Rubrobacter xylanophilus DSM 9941 uid58057

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|108802887|ref|YP_642824.1| redoxin [Rubrobacter xylanophilus DSM 9941]
    MARNTPSGGKKRGAGAPQANRPLVLALAGFTALAIVVIALLAVLSARGGDAGNFTPNDQGLLPVGSQAPDFTTKTVTGER
    VSLPEGQAAMLVFFATW
    CPHCQNEAPTIADFSREYEDLRVMMISVADENWPETDTPQEVRRFVSEYGIQGPAIYDPELGR
    TYRVTGTPTVYVVDANGTIVGAHSGEAPREVYEGWIQEALG

    >gi|108802987|ref|YP_642924.1| ATPase, P type cation/copper-transporter [Rubrobacter xylanophilus DSM 9941]
    MGEGARRTSFRVTGMSCAACASRVQKALGRVPGVVEANVNLATERATVEHGPEAGMEELRRAVEKAGYGVALEEDTGEGR
    EREYRGLRRDLLVAGAFTALIVLGSLPHMLGLAPPVPMGVLNLVLLALATPVQFWAGRRFYRGAWSALRHGQANMNTLVA
    LGTSAAYLYSLAATLAPGLFAGRAGVYFDTSAIIITLVLLGRLLEARARGRTSEAIKKLAGMQARTARVVRGGEEADIPV
    EEVAVGDTVVVRPGEKVPVDGVVIAGRSAVDEAMITGESVPAEKGPGDEVIGGTINRTGSFRLRATRVGRDTALARIVRL
    VEEAQGSKAPIQRLADRISGVFVPVVMVVAGLTFLIWWAFGPEPAFTHALLNMVAVLIIACPCAMGLATPTSIMVGTGRG
    AERGILIKGGEALEEAHRTTTVVLDKTGTLTKGEPRLTDVVPAGGLAGEELLRLAAAAESASEHPLGEAVVAGARERGLA
    LPSPEDFEAPTGLGVRATVEGRTVLVGSRSLMRESGVQEDGLAPRAEALSREGKTPILVAVDGEPAGLLAVADTIREEAE
    EAVELLHRMGLEVVMMTGDNRFAAEAVAGRLGIDRVLAGVMPQDKAGKVRELQEEGRKVAMVGDGINDAPALAQADVGIA
    IGTGTDVAMEAADITLVGGDVRGVARAIKLSKATIRNIRQNLFWAFAYNVALIPVAAGALYPLFSGGTVPEALRPILGEY
    GFLNPALAAAAMALSSVTVVSNALRLRRVRL

    >gi|108802996|ref|YP_642933.1| OsmC-like protein [Rubrobacter xylanophilus DSM 9941]
    MAAERRAEAVWEGNLVQGSGRFTVGSGAFGEMPVTWASRTEKPDGKTSPEELIAAAHASCFAMALSFVLGEGGNPPERLE
    VSATSTFEEADGGFRISRMQLDVRGRVPGLDEEGFRSAVEQAEQG
    CPVSNALRGNVDISVSARLEG

    >gi|108803082|ref|YP_643019.1| thioredoxin reductase [Rubrobacter xylanophilus DSM 9941]
    MSEQYDVVVVGSGPAGYTAALYAARANLRTLVFQGFEAGGQLMLTTDVENYPGYPEGVTGPEMMEDFERQAARFGAEMRP
    DNVDRVDFSGRPFRLWAEGQEEPVLARAVIVATGAKARWLGLPGEQRLMGRGVSG
    CATCDGFFFKDKRVAVVGGGDTAME
    EALFLSRYASEVVIIHRRDEFRASKIMLGRARKNPKISFITDTVVTDVLGEDAVEGLSLRNVKTGEESTLEVEGFFVAIG
    HDPATEIFRGQLEMDEGGYLLQKEHTMTSVPGVFAAGDVADRRYRQAVTAAGDGCRAAIDAERWLEEQGEAQEAEDPGVW
    TAGKDRSPAGSG

    >gi|108803439|ref|YP_643376.1| heavy metal translocating P-type ATPase [Rubrobacter xylanophilus DSM 9941]
    MARRELPVLGGGRPAPPGARRTVLRVEGMDCAACAASVERSVGRLPGVYRATVNFAAGRLDAEHDGSVSREMLEGAVRAA
    GYRVAGPRREARGALWREARFALTGGAALLFAAGAALQLAGGPGAARISLYAAAIAVGGGPIFRAALAALRARSMDMNVL
    MSAAVFGAAGIGAWGEAALVVVLFAAGGSLQAYAVRRTRGAVRALARLVPEEVLVRRDGAERAVPAGEVGVGELVVVRPG
    ERFAVDGEVVEGRTSVDESPVTGESAPVEKGPGDAVLSGSLNGAGAVLVRAVRRAEDSTLQRVARLVEQAQASRAPAERF
    VDRFSRVYTPLVVAAAVALATAPPLLGGDFGTWFYRALALLVIACPCSLVISTPVTVVSGIGAAARRGVLVKGGEALEAA
    GGLRALLFDKTGTLTEGRPVLERVLALRGTREEALALAAALERRSEHPLAHAMLSAAGERPLPEVAGFRSIPGRGAEGEV
    RGRRYTVGSPALFAERGVSLEAALPALREVERAGETPVVLGDGAGPIAVFGLADAVRPEAPEAIRALREEGVEELVMLTG
    DAEAPARRVAGLLGIGYRARLRPEEKVAAVRERVARHGAAGMVGDGVNDAPALAAASVGFAMGAAGSDAALEVADVALMH
    DDLRRLAGAVRLSRAARRAIKQNILASVLVKGLFVALAPFGLVTLWLAVLADMGTSLGVTLNGLRLFAGRW

    >gi|108803505|ref|YP_643442.1| protein-methionine-S-oxide reductase [Rubrobacter xylanophilus DSM 9941]
    MAQTPRKVQLSDEEWRRRLSPEEYRVAREGGTEPAFTGRYWDHKEEGVYRCVCCGTPLFSSETKYDSGTGWPSFWAPIEE
    ANVAYREDRSLLMRRTEVLCAACDAHLGHVFDDGPPPTGRRY
    CMNSAALRFSPGPPPG

    >gi|108803586|ref|YP_643523.1| UBA/THIF-type NAD/FAD binding fold [Rubrobacter xylanophilus DSM 9941]
    MKELVNVPPNGQVELSNEEIARYSRHLIMPEVALEGQKKLKAARVLTIGAGGLGAPLAMYLAAAGVGTIGIVDFDVVDES
    NLQRQIIHGTSDIGRPKLESARETIEDINPNVRVETFNEALSSENALDIFRDFDVIVDGTDNFPTRYLVNDACVLTGKPN
    VYGSIFRFEGQASVFWAEEGPCYRCLYPEPPPPGLVPS
    CAEGGVLGILPGAIGVIQATETVKLILGIGEPLIGRLLLYDA
    LGMRFREMKLRKDPKCPICGENRTIHELIDYEEFCGIPQAQAAERENEVPEITVRELKERLDRGEDIKVLDVREPHEYQV
    ANIGAPLIPLNELPERMHELNQNDEIAVH
    CKTGGRSARAVKLLRDAGFTNVYNVKGGITAWSEEIDPSVPKY

    >gi|108803743|ref|YP_643680.1| methylated-DNA--protein-cysteine methyltransferase [Rubrobacter xylanophilus DSM 9941]
    MTEKVAGVLRGAGESIPPPEDLGALVERVLEEAADVLFRVGSPLGPVFVAAGSRGVTCVGRAGGEEAFVRRYRERFGRLL
    VPAGERERGFAERLSAALAGRRVEVPLDLERMTPFQRRVMRVVRGIPRGEVRPYGWVAREAGSPGASRAVGNVMARNPVP
    LLVP
    CHRVVRGDGTPGDYGFSPREKVRLLREEGVPLEELSGSPYTATPTTGVFCHTTCRHARRIRPENRLPFRSPAEALQ
    AGFRPCRACRPAAV

    >gi|108803793|ref|YP_643730.1| protein of unknown function DUF395, YeeE/YedE [Rubrobacter xylanophilus DSM 9941]
    MEHTERPVRAEGVRGFAGSLPEPRTGVAAAAFGAMALLGYAVFSGHGVRQGVLYLIGVLLGVALYHARFGFTSAFRQLVA
    VGQGAGLRAHMLMLAVASAIFAPILAAGSGLFGAQVEGSVAPLGLSVVVGAFIFGVGMQLGGA
    CASGSLYSVGGGQTSIL
    FTLAGFIFGSVLGAWHWGFWTQEALNLAPVSLAELFGGYAGALAVQLAAIGLVASATVAVARRRRPPELAPRPSARGLAR
    AVRGTWPLWAGAVALAVLNGATLLVSGQPWGITSAFALWGSKIAAALGVDVGSWTYWSGERAASLQAPVLADVTSVMDFG
    IVLGAMAAAALGGTFVVHRRIPAKTIAAALVGGVLMGYGARIAYG
    CNIGAYFSGVASFSLHGWLWAAMALLGTYLGIRLR
    PLFGLSVPRPGDSSC

    >gi|108803818|ref|YP_643755.1| thiosulfate sulfurtransferase [Rubrobacter xylanophilus DSM 9941]
    MSEREIEAKGYAHPEVLVSTQWVAEHLDDTQNIRIVESDEDVLLYEVGHIPNAVKIDWVEELNDPLVRDYISAERFAELM
    SEKGISPETTVVFYGDKNNWWATYALWVFQLFGHERVKVMDGGRQKWEAEGRPMTKEVPSFARTRYPVPERDDSRIRAFK
    GEVERALERVGRGISLIDVRSPGEYRGELLHMPDYPQEGALRGGHIPGAANVPWARAVREDGTFKSAEELKEIYEGEAGL
    SAEDEEVIAY
    CRIGERSSHTWFVLKYLLGYENVKNYDGSWTEWGNAVRAPIER

    >gi|108803844|ref|YP_643781.1| thioredoxin [Rubrobacter xylanophilus DSM 9941]
    MPEPVAVTVDSFEREVLESEVPVLVDFWAEWCPPCRQLEPVIEELAREYAGRVKVAKVDVDAESSLAGRFGISSIPTIAF
    FEPGERPKAVMGAMPKEMIESAFGLERFSG

    >gi|108803921|ref|YP_643858.1| redoxin [Rubrobacter xylanophilus DSM 9941]
    MGVEDPYTLPEDLPVPQDDGAARHLPGTRLPSLALPATSGRSVDLSALPGTTVVYCYPMTVRPGSPLPEGWNGIPGARGC
    TPESCGFRDRHAELASLGARVFGLSAQSTGDQREARERLGLPFELLSDGELAFARALGLPTFKVEGRILLRRLTMVVEEG
    RVEHVFYPVFPPDAHAGEVAGWLRGRGRFRKGER

    >gi|108803969|ref|YP_643906.1| redoxin [Rubrobacter xylanophilus DSM 9941]
    MPAEVGERAPGFALPADSWEREVSLEEALERGPVVLFFYPGDWSSVCTDQLDEVQERLSEFSRRGAGVLAISVDSPWSHR
    AWAEARGITFPLLSDFHREVVRAYGVLNEQGFAERAYFVVDREGRIRARRVERTPRDRPPLERVLEDLDGAL

    >gi|108804089|ref|YP_644026.1| glutaredoxin [Rubrobacter xylanophilus DSM 9941]
    MSEAAREEAEIRLYTGSYCPYCRRVEKELERLGLSYEAVDADADGREEVIRLSGQRAIPVLTIGDEVLVDSTNIIRELRR
    RYA

    >gi|108804446|ref|YP_644383.1| glutaredoxin-like protein, YruB [Rubrobacter xylanophilus DSM 9941]
    MSKVVVFTTSSCPWCERAKRYLRERGVAFKEVNVERDPGAARDLVRRTGSTGVPVIKIGGKWIVGFDRQRIDQELARRAS


    >gi|108804454|ref|YP_644391.1| protein of unknown function DUF395, YeeE/YedE [Rubrobacter xylanophilus DSM 9941]
    MAESFTPTSGLLGGLLIGASAALLLLLNGRVAGVSGIVAGLLGGRPGGWQAMFALGLLLGALGYGVLAGGLAVDVRASVP
    VMAVAGLLVGFGARLGSG
    CTSGHGVCGLARLSARSVVATAVFMSAAFATVFVVRHVL

    >gi|108804455|ref|YP_644392.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
    MLFERVYDGDLAQASYFIGCQATGEAVVVDPRRDIGAYLEMARKNGMRIAAVTETHIHADYLSGSRELAAATGATLYLSD
    EGDEPWKYGFEGERLHDGDEIRVGNVVLKALHTPGHTPEHLSFLVTDGAAAEEPGYILTGDFVFVGDLGRPDLLEEAAGM
    AGTREEGARRMFRSLRERFLSLPDYVQVFPGHGSGSACGRALGAVPSTTVGYERRFSWWSRYVESGDEEGFVEALLEGQP
    DAPAYFGRMKRQNREGPALLGELPELRRYGSEELARLLQGGEVLLVDTRSLEEYYRRAIPGAVVIPGGEHLATSAAWVVD
    PEEDGDIVLLARGEEDAQRMRNHLIRVGIDRVRGYITATEGLPGEPVVLVPPEELSGGNGTFVLDVRARSEYRAGHIPGA
    VQLHVGRLRWRLEELPEGRPVVVH
    CQSGRRAAIAASTLRREGFGEVYELEGSYEGWARARGRGGATASPPAPGASGRRR

    >gi|108804599|ref|YP_644536.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Rubrobacter xylanophilus DSM 9941]
    MAERFDAVVLGMGPGGEVAASRLISGGKRVAVVEKELIGGECAYWACIPSKTLLRPPEVRGEARRAFGTGVPELEMEAIF
    DYRDYMIRNLDDAAQVEGYERQGATVVKGAGKIVGPGKVEADGETIEAGHIVVATGSAPNVPPVEGLDEITVWTNREVTT
    SREVPRRALIVGGGPNGIEAAQWLSRFGSEVTIVQSADRLIDREDPRVGELIRGALEGEGIRVLTGRKAARARRDGEGAV
    VELDDGAEVGTDVVVIAAGRRPRTEGLGLETVGIEPDGGAIPVDDRCRAAEGVWAIGDATGVALFTHVAKYQGRVAADNI
    LGRERRADYRGIPRVVFSDPEIAACGLTEEQARREGMATATATLDLSRAIARPYTYEEDPRGTLSLVADRKRGVLVGAWA
    VAPLAGEWIHEAALAIRAEVPIEKLLDSVAQFPTYSEAYLYCLERLDL

    >gi|108804601|ref|YP_644538.1| mercuric reductase MerA [Rubrobacter xylanophilus DSM 9941]
    MSGHRSRMKVGGMTCGHCEVAVGRALEGAGARDVEADFRRGEAVFALPEGAGVEALRRAVREAGYEPGAVERVGGERVRG
    GGRHDYDLAIIGSGGGAFAAAIRAVERGARVAMIERGTVGGTCVNVGCVPSKTLLRGAEIYHRAGHHPFEGVRTKALAAD
    YGAMVAQKDRLVGRMRQEKYLDLVEEYGWELIRGEAAFEDEGTLRVEGRRISAAAYLIATGARPAVPPIPGLEEAGYLTS
    TTNMELEEAPESVLVIGAGYVAIEQGQLLSRLGSRVTLMQRGPRLLREQEPEVSEAMMEALRREGIEVLTGVRIERAGKT
    EKGKKRLHLAVGGEERVLEGEEILVAAGRRPNVEELGLERAGVELDERGAVRVDGRLGTTNPRVWAAGDVTLGPQYVYVA
    AYEGALAADNALGGAGREVDLSALPGVIFSDPQVASVGLTERRARERGLEVQSSVLPLEAVPRALVNHDTLGVIKLVAEA
    GTGRLLGAHMVAENAGDVIYAATLAVRFGLTVSDLAENFAPYLTMSEGLKLAAQAFGRDVSRLSC
    CAA

    >gi|108804607|ref|YP_644544.1| redoxin [Rubrobacter xylanophilus DSM 9941]
    MTAAKKRAAAAVLLAAALAAGACGGSGGGQAAAGGQDEAVRETTAAAGETGGAAAAVPSIETLDGQEFDLEEKRGEVVAL
    YFMAGW
    CGSCIPEARAWSELYPEYRDEGLELLIVSADPNDTPQTIRRFREAGGIGKLPWAIDQTGEFTRSLGVRALDSTV
    IVGRDGGVVYRDAVPTGRQTLEQEIEEAL

    >gi|108804609|ref|YP_644546.1| redoxin [Rubrobacter xylanophilus DSM 9941]
    MSKTPREGERFPELSFLTEEGRRVSTGDLLGQTTVLYFYPKDQTPGCTREACAFRDRMEDYGRAGIKVYGVSLDPPESHR
    RFRERNRLNFPLLTDEEGRAARELGILSEKGYARRVTFLLDAGGTVIRVYPEVSPETHADEVLAAASSAGPSAG

    >gi|108804636|ref|YP_644573.1| heavy metal transport/detoxification protein [Rubrobacter xylanophilus DSM 9941]
    MKTLLRSNELSCPSCIKKIERSLKALDGVSEATVHFTTGRIEVEHDPERVGPEALVEAVRSAGYNSRVAPF

    >gi|108804655|ref|YP_644592.1| DSBA oxidoreductase [Rubrobacter xylanophilus DSM 9941]
    MNAKDPAKNADGKAGWPLLAALLGAALLAGAMALYLLGPADRGAGESPPGGGERLPAPSLGREDAPVVMVEYADFQCPYC
    GEYAREVQPKLVEKYVESGTLRIEWRDFPYLGQESVNAALAARAAQAQGRFWEYHDLLYENQKPVNSGGFSDANLIKFAK
    KAGLDVERFEEDLKSGRYEAAVARDFREGQRRGVAGTPTFVINGKVVVGAQPQEVFEKAIEKAEREAQGG

    >gi|108804659|ref|YP_644596.1| beta-lactamase-like protein [Rubrobacter xylanophilus DSM 9941]
    MFFREVLNEDLGCASYVVAGGGEAAVVDPKWEIEEYLRIAEENGFDIAHILETHNHADHVSGKGRLAEATGAKIHISKDA
    GVEYDHEPLSDGDVVEVGGVRLVALSTPGHRPEHMSFLVEDTSRSGSPWVVLTGDFLFVGDLARPDLAVEAEEGARGIFR
    SLRRLEHLEDFVEVRPGHIGGSLCGGAGMSRKPGSTVGFERRFNEYLRIEDEEEFVRALTAEQAPQPPNFERIVELNRGP
    LLTEAASLEPLLPRRAKELVEAGAILIDGRDQREFDAAHVPGSINVTMNQSGVGTRAAWVVGPEAEVVTVADGDERARRM
    ARMLEAVGFRKVRGYLAGGLGGWRAAGFGVGSTPAIDVPTLAERLRRDEVALLDVRGAEEWEAGHVEGSIHVPYQSLRDG
    VPEEVRNAGKPLAVA
    CSGGIRSAIAASLLKRSGVEGVQHVAEGGVPDLEKAGVDLRR

    >gi|108804664|ref|YP_644601.1| thioredoxin [Rubrobacter xylanophilus DSM 9941]
    MSKPVAVTAQTFDGEVLGSEIPVVVDFWAAWCGPCRRVAPVMDELARDYEGSVKVVKVDVDAESELAARFGVSSIPTIAF
    FEPGREPKAVVGALPKGALVEAFGLDRLPRGAGRVA

    >gi|108804901|ref|YP_644838.1| glutaredoxin [Rubrobacter xylanophilus DSM 9941]
    MRVELYTAPGCPYSEAAREDLEWRGVEFVEYDVEKDRRAYERLLKLTGGMRTVPVIVEEGRPVQVGWMGRGCTV

    >gi|108805011|ref|YP_644948.1| putative reductase [Rubrobacter xylanophilus DSM 9941]
    MMVPFVRPRKPLERCRLALVTTGGVHLPGQPPFDIDDPLGDCSYREIPSDAGELTWTHAYHAPGREGDLDAVFPLWTARR
    LVSEGRVGGLSPRHFSFMGAIHDHGPLEEDTAPEVARKLLADGADAVLLTPS
    CPLCHRSVELVSSILEESGLPTVTLSME
    DGVEAPRVARVPFPYNMPLGPPGDRELHRRVALGALGLLHGLEAPGEVPLL

    >gi|108805100|ref|YP_645037.1| thioredoxin [Rubrobacter xylanophilus DSM 9941]
    MAVKDVTDDTFKSEVLDSDKPVIVDFWAPWCAPCRRVAPVLEELSESRDDVKFVKLNVDDNQNTTLNYSVTSIPTIARFE
    NGQVTRRAVGALPKQQLMEQLDL

    >gi|108805155|ref|YP_645092.1| thiosulfate sulfurtransferase [Rubrobacter xylanophilus DSM 9941]
    MSEREIEAKGYAHPEVLVSTQWVAEHLDDTQNIRIVESDEDVLLYEVGHIPNAVKIDWVEELNDPLVRDYISAERFAELM
    SEKGISPETTVVFYGDKNNWWATYALWVFQLFGHERVKVMDGGRQKWEAEGRPMTKEVPSFARTRYPVPERDDSRIRAFK
    GEVERALERVGRGISLIDVRSPGEYRGELLHMPDYPQEGALRGGHIPGAANVPWARAVREDGTFKSAEELKEIYEGEAGL
    SAEDEEVIAY
    CRIGERSSHTWFVLKYLLGYENVKNYDGSWTEWGNAVRAPIER

    >gi|108805157|ref|YP_645094.1| OsmC-like protein [Rubrobacter xylanophilus DSM 9941]
    MTSIAEKIGELREQLERLERAQQDFSASTRLVEGLRTEAEIRGFELTVDEPRELGGTDAGPNPVELVLAALGTCQEIVYA
    VYAPRAGVELEGVEVDVEGTLDPRGFLGVSGEARPGFESVRYSVRIQSPSEPEKVRELVRLVEEHCPVLDIISNPVRTSG
    SAQLNGSPLA

    >gi|108805332|ref|YP_645269.1| hypothetical protein Rxyl_2540 [Rubrobacter xylanophilus DSM 9941]
    MDTVANRLANETSPYLLQHKDNPVDWYPWGEEALRRARREDKPILLSVGYSSCHWCHVMERESFEDEETARIMNEHFVNI
    KVDREERPDIDSIYMSALQAMTRGGGWPMTVFLTPEGVPFYAGTYFPPEPRGGMPSFKQVLLTLADAYRNRREEVLRSAE
    SVREFLRASTTAEMPRGRLREELLDGAAEALMRQLDRRFGGFGGAPKFPQPMSLEVLLRHHRRTGDREALAGVELTLRSM
    ARGGIYDQLGGGFHRYAVDGRWLVPHFEKMLYDNALLSRLYLEAYQATGDGFYRRIAEETLDYVARDMRGPEGGFYSAED
    ADSEGEEGKFYVWTPRELREALGSEDASLAAAYWGVTERGNFEGRNVLHVPREPEEVAREVGLSPGELGRRVREIRRRLL
    EARGRRVRPGRDEKVLAAWNGLMLRSFAFTARVLRREDYLRIACENAAFLLGRLLSPEGRLLRSYRDGRARIAGYLEDYA
    MVADGLVSLYEATFETRWLREAISLADAMDELFWDESAGAFFDAPAGGEELVTRPRDVYDNATPSGTSVAVDVLLRLALL
    LGREDYRRRAEAALEGLSGLLEQMPAAFGRLLGALDFHLGRPREVAIVGRPDAPDTRALVDALYSVYLPNRVIAGGPGGE
    DASLVPLLEGRGMVDGRATAYVCEGYVCKSPTTEPGELLRQLREG

    >gi|108805341|ref|YP_645278.1| dihydrolipoamide dehydrogenase [Rubrobacter xylanophilus DSM 9941]
    MADKFDLVIIGGGNAGYIPAIRASQLGMSVALVERREGGHLGGTCLNLGCIPTKALLQTAAMLHDARNGEEFGVKVGDVR
    FDYRQAAKRRDQVVNQLRRGVAGLMKKNKVSVYNGTGSFIQPRRIKVELNDGGTEELEAENVLIATGSAVNTLPGLEFDG
    EKVISSDDVVTENDGYPESVIILGSGAVGVEFASMYNDFGTEVTIVEILDRLVPLEDPEVSAELEKQFEGRGIRCLTGTK
    ADPGSLDKSGDGVKIKVAGEGGEETLEAEKLLVAVGRKTVTEELNLEATSVKTDDRGIIQVDEFYRTDEPGVYAAGDVIG
    GYWLAHAAGHEGIVAVEHMAGKDPMPLDQNLIPRVTFCRPEIASFGLSEEQAREEGYEIKVGKFPFRAIGKALIEGEPNG
    FLKVVADAETDLILGMHAIGPHVTELIAEGVFAKLVEGTPEEIGMAVHAHPSLAEIVGEAAMAVDGHAIHF

    >gi|108805357|ref|YP_645294.1| alkylhydroperoxidase AhpD core [Rubrobacter xylanophilus DSM 9941]
    MEPRIDYARVAPGAPEAMRHLERYVRESGLEPGLLELVRLRASQINGCAYCIDMHTKDARAAGESEQRLYALDAWWETPF
    YTERERAALAWTEAVTKVSEGTSPTRSTSRRASTSARRSSSISRWLSSR

    >gi|108805424|ref|YP_645361.1| rhodanese-like protein [Rubrobacter xylanophilus DSM 9941]
    MAKSYEDLVAEARRQTRQVSPEEVREALRSGEGITVVDVREPEEWGQGHIPGAKHIPRGVLEYRAASDLPDRGARIVVHC
    AAGGRGALAAKTLQEMGYTDVANMEGGLGAWRERGYELE

    >gi|108805549|ref|YP_645486.1| hypothetical protein Rxyl_2759 [Rubrobacter xylanophilus DSM 9941]
    MTDTERRAAGSRRGEVPISWFPVPEESELPEDLQGLFRKAREKLGFVPNVFRAYSFRPERLSAWFDHYRQLHEPTENLDA
    AEREMIAVAVSMANGCLY
    CLVAHGAALREALGDPILADRITLDYRRAGLDERRTAILDFAVKITREPLECSPEDIERLCG
    LGLAREEVWDVIEIASMYNFTNRMSLACGMIPNEEYHALAR

    >gi|108805561|ref|YP_645498.1| HesB/YadR/YfhF [Rubrobacter xylanophilus DSM 9941]
    MNREGGGVIIRGDGARERSWLRHSREVPVEQKQAIVSITDKAAEKVRALMEQEGEEDLALRIGVRPGGCSGFQYSIYFDD
    EVAEDDEVFETKGVKILVDAMSVPYLMGSEFDWQESLMGAGFVVNNPNVQGSCGCGGSFTC

    >gi|108805590|ref|YP_645527.1| thiosulfate sulfurtransferase [Rubrobacter xylanophilus DSM 9941]
    MSDPLVGTAWLEERLGDSRLRVVDIRGYVKKRTVGEGRQEAEYLGAREEYERSHIPGAVYVDWTRDITDPDDPVPVQIAP
    PERFAEAMGSRGIGDETHVVVYDHAGGQFATRLWWALVYYGHDAVSVLDGGWNRWVAEGRPTTRELPSPAPAAFTPRPRP
    GWRKEAEEVLRLSRSGEALLLDARDAGQYAGVLARGEGRAGRIPGAAHLHADSLLDPERGGFLPPEELERRVREAGVPED
    RESPVVAY
    CNGGVAATVPLFVLHRLGYRNLSNYDGSWNEWGVRDDLPAER

    >gi|108805594|ref|YP_645531.1| thiamine biosynthesis protein [Rubrobacter xylanophilus DSM 9941]
    MTETAERKTETARAAAGRPGFRRGLLVRMGGEIYTKSSRTRRRFLRVLVNNIYLALRESGIRASIRPEWSRVLVYADDLP
    RAREVLTRVFGVYAVAEALEVPYASLEDLVEKVAPLFREHVAGKTFAVRARRRRAPFTSQDVGRELGAALLPFSAGVDLD
    DPEAEVRLEVGRDRAFVLLEESRGPGGFPAGTGGRALALFSGGFDSPVAAWRVMRRGIRVDLVVYDLGGCGQVGQALAVA
    RELALRWAPGLEVRANVVDLAPVVSALVRRVDPRLRQILLKRAMYRAGSILAGELGFEALVTGESLGQVSTQTLRNLAVA
    EEAASVPVLRPLVGSDKQEIIEAARSIGTHDVSALVKEHCSIATGPVETWADPEEVLTAESGLDQDVDEAWLRRAVENRR
    VIRLKSWDPAGEESPGYVVDRVPEGAVVVDIREPGEGEPVGDLRLPFSRAMESLEELDPSREYLLV
    CASGRRSELLAREM
    IGRGYRAYSLEGGAGRLAAAPS

    >gi|108805609|ref|YP_645546.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rubrobacter xylanophilus DSM 9941]
    MPQTLAIVGAGPAGGSAAAALRREGFEGRVILIGAEPHPPYERPPLSKEYLRGETSFEQALLQPSGFYRENGIEAWFGVR
    ATRVDAARREVELENGERLAYDGLLIATGARNRRPAIPGLGLGGVHQLRTVAD
    CDRIRQEIAPGRRAVVVGMGFIGSEVA
    ASLRQSGVEVTVVDRNEVPLRRALGREVGRVIEELHRDHGAELILEDAVAAFEGRERVERVTTRGGRRIGCDFVVVGLGA
    EPVTDLLAETGAKIQNGIVVDEHCRTSVEGVYAAGDVANHYHPTFGRHIRTEHWQNALRQGSVAARSMLGKKSAPYEEIP
    WFWSDQYGHNLQYAGLHTEWDELVVRGSMRERDFLAFYRKDGRVLAAVAIGRGRELRRSIPLIKARERVEAAKLRDPDVD
    LRALAGAAGSRR

    >gi|108805651|ref|YP_645588.1| methionine sulfoxide reductase A [Rubrobacter xylanophilus DSM 9941]
    MLRAGAGTPAAWYPQRRMDGRLETATLGGGCFWCVEAVFDELRGVRRVEPGYSGGHVERPTYEQVCTGLTGHAEVVQVSF
    DPREISYRELLEVFFAVHDPTTKDRQGPDVGPQYRSVIFYHDEEQRRTAEEVISELEARGIWDGPIVTEVAPFTAFYPAE
    EYHRDYFRRNPDQPYCRVVIAPKVAKFRKEFLERLKA

    >gi|108805666|ref|YP_645603.1| methyltransferase type 11 [Rubrobacter xylanophilus DSM 9941]
    MGRGLRDAVRERYAAAARSVAGGGSCCGGAGAAEGEGLPRAAWRASLGCGDPVSLAGLSPGEVVLDLGSGGGLDALRAAR
    RVSPGGRVYGLDMTGEMVELARRNASEAGVHNVEFLQGEIEDIPLPDASVDAVMSNCVINLSTDKERTLAEAARVLRPGG
    RLAVHDVIFPDGSPPLREGRRRDPELWAG
    CVAGALRAGEYRRLLAAAGFEEVSVEPVSPFGCGEGLPPLASAFVRARRPA
    GGRDGS

    >gi|108805706|ref|YP_645643.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rubrobacter xylanophilus DSM 9941]
    MRLVVVGGVAAGTKAAARARRVNPRLEITVYQEEPEPSISECGLPYLLSGTVSGRRRLVARTPEEFARDGIRVLVRHRVE
    EVRPEEGRLLVRDLAAGSVFEDRYDRLVLATGARAVPLGVPGSGLEGVFNLRFLTDADRILDHIRRHRPRRALVVGGGYV
    GLEVAENLRLLGMEVVLAQRPRRVATAYDPEISRRIEEHLRERGVELRTGAEVEELRGDGRVREARISGEAVEAGLVVAG
    VGIEPEVDLARRAGARIGTTGAVWTDRHQRTSLPEVWAAGDCAQTRNRITGGPAWVPLGDTANQTGRVAGTNAALGEDAE
    EFPGVLGTGIFKVFDLAAGKTGLSEAEAAGAGLEAVAATIESRSRAGYYPGAGRVLLKLVAERGSGRLLGAQALGPGADK
    LTDVCATALWGGLSCSDLINVDLAYAPPYGPVLSPVIQAATVLQRRLSQPPK

    >gi|108805726|ref|YP_645663.1| ArsR family transcriptional regulator [Rubrobacter xylanophilus DSM 9941]
    MNEREHRAFKEELFGQFARIGRALANPHRLELLDLLAQGERTVEELAREAGMSVANTSRHLQELRSARLVEVRREGLYGY
    YRLADERVFGVWRAIRELGEARLAEIDWLVRTHLKDRESLEPVGAEELFERLRRKDVLVLDVRPEEEYRAGHIPGALSVP
    LERLEAYLAEIPKDQEIVAY
    CRGPYCVFADEAVALLRSRGYRARRLQEGLPDWRAAGMPVEG

    >gi|108805945|ref|YP_645882.1| periplasmic binding protein [Rubrobacter xylanophilus DSM 9941]
    MRAVSLLPGATEMVFFAGAGEALVGVTHECDHPPEVRSLPRLTSSGIDHRSMTSAEVDAAVRSVTDGASLYSLDASLLRR
    LEPDLVITQGLCEV
    CAVSPGVVEAAISALPRRPAVLSLNPSSLEEVLSDAVRVGEALGRGREARERVAGLRERLRRVARA
    TAGLPRPRVACLEWLDPPFSAGHWVPEMVELAGGEPLLAAPGEPSRRLGWEEVVGGAPEAVVLMPCGFGVGRTLREAGLL
    ARVPGWEGTPAVREGRVWAVDANAYFSRPGPRLVRGVELLAALLHPEAPVSPPGPEEARPLPRELLVAR

    >gi|108803529|ref|YP_643466.1| OsmC-like protein [Rubrobacter xylanophilus DSM 9941]
    MDLRRVQRPLKERYRREPGSSRITLRARGTETGTPVSCSVDIGRAVYEAGAHAGVGGPGTAACSGDLLLGALAACAQITC
    QMVAASLGVPTRGIEALAEGDLDLAGTLGLSEEVPVGFQEIRLTLAVDAPEASEEQLESLREKTERY
    CVVMQTLKSPPRV
    SVSWEAG