADDEIRQGIKDYSDWPTIPQLYVKGEF
    VGGCDIITEMTLSGELDTLFEENGVAYDKDAADKIRAANA

    >gi|56696927|ref|YP_167289.1| glutathione S-transferase family protein [Ruegeria pomeroyi DSS-3]
    MIRFRQHDPGAKTLSGKFIIHHIPVCPFSQRIEILLALRSLSDAVEFRVVDITRPRDPELLAKTRGTTALPVLETPDGRI
    IKESLVILRYLDEVLPGAPLRRIDPAEHAIESMLIAKEGAFVTAGYLYVMNQDRSQREAHLDRLLGLYRGLDDFLVEHNP
    KGTWLFDGFGLAEAVYTPLFKRFWFLDYYEDFALPDDPAYDRVRVWRAACIAHPATDQVSEEEIVKLYYDYALGAGNGAL
    VDGRTVSSFAFEPDWRSRPWPPRDKYDGTASDAALGLLSV

    >gi|56696938|ref|YP_167300.1| DSBA-like thioredoxin family protein [Ruegeria pomeroyi DSS-3]
    MTQTVKLDILSDPICPWCYIGKTQLDKALAAIPDHPFVIEWHPFQLNPDMAPEGMDRREYLERKFGGKEGAVRAYAPVVE
    HAEKAGLAIDFEAMQRTPNTLDAHRLIHWAGVEGKQTEAVDALFAAYFTEGRDIGDAEVLADIADSIGMDAAVVLKLLKS
    DADRDDIAKRDSHSREMGVSSVPTFIVANQHAVPGAQPPELWEQVIREIMSQIETTSA

    >gi|56696971|ref|YP_167333.1| anti-oxidant AhpCTSA family protein [Ruegeria pomeroyi DSS-3]
    MKTGASLPNVIFHTRVRDEAVGGPNPYRWQDMTTAAYFAGKRVVLFSLPGAFTPTCSTYQLPGFENGFADFQNQGIDAIY
    CMSVNDSFVMNKWAEAQGLKNVTVIPDGSGEFTRKMGMLVDKDNLGFGFRSWRYAAIVNDGKIEAWFEEPGLMDNCPEDP
    YGVTSPETVLNWLVAANSEVAA

    >gi|56697067|ref|YP_167430.1| hypothetical protein SPO2204 [Ruegeria pomeroyi DSS-3]
    MCSSLAAYNHRSSPMKRFVLAFCAALMLTGLALVAPEPSQAGEDKPGLFITLTTDDTWAAGKAIMFAHQRALKSGYDTAI
    WLNVRAVYLADKKRPSHIHGLMAGQGATIQDMLSAFIADGGTVLM
    CGACSKAAGLTQADYIDGVTMGSWPVVESWLFRDN
    MRTLAW

    >gi|56697082|ref|YP_167445.1| rhodanese-like domain-containing protein [Ruegeria pomeroyi DSS-3]
    MFFFRKPSLPGLSITEAVDAAARGDLLVIDVREAGELAATGKAAGALHVPLMQLSARADRNHPEFEPLLEGASRIAVYCA
    SGGRSARARKLLLGLGYPEVHNLGGLGHWARAGGRIERA

    >gi|56697085|ref|YP_167448.1| dihydrolipoamide dehydrogenase [Ruegeria pomeroyi DSS-3]
    MAAQSYDVIVIGAGPGGYVAAIRAAQLGLKACVVEREHLGGICLNWGCIPTKALLRSSEVFHLMERAKEFGLKADNIGYD
    LDAVVKRSRGVAKQLSGGIGHLMKKNKIDVVMGEATIPAKGKVSVKTDKGTQELTAKNIILATGARARELPGLEADGDLV
    WTYKHALQPVRMPKKLLVIGSGAIGIEFASFYNTLGADTTVVEVMDRVLPVEDAEISAFAKKSFVKQGMKIMEKSMVKQL
    DRAKGKVTAHIETGGKVEKLEFDTVISAVGIVGNVENLGLEALGVKIDRTHVVTDAYCRTGVEGLYAIGDIAGAPWLAHK
    ASHEGVMVAELIAGKHAHPVKPESIAGCTYCHPQVASVGYTEAKAKELGYDIKVGRFPFIGNGKAIALGEVEGMIKTIFD
    AKTGELLGAHMVGAEVTEMIQGYVVGRQLETTEEDLMHTVFPHPTLSEMMHESVLDAYGRVIHM

    >gi|56697091|ref|YP_167454.1| AhpC/TSA family protein [Ruegeria pomeroyi DSS-3]
    MPDVTDIAPEFTLPRDGGGEISLSDLRGRAVVLFFYPRDDTPGCTKESIGFSVNLQAFADAGAQVLGISRDTVAKHDKFV
    AKHGLTTPLLSDAESDVCERYGVWVEKNMYGKKSMGIERTTFLIDGEGRIAQVWRKVKVDGHVDAVLDAVRAL

    >gi|56697108|ref|YP_167471.1| hypothetical protein SPO2245 [Ruegeria pomeroyi DSS-3]
    MSQSSECARPHRRGFDFCASAVFLCTQRAQSVGGCAMRGCPLLLWRPETCQNPAPFCRGFAAQGFTAVSVVSRAVTKTTF
    FDENLIERVLWQFTMKEQRANAIPATCRYARYSANPTPTPRPVKINESDRTMNFEEKIATHYGHGNLTAAIRSGLQAQGI
    TPEQASVEDLGPVDEFHIGGRAATVHFFDQIDLSETSKALDIGCGLGGAARYAAHSFGSQIEGIDLTPEYVETGGALCQW
    VGLSDKVNLSVASALSMPFESGDFDIAYMMHVGMNIEDKRALFKEVARVLKPGGTFAIYDIMRSNDEDLVYPVPWASSAE
    TC
    CLAGPATYRAALEEGGFVVRQENDRRDFAIDFFEKMKKANAGQKSPPPLGLHVLMQQTTAEKIPNMIANLQAGRIKPV
    EIYAVKQ

    >gi|56697160|ref|YP_167524.1| osmC-like family protein [Ruegeria pomeroyi DSS-3]
    MPTERITFAGHDGSQLAARLDLPQGPVLATALFAHCFTCSKDIPAARRIAARLAAMGIAVLRFDFTGLGHSEGEFANTTF
    TSNVGDLAAAARYLAGRDMAPALLIGHSLGGAAVLRARAQIASVRAVVTIGAPADPGHVAHHFETALPRIQAEGAAEVCL
    GGRPFRIGRDFVEDIAASALQPAIADLRAALLVLHAPRDETVSIDNASQIFMAAKHPKSFVTLDDADHLISRARDAEYAA
    EVIAAWAGRYVDLAPPAPPPGAPEGIVRVSEADPAGFLQDVQAGPDHHALADEPLSYGGTDRGMSPYGFVSAGLGA
    CTSM
    TIRMYARRKGWPLEGVSVDICHDKVHAQDADTGASGKIDAFTRVIRLIGPLDGAQRQRLLEIADKCPVHRTLEASSHIVT
    RLDEAG

    >gi|56697173|ref|YP_167537.1| DsbE subfamily periplasmic protein thiol:disulfide oxidoreductase [Ruegeria pomeroyi DSS-3]
    MARISPLMVAPPLIFGAFVLLAAVGMFRDDPDALPSAREGQAAPPLVLTAFPGAPGFDDATLRDGKVKLVNYWASWCAPC
    RAEHPSLEKLAGEGIPVYGINYKDKVENAQAFLDELGNPYAALGRDEQGRTALDWGLYGVPETYVIAGDGTIMLRFAGPI
    TARVIDSTIRPALEKAAAK

    >gi|56697353|ref|YP_167721.1| Iron-sulfur cluster assembly family protein [Ruegeria pomeroyi DSS-3]
    MRLPPKVTDRAFARLAEIGAADQGQALRVAVEGGGCSGFQYEIALDAPKSDDLVLEGQGQRVVVDAVSLPFLENAVIDFS
    EELIGARFVIDNPNATASCGCGTSFSI

    >gi|56697436|ref|YP_167804.1| 27 kDa outer membrane protein, putative [Ruegeria pomeroyi DSS-3]
    MMLRHIAPAVTALSLLSAPVQALDLSDMTPDQRAAFGEQVRAYLLENPEVIIEAVNLLEQRKAQEEAQQDLELVQVNAEE
    LFNDGYSWVGGNPDGDITLVEFMDYR
    CGYCRRAVPEVDELLKTDGNIRLIIKEFPILGEASLASSRFAVATLIVAGPDAY
    KQVHDALLDFTGEADEVALGRIGEGLGLDTDAILAEMESEEVTRRLAETRALAQRLNISGTPSFVMETEMLRGFLPADQM
    RQIVDALRAERS

    >gi|56697462|ref|YP_167830.1| iron-sulfur cluster assembly accessory protein [Ruegeria pomeroyi DSS-3]
    MEIFMFGIPGKQAVTMTPRAATQIARLMDKGGHTGLRIGVKKGGCAGMEYTMDYVDQADPHDEVVEQDGARILIAPMAQM
    FLFGTEIDYEVSLLESGFKFKNPNVVDACGCGESIKFDESLASR

    >gi|56697484|ref|YP_167852.1| YeeE/YedE family protein [Ruegeria pomeroyi DSS-3]
    MQNVTLQEGRPMTLNWKIGGLLLGLVFFAAVLLVKPIGVSTQFVILDGILADAVMTDLVTKTEEGYTSTNAYLAKSGGKY
    AKSVANPLNYSFVFVLAMMLGGFLSLMARGGLDRAERAIPALWRANFGDSAVKRYAVAFLGGFIVLYGARLAGG
    CTSGHM
    MSGMMQTALSGYIFAAGAFAAAIPVSILMFRKEV

    >gi|56697532|ref|YP_167900.1| hypothetical protein SPO2690 [Ruegeria pomeroyi DSS-3]
    MNHEAVQNYYGEVLQSSADLQTNACCTPDAVPAHLKPVLGKLHDEVMARYYGCGLIAPLALEGARILDLGCGAGRDVYAL
    SALVGESGAVVGVDMTPAQLEVAQAHRAYHAEVFGHAAPNTEFHQGYIEKLDDLPLKPGSFDIIVSNCVLNLATDKAAVL
    RGAQRLLKPGGEMYFSDVYADRRIPEALARDEVLYGE
    CLSGALYWNDFLSLARGAGFGDPRMVESRLLTIENPELERRVG
    PIRFLSATYRLFNLAGLEPDCEDYGQAVIYKGTVPHAPHEFVLDDHHVIETGKVFPV
    CGNSWRMLAESRFAPHFQFIGDF
    STHYGIFAGCGGASPFNGLSPVAPAASGGCC

    >gi|56697730|ref|YP_168100.1| hypothetical protein SPO2892 [Ruegeria pomeroyi DSS-3]
    MSGTAILTHPMGRRAVLALGGAVLAGLAVREYLLTPEDFAGGDLSVEAAHEQANAGAVLLVDIRRPDEWASTGVGAGAQP
    LDMRRADFVAALDQLAGGDRARPIALI
    CARGVRSARLANQLAQAGFTSIIDVPEGMLGSRAGPGWLRAGLPVVAHAEAQE


    >gi|56697737|ref|YP_168107.1| selenide,water dikinase, putative [Ruegeria pomeroyi DSS-3]
    MHTPPLPRTRDLVLIGGGHTHALVLRKWGMMPLAGTRVTVINPGPTAPYSGMLPGFVAGHYDRAALDIDLVQLARFAGAR
    VVLGAVQGIDLDQREIHVPGRPPISFDVASVNVGITSAMPEMEGFADHAIPAKPLGPFAARWAAYLAGAGPARVAVIGGG
    VAGAELVMAMAHALRSRGRAGQVTLIDRARVLAGLGPGAAARVRQAMVGLGVTLVEGVEIARISAEAVELGDGRQIEADF
    ITGAAGARAYPWLAETGLDTHEGFIAVDACLRSSDPMVFAAGDCAHLTDTPRPKAGVYAVREAPVLYDNLRAALGAGHPR
    PYRPQSDYLKLISLGGKSALAEKWGRVFAGPAMWRWKDRIDRTFMDRFRDLPQMGQPALPELHSAGLNEALGDKPLCGG
    C
    GAKVGRAALRAALAPLPGMVRNDVTPLPGDDAALLTTGGVRQVMTSDHLRALAEDPVLMTRIAAHHALGDIWAMGAAPQA
    ATATVILPRLSPELQQRSLAEIMAAATEVMRAAGAEIVGGHSSVGDELTIGFTLTGLCTQAPITLGGGQPGDVLILTKPL
    GSGVLMAAEMAGRAPGADVAAAYALMTMDQGPAARILGAAHAMTDVTGFGLAGHLHGLCEASGTGAELDLAAVPLMAGAL
    ALSEAGHRSSIFADNRALVPGLPATGAAALLFDPQTAGGLLAAVAPDQADVCLADLVKAGYPAARIGELTQTPGLRLAR

    >gi|56697746|ref|YP_168116.1| arsenate reductase [Ruegeria pomeroyi DSS-3]
    MIEYWHNPRCSKSRQGLALLEERGAEIELRRYLEDAPSLEELRATQAALGVSAIAMMRTGEARFKELGLSKSDPDAVLLA
    AMAESPVLIERPLAIKGDRAVIGRPPEDMLSLLD

    >gi|56697783|ref|YP_168153.1| rhodanese-like domain-containing protein [Ruegeria pomeroyi DSS-3]
    MVLTVKDMMAAANAVVPRIDGARAQQLVAEGALLLDLRDAPELERAGRASGAHHIPRGMLEFRADPDTPFHDPELRKDRV
    IVLH
    CASGGRAALAGKLLKDMGYGEVYNLGGFADWTGERIEPVDPGM

    >gi|56697955|ref|YP_168326.1| YeeE/YedE family protein [Ruegeria pomeroyi DSS-3]
    MDLVSLVERIGEAPTAALFGLITGITFGVAAQRSRFCLRAATVEFARGRMEDKVAVWLLTFSTALVWVQAAQLMGLMNGA
    DARMMAVPGSWSGAIIGGLMFGAGMVLARG
    CSGRLLVLAATGNLRSVVSGLIFAVVAQMSLSGLLSPLRDKLAALWITEG
    GRNMNLLSTFGLPEYGGLVLGLVCAVLALVLARRHRIGAARLVFASGVGFAVALGWVLTYALSQVAFEPVQIESATFTGP
    SAHTLMFFLDRNAVLEFDVGLVPGVFIGAMIAAALAGEMKIQAFDGPVTMRKAMIGAALMGFGGMLAGGCAIGAGVTGGS
    IFVGTAWAALFFMWVGAMATDFLIDQRAASPRAA

    >gi|56697966|ref|YP_168337.1| methylated-DNA--protein-cysteine methyltransferase [Ruegeria pomeroyi DSS-3]
    MPSLTVDTPTGAFVLTEEEGAITRATWGRGGSDHTPLLDRAAEQLTEYFRGEREVFDLPLRVRGSVLQRAVCDAIAAIPF
    GYTRTYGEIARDLGSSAQAVGQCCGGNPIPVIIP
    CHRVMGARGLTGFSGQGGVETKVALLRLEGAAGLLI

    >gi|56698093|ref|YP_168464.1| glutathione S-transferase family protein [Ruegeria pomeroyi DSS-3]
    MTLHLMSHALCPYVQRAAISMLEKGVSFERTDIDLAKKPEWFLAISPLGKTPVLLDNQQAIFESTAILEYLEDTQSPPLH
    SKAAITRAQHRGWIEFGSSILNDIAGLYNAQTEDAFDQKTAALEAKFAQLERQLGEGAFFAGNAFTLVDTVFAPIFRYFD
    TFDEIADFGILLGKEKVAAWRKELAARPSVKQAVSANYPSLLRVFLLNRNSHLSQLMKRQLS

    >gi|56698135|ref|YP_168507.1| ADA regulatory protein, putative [Ruegeria pomeroyi DSS-3]
    MTDLFLPDDDTLYAALLARDPAWDGRAYVGVSSTGIFCRLTCPARKPKRENCHFLPTVAACLAAGYRACLRCRPLRPEGD
    GDPVVTRLLAALEADPARRWTEGGLTAMGLDPSTVRRSFKRQFGQTFLDMARQARLQAGLTTLAQGGRVIDAQIEAGYDS
    PAAFRAAFARHLGLPPGSFRANARLRADWFDTVLGPMIAVSDRTHLHLLEFADRKALPTELKRLHASCKGDMGFGRLPPI
    DEAEAQLTAFLAGRRARFDLDLALHGTPFTCRVWQALQELPAGSTVSYSELARRLGRPEAVRAVARANGANQIAIVIP
    CH
    RVLGADGALTGYGGGLWRKQRLIELERAYAQTERTPA

    >gi|56698207|ref|YP_168579.1| thiol-specific antioxidant protein [Ruegeria pomeroyi DSS-3]
    MGLRINDIVPNFEADTDKGRIAFHDWIGDSWAILFSHPKDFTPVCTTEFGAVAQLADEWAKRNTKVIGVSVDGVEDHKKW
    KGDIESFAGTSAGFPIIADEGLAVSKAFDMLPADAYLPDGRTPADSATVRSVFIISPDKKLQLSMTYPMSVGRNFAEVLR
    ALDGLQRTYQQPLATPANWQTGQDVIVALALDNAAAEEKYGALDIKLPYLRFAKNPG

    >gi|56698246|ref|YP_168619.1| thioredoxin [Ruegeria pomeroyi DSS-3]
    MLELGQKAAPAADLIKDTNEATFMADVVEASQTVPVIVDFWAPWCGPCKTLGPALEAAVTAAKGAVKMVKVNVDENQMIA
    GQMRIQSIPTVYAFYQGQPVDGFQGALPASEISAFVDRVIAAAGGEAPGAQLEEAVVAAEEMLEQGAAADAAETFAAILG
    EDPNHAAAYGGLVRAHIALGDLDQAEAILNGAPAEISTKPELEAAHAQLELARQASNAGPVAELAAAVEADPDNHQARFD
    LAQALHAAGQTEQAVAELLDLFRRDREWNEGAAKAQLFTIFDALKPNDPIVLNGRRKLSSMIFA

    >gi|56698269|ref|YP_168642.1| DsbA family thiol:disulfide interchange protein [Ruegeria pomeroyi DSS-3]
    MNRLGTLVFAGVAIAAGAYWLTLPSQGNLPANPLVGSAEAQQAEIDTSSIVEMVQGAEDAPVEVIEYASYTCPHCAAFHE
    GPYKKLKADFIDTGKVRFIYREVYFDRYGLWASMVARCAGPEKFFGISDLIYKGQAEWSRAGGPAEIAEELRKIGRLAGI
    ENDKLEACLGDATKAQTLVAWYQEHATRDDINSTPSFMINGKKVENQAYDGFKALIEAELGN

    >gi|56698342|ref|YP_168715.1| copper-translocating P-type ATPase [Ruegeria pomeroyi DSS-3]
    MTAQLRPSPAACPACVAVPAQPARPVPEDVQIALSLPGIHCSACISTVERALQAHPGVEDARVNLTLKRALIKAAPELRA
    ADLIPVLERAGYEAHELDPGTLNATRTDRAGRDLLMRLAVAGFASMNVMLLSVSVWSGASDATRDMFHWISAAIAMPAIA
    FSGQPFFVRAWGALKARRLNMDVPIVLAIVLALVTSLWETSLSGEHAYFDAALTLTFFLLAGRYLDYRTRAVARSAAEEL
    AALEVPRAIRLQDGVETEVAVAQLAVGDLILVRPGGRMPVDGEIVEGRSELDRSLLTGETLPVFAEPGLVVSAGEVNLTG
    PLVIRANAVGQDTSLHRMADLVAIAESGRSRYTSLADSAAKLYAPGVHILSALSFVGWYLYSWDVRTALNIAAAVLIITC
    PCALGLAVPAVTTAASGRLFKRGMLIKHATALERLAEVDTVVFDKTGTLTAGTPELTNLGDHRRADMEIALALAEASSHP
    LSVAITRAARAAGLHPARIDDVTEVPGFGTEGAWQGQRVRLGRAAWVGAEQAAQTSAWLAVGDRAPVAFLFSDALRPGAE
    ETVAGLKAAGKEVLLISGDTTGAVESLARRLGIESWMAEALPQDKADRVQALADAGKRVLMVGDGLNDTAALAAAHVSIS
    PASALDAARVASDIVLLGNDLSPIAGACDTAIRATKRIRENFRIATVYNVIAVPLAVAGLCSPLIAALAMSTSSITVSLN
    ALRLR

    >gi|56698400|ref|YP_168773.1| ADA regulatory protein [Ruegeria pomeroyi DSS-3]
    MNVQTTEEGYHYGVIRRAIELIDAGGESMPLDDLAARMNMSPAHFQRIFSRWVGVSPKKYQQYLTLGHAKALLEERFTLL
    EAAQNVGLSGTGRLHDLFVRWEAMSPGDYARKGADLTIYWGWFESPFGPALVMGTERGICGIGFAAEAGAEATMEDLLSR
    WPQATFVEDPMRLRPWVLSAFGAASDRLEPVPLYLIGAPLQIKVWEALLRIPSGQVTTYGELAQSIGQPRAVRAVGTAVG
    RNPVSWLIP
    CHRALRKSGGLGGYHWGLPVKRAMLAWEAARSEA

    >gi|56698537|ref|YP_168913.1| thiosulfate sulfurtransferase, putative [Ruegeria pomeroyi DSS-3]
    MQDDPKTLVSTDWLAAHLKDPDLRILDGSWHLPHLGRDPKAEYEAAHIPGARFFDIDDISDHRSDLPHMVPPVEKFMSRL
    RAMGVGDGHQVVVYDSLGLQSAARVWWLFKLMGQDNIAVLDGGLPKWQAEGHPIEDLPPVIRDRHMTVRVQNHLLRDVTQ
    VSAAAKLHDHEIVDARSAGRFAGTDPEPRPGLRGGHIPGSKNVPFGTLLNKNGTMKSPADCRAVFEAAGVDLKKPVITT
    C
    GSGVTAAILSLALQRMGKTDHSLYDGSWAEWGAFPTLPVATGEN

    >gi|56698554|ref|YP_168930.1| anti-oxidant AhpCTSA family protein [Ruegeria pomeroyi DSS-3]
    MISVGDTLPDATFMVFSDKGPETVDLEPKLKGRKVVMFGLPGAFTRGCSMTHLPSFIRTRQALADKGVDEVICVSVNDPF
    VMTAWGQQSGAAEAGITMLADPTAEFTKAIGLAFSAPVVGLYDRCQRFALMAEDGVVKVLNLETEAGACKLTVGEELLEQ
    I

    >gi|56698558|ref|YP_168934.1| methionine sulfoxide reductase A [Ruegeria pomeroyi DSS-3]
    MSLERAVLAGGCFWGMQDLIRKMPGVDRTRVGYTGGDVPNATYRNHGSHAEGIEIWFDPTRISFRQLLEFFFQIHDPTTV
    NRQGNDLGTSYRSAIYYVDEAQKAVALDTIADVDASGLWPGRVVTEVEPVGDFWEAEENHQDYLEKHPNGYTCHFARADW
    VLPKRADAAE

    >gi|56698559|ref|YP_168935.1| methionine sulfoxide reductase B [Ruegeria pomeroyi DSS-3]
    MTRYTKSPEAIAALSPEEFHVTQRSGTERPGTGKLLHNKEPGIYVDIVSGEPLFASSDKYESGCGWPSFTKPIETTHVLE
    LEDRTHGMIRTEVRSKHGDSHLGHVFPDGPRDRGGLRY
    CINSASLRFVHRDDMTAEGYADYLDQVEDIA

    >gi|56698560|ref|YP_168936.1| glutathione peroxidase famly protein [Ruegeria pomeroyi DSS-3]
    MVRIIFLIVLLLVGRSVQAGAVSGSFPSIDGGTLSLEEWRGQPVLVVNTASQCGFTGQYAGLQALWERYQSAGLVVLAVP
    SDDFNQELATAAEVKEFCALNYALTLPMTNILHVKGADAHPFYKAVKAETGFEPAWNFNKVLVAPDGSIAATFGSAVKPD
    SARMQREIEALLN

    >gi|56698575|ref|YP_168952.1| alkylhydroperoxidase [Ruegeria pomeroyi DSS-3]
    MTDQTRPTALDLPMVDPLPQETQKYFDICVEKLGMVPNVLKANAFDIAKLNAFTAMYNDLMLAPSGLSKLEREMIAVVVS
    SINKCFY
    CLVAHGAAVRQLSGDPKLGEMLVMNYRVAPLDARQRAMLDFAAKMTTASAEIEESHRQALRDVGFSDRDIWDI
    ANVAGFYNMSNRVASATAMVPNDEYHSQFR

    >gi|56698606|ref|YP_168983.1| alkylhydroperoxidase-like protein [Ruegeria pomeroyi DSS-3]
    MSVQKEKLAQANKRLMGLFKADQKTMMAFKTLSDTAVREAQVSTAMKEMIAVAIAAARGCEDCILYHVNEAKSHGAERGT
    LVEVLAVAIEMSGGPGTVYAAKALDAFDQL

    >gi|56698685|ref|YP_169062.1| thioredoxin [Ruegeria pomeroyi DSS-3]
    MSTVAVTDATFDAEVKNSDIPVVVDFWAEWCGPCKQIGPALEELATEYAGKVKIAKVDVDSNPNAAAAMGVRGIPALFIF
    KDGQVVSNRAGAAPKAALQNWIDSSI

    >gi|56708821|ref|YP_164862.1| Na(+)-translocating NADH-quinone reductase subunit D [Ruegeria pomeroyi DSS-3]
    MSQTKKELLIDPLVDNNPITLQVLGICSALAVTSSLQVAFVMALAVTFVTAFSSFFISILRNQIPSSIRIIVQMVIIASL
    VILVDQILKAYAFEISKTLSVFVGLIITN
    CIVMGRAEAFAMKNPPVASFIDGFGNGLGYGLILMLVGVIRELFGSGSLFG
    VTILQTVNNGGWYVPNGLLLLPPSAFFVIGLLIWAFRTWKPKQIEEREFKIQSVEAH

    >gi|56708822|ref|YP_164863.1| Na(+)-translocating NADH-quinone reductase subunit E [Ruegeria pomeroyi DSS-3]
    MEGLISLAVKAVFVENLALSFFLGMCTFIAVSKKISTALGLGISVMVVQAITVPANNLLLNTLLKPGALAWAGFPDVDLT
    FLGLISYIGVIAAMVQILEMILDKYFPPLYNALGIFLPLITVN
    CAILGGSLFMVERDYNFAEATTYGLSSGFGWALAITA
    MAGVREKLKYSDVPDGLQGLGITFITAGLMAMAFMSFSGVKL

    >gi|56708959|ref|YP_165004.1| hypothetical protein SPOA0173 [Ruegeria pomeroyi DSS-3]
    MKAPELQIQQWFNSATDLTLADLRGKVIVIEAFQMLCPGCVMHGIPLAQKVRAAFPEDKVAVLGLHTVFEHHEAMTPISL
    KAFLHEYRIKFPVGVDQPGDGAMPRTMAAYQMRGTPSLLLIDKAGDLRAHHFGDVSELLLGAEIATLLGEAAPSVQKQAG
    TPQGDANCDNDGCTV

    >gi|56708981|ref|YP_165026.1| thiol:disulfide interchange protein DsbE [Ruegeria pomeroyi DSS-3]
    MTIEVDMPRKKGGLEWKLPLLAALVGLPLLLGIGLTRDPNRIPSALVGKSMPAFEIPYLQRAGMLNSAEHAGKPMLLNFW
    ASW
    CTTCRVEHPKLVELGVRSQLSDEFSILGINYRDDPARAAGFLNREGHFGYPSGYDERGRLGIDFGVYGMPETFFIDA
    DGVVQARHAGPVTDKVLAKYLPLIGVDP

    >gi|56709144|ref|YP_165189.1| 27kDa outer membrane protein [Ruegeria pomeroyi DSS-3]
    MTRAKQIILWASLSAMPLIAQASERSDDEIKALVYQAILERPEIILQAVEQLQQAEEAAQAASAHAALTENRDSLFNDPN
    APVLGNPEGDVTVVEFFDYN
    CPYCRRAMAEVQGLVDADPNVRLVYREWPILGEGSDFAARAALAARQQGKYEAFHWALMG
    MSGKANETGVLRIAREVGLDTEQLQRDMEAPEVTAHIAQSMALAQKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRARK
    AAAK

    >gi|56696406|ref|YP_166763.1| hypothetical protein SPO1522 [Ruegeria pomeroyi DSS-3]
    MRIAAALLAIALTGLSGAVWAETSAAIVARKPDLFHPETGLRIDRQRAPVPEDIPPPARKISALWARKLIARGALALDVY
    GAAQSRYDELDGTWLVPEPRQSLPGAVWLPEVGRGVLDAALQVYLERELERLTGGSKARAIVVFCVAD
    CWMSWNAAQRIA
    GMGYLQVYWFPLGTDGWRELGWPLEPVEPVPVPVD

    >gi|56696056|ref|YP_166410.1| hypothetical protein SPO1160 [Ruegeria pomeroyi DSS-3]
    MLMPRQTTPPLSLPLVGGGRFDLSAETSTRWTLICFYRGLHCPICATYLKELEKRVADFAERGVACVAVSSDSEERAQAM
    AEKVGGGTLRFAYDLPLAEARDWGLYISTSRGKTSIGIEEPALFSEPGLFLVTPERTLYYGAVQTMPFVRPHFSELVAAL
    DFAIPNNYPARGEYTGAV

    >gi|56698211|ref|YP_168583.1| hypothetical protein SPO3387 [Ruegeria pomeroyi DSS-3]
    MQPYEFLPEGFWRKDSPPNARVKRTVDGQIRRDVVVVGGGYTGLSSALALAQQGYSVAVLERGVIGSGASAYNCGHVGIQ
    LGKNPYLTLNKLGLERTRMYADVLTQAIANVGTIVSQSGIDCHYRAIGNLTAGVSEPQRRDVENTFEACDKVGLPVKMLD
    RRDLSQMDAPAFVDSAFHELIGGDIQPALYVQALAKLAEDAGVEIYEDCSVTRVNTSGHVRADTANGAVLADMAVIATNA
    YSGEIGLLRRSIMPWSVSVMVTEPLTPHQRACIGWRNGEPIHTPHQMIENIRLTHDGRILIGTKRARLGWGDRHPPANDP
    VTFQLLFEVLRDRFPEIPDLRPAYTWSGRVAISSDLLPFFDHFEGRKNVVIAAGYGGHGLPMASYSGTIIADMLLGNNTD
    RAALFVNRKRRLPIPPEPLRWVVGHAMKRKMVEADSIIDAAARRELSARRALPRIVRTTYAGD