Rothia mucilaginosa uid43093

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|283457108|ref|YP_003361672.1| glutaredoxin-related protein [Rothia mucilaginosa DY-18]
    MFERQQSDQQKAREVMKDGGVVIYWRPGCPYCEALDSKLGELGDHATWVNIWEDPQAEAHVKSLNDGNATVPTVDTGDTH
    FVVADLVSRNKVKKLIQNTLDAGGEA

    >gi|283457157|ref|YP_003361725.1| rhodanese-related sulfurtransferase [Rothia mucilaginosa DY-18]
    MTAVPQVDPRDVPEGATIIDVREDYEWEGGHATGAKHITLGTITERLAELPAPGEDFYVICHGGGRSNRAATFLREHGYA
    AHNIAGGTSAWFAAGLPMTSENGEAPAVVH

    >gi|283457179|ref|YP_003361747.1| cation transport ATPase [Rothia mucilaginosa DY-18]
    MSSTLQKPSLQSERSLFNSAGTTVKSTESTRIIHVDIQGMTCASCVGRVERKLRKIPGVDPAVNLPLESARVIVPEGVSD
    EQIVETINNAGYTAHLKNGPRAGAGTNASASDGGGQHTTPSMKGGFTDRIIYAAILGVPIFLISMFPAFQFPNWGWVVAI
    LTAPVAFWCAAPFHRAALINARHGSSTMDTLVSLGVVVAYFYSLAQLLMNPALTAHVHHAGGSFWSMFTGHHAPLYFDSA
    SMVTLFLLIGRAIEHRTRHRSSDALRTLLSMGAKEATLLRTDKQGVTKQVQVPVEDLMPDDLFLVRPGEKIATDGVVVEG
    TSAVDASLLTGESVPVEVHPGDAVTGATVNTSGSLTVRATRVGTETTLAKMGELVASAQETKAPIARLADRVSAVFVPVI
    LTISALTLVGWWLVSGDGAAAFNAAVSVLVVACPCALGLATPTALLAGTGRGWQLGILIRNAQVLEATSTVDRVVLDKTG
    TVTTGEMSVAFYGTFGDYESAGDLAGISPDSTDSKSERSLSVLRDAAAVEALSEHPIARAIAGFAREQGVLAEGASAPSV
    SDFEGVPGGVRGVLSGAGEGTENGTPQLVVVGTPEYLQAAGAQLSEGQLALLDQARRAGLTTVVVARGEMPNNEAAENAP
    APQPVGMISVADTPKPEAAETMAQLRELGLEPILLTGDAPQVAQAVASQVGISADNVYAGVTPEGKSQVVRQLQEAGHRV
    AMVGDGVNDAPALALAELGIAMGSGTDVAAEAADIVLTRSDVASVVTALRLSRATLRTIKSNLFWAFAYNTVAIPVAVAG
    LLNPMIAGAAMAFSSVFVVLNSMRLTAFRK

    >gi|283457329|ref|YP_003361903.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component [Rothia mucilaginosa DY-18]
    MTTPAHLHFDMVVIGFGKGGKTLAGAYAKTGKNVALIEQSTGMYGGTCINIGCVPTKALVHRADEFRASGERTLEEANAA
    YESAVVFRDKLTGMMRAKNREILLSNETAKLIDGHARFISDTEVEVTAGEDTLRVTADYFIVNTGAVSVIPPIEGVRESE
    RVLTSTELQKLTPRPKRLGIIGGGPIGVEFAGIFSSYGTEVTILDGAPALFGRYDEDVAQVAREIIADQDITAHTGVRVQ
    SFKDGADSVTVTYLDSEGATQQLEVDYVMVATGRKPATEGLGLENTSIETNDRGAIVVDEHLRSTVPNIFALGDVNGGPQ
    FTYISLDDYRVVLSQLVGDGSRSTKDRKAVASTIYMNPPLSSVGLTEREAIEAGHKVKVASKPVAAVAAMPRAKTMENPR
    GIMKFVIDAQTDQILGAQLLVIESMEVINLVALAMRHGITASQLRDEIYTHPSITEGLNEVLAVAAPVN

    >gi|283457413|ref|YP_003361989.1| predicted sulfurtransferase [Rothia mucilaginosa DY-18]
    MAQNKIILYYQFAPIADPQAVMLWQRALCEKLGLRGRILISKHGINGTLGGEINAVKAYTKETRKYPGFKNMEFKWSEGG
    AEDFPRLSVKTRDEIVAFGAPDELQVDENGVVGGGVHLKPEEVNKLVEERGDEVVFFDGRNAFEAKIGKFKNAIVPDVRT
    THDFIREIESGKYDHIKDKPVVTY
    CTGGIRCEILSALMKNRGFKEIYQIDGGIVRYGEKYGDKELWEGSLYVFDKRMHME
    FTPDTVTIGKCEQCGAPSNKFENCSNENCRELVLLCPECAADDAKRHCVPECSVDREAAEANA

    >gi|283457472|ref|YP_003362050.1| thiol-disulfide isomerase [Rothia mucilaginosa DY-18]
    MATNEITQQNLTATVESNDIVFLDFWADWCGPCKQFSPVYEAASEKHSDIVFGKVDTEDQGQLAQAAGITSIPTIMGFRD
    GILVYQQAGALREDQLETVIGSIRELDMDKVRAEIAAAEGSAEKK

    >gi|283457519|ref|YP_003362101.1| dinucleotide-utilizing enzyme [Rothia mucilaginosa DY-18]
    MMRGTPMSSHTSRSTSELSAAERAFYSRQLILPEMGYEAQLALKRARVVVLGAGGLGAPALLYLAGAGVGQIVVVDDDVV
    DASNLHRQVIHTHARVGNSKADSAAESLRSLNPFIEVVPVRERLTEANVDDLLSGADLVLDGSDNFESRYMVSAAAARAG
    IAHVWAAILGFDAQLSVFWAGHGPVYEDLYPHAPAAGSVPS
    CSTAGVVGAMAGVVGAAMAMEAVKLLTGVGEPLMGEVGL
    YSALSGRWEYIPLVASVQAVPKKSVVLPQETSYKPKNYVTIRNISQDFTSSSTDSTPRPISAQDLKKLSSDENIALLDVR
    EQVEFEAFAIDGAINLPLTELLEAGRNSVLKALIERKIPANAQKIVIYCTGYARTVEAAREIAPLVGRSVYMLEGGISAW
    LTV

    >gi|283457648|ref|YP_003362232.1| peroxiredoxin [Rothia mucilaginosa DY-18]
    MAEVTLQNELVIHTNGDLPAVGAKLPEFSVLAADLSEISSADFAGKNLVLNIFPSVDTSVCATSVRTFNKQAAGLENTVV
    LCVSNDLPFAIGRFCAAEGIENVVTSSAFRSSFGEDFGVKLIDGPLAGLLARSVVVVNPAGEVVYTELVPETTNEPNYEA
    ALAAIK

    >gi|283457790|ref|YP_003362381.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component [Rothia mucilaginosa DY-18]
    MQGSNIVAQEFDILILGGGSAGYSAAIRARQLGFTVGLVEKEKVGGTCLHTGCIPTKAYLHAAELAEDAREASKVGVNAV
    LQSIEMGKVRDYKDGIVSGKFKGLAGLLKMKGVEVIPGEGKLTAQDTITVGGVEYKGKNIILASGSVSKTFGLPIEGRVL
    TSTEALEMDYLPKSAIVLGGGVIGCEFASMWNAMGVDVTIIEGLPNLVPNEDPAIIKVLERAFKKRGIKFNTGTLFEKVE
    QDANGAKVTLADGKVFEAEIVLVAVGRGPNTANMGYEEQGIPMDRGFVLANERLHTGVGNIYAIGDIVPGVQLAHRGYQQ
    GIFVAEEIAGLNPTIVEDINIPKVTFCDPEIASVGYSEPKAKEKFGAENVETAEYNLAGNGKSSILGATGIVKVVRQKDG
    PIVGVHAIGKRMGEQIGEAQMWVAWEAFPEDVAKFVHAHPTQNESLGEAAMVLNGTPLHSA

    >gi|283457807|ref|YP_003362399.1| peroxiredoxin [Rothia mucilaginosa DY-18]
    MMSVRLEPGTPAPAFTLADASGKEHSLSDYAGSKVILYFYPKASTPGCTKEACDFRDNLASLKSLGYVVLGVSPDSPAAI
    ARFVEKESLTFPLLSDADHAVAEAYGAWGEKKNYGKVYEGLIRSTFVIDEQGVISVAQYNVRATGHVAKLRRDLGIDPK

    >gi|283457919|ref|YP_003362522.1| 2-hydroxychromene-2-carboxylate isomerase [Rothia mucilaginosa DY-18]
    MTENAPAQIDFWFDPICPWCWITSRWIGEVQKVRNVEVTWRPFSLSMHNQGRDLPADYQAMMDRSWAPTRLITAVRELHG
    NEVIKPLYDALGEQIHHNDNKADSYRDAIIKALEEVNLPAELVDVAFTDQYDEQMRASLDLALETVGGTDVGVPLISING
    TAFFGPVISPSPAGEEAGKLFDGALALASYPGFFELKRPRNVGPIFHGEKGEA

    >gi|283457957|ref|YP_003362563.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Rothia mucilaginosa DY-18]
    MLGERTGRQLPHPSVRGIDTMRIDIWSDIVCPFCYVGKRNLEQALAEFEHRDEVEVVWHSFELDPSATEHPAGSLPELIA
    GKYQMPLEQAIASQESLAEHARKVGLDFNWRQARYGNTFDAHRVIHYASEQGLASAAQEAFKMAYFTEGRSVQDHESILD
    IASEIGLDTAEVEAVLKSDRYAADVRADEQLAHQLGINGVPFFLIESKWAVSGAQPAEALLQALRHVWEQTHQVEFLNPL
    AGAAGDAAGNNAAEAGPSCDVNGNCS

    >gi|283457961|ref|YP_003362567.1| glutaredoxin-related protein [Rothia mucilaginosa DY-18]
    MVVTVYTKPQCVQCNMTYRALDAKGISYTKVDITEDAQALEMVKSLGYMQAPVVIAGDEHWSGFQPDKINALAA

    >gi|283458092|ref|YP_003362706.1| hypothetical protein RMDY18_10540 [Rothia mucilaginosa DY-18]
    MHTLGCASNTQGRIVKAKTPTRDAHATHTGNQQNKRTTPMSATTIELPTHGVNLTEVAQTKVRTLLEQEGRTDLRLRIAV
    QPGG
    CSGLIYQLYFDERVLDGDAVRDFDGVEVIVDKMSAPYLDGSTIDFEDTIEKQGFSIDNPNAAGSCACGDSFH

    >gi|283458239|ref|YP_003362858.1| peptide methionine sulfoxide reductase [Rothia mucilaginosa DY-18]
    MTDVVLAGGCFWCLDAVYRQFRGVEASVCGYTGGDTPDPDYRSVCSGATGHQEALKLSFDPQVIDLDTVLDIFFTSHDPT
    SWDRQGADTGSQYRSVLFYADEQQREAFERAVARAQQLYSSPIVTEIKPLGVFYEAEEYHQNYYALNPAQGYCAFVVSPK
    VAHARRNFAHLLR

    >gi|283458264|ref|YP_003362883.1| hypothetical protein RMDY18_12310 [Rothia mucilaginosa DY-18]
    MMGNSLPGVGAIAKNWREVLKPEEYAVLREGGTERAFTGEYWNTHTEGVYSCRACGTELFRSDQKFDSHCGWPSFFAPLA
    EDRVRYLEDTTFGMRRVEVRCAACDSHLGHVFEGEGYPTPTDLRY
    CINSVCLTLTPAGEASADEAESAE

    >gi|283458401|ref|YP_003363025.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component [Rothia mucilaginosa DY-18]
    MSIENVERIDGVAQYDLIVIGSGSGNTLIGPEWDDKKVALIDGGIFGGTCLNVGCIPTKMYVYPATIAQKTREVKHLGVD
    AHVDAVHWAQIRDRIFASRIDQIVEGGRNWRAGLPNVDFYDQYARFVGSHTVELTDGTRLQGRQIVVAAGSRAVLPPVPG
    IDSSKVYTNDNVMRMDELPARMVVIGGGVIAAEFSHVFSAFGTEVTQLNRSSRLLRGVDEEVVARFEEAASKQWNIVKDA
    SLSEIRENADGSVTVVAKHTTENGEELLEIPADAVLVATGRRPNTDTLNAKNYFDVQDGGQLSVDKYQRVLYNGAPVPGV
    YALGDVSSRYQLKHVANHEARVVQHNLSHPEDLRASDHRYVPAAVFSNPQIAVVGMTEEQARQAAEREGFEITVKAQNFG
    DTAYGWAMEDKIGLCKLIARKDNGELLGAHLVGEESSVLIQPLLQAMSFGMDARTLARGQYWIHPALTEIVENALLGLEF
    DEPAN

    >gi|283458416|ref|YP_003363040.1| methylated DNA-protein cysteine methyltransferase [Rothia mucilaginosa DY-18]
    MPFAPSAVHTHEPTRKSMTKATDSPQPPEALTRWYTRYSSPVGVLYIAARANAIVGIWYEDQAHFPLPHELGELIENPGT
    YLREHGTAEDEEPTGEYAAAQLLSRAEAELSEYFERKRTSFTLPLDPEGTDFQLIVWEHLKTVPAGYTTTYGEISRAVGP
    GAPAQAVGQAVGRNKVSIMIP
    CHRVIGADGSLTGYAGGVERKQFLLDLEEPEEVREARLF

    >gi|283458720|ref|YP_003363355.1| dinucleotide-utilizing enzyme [Rothia mucilaginosa DY-18]
    MDVNLTPTPVNPEHMRLDRERTDRQRRLPGFDQDAVAAARVLVIGAGGLGCPVVQALAAAGVGYLHIVDSDSVELSNIQR
    QPLFGVPDVGEPKAEVAARRALDLCPSLTVETSVRHVDASWILDLFAASAPDCVVDCTDTFASKYLIADAAQVAGLPLVW
    GTVLRFGGSVSLFEPDGAHLRDIFPTIPQTVES
    CALAGVLGATTAVVGSLMATEVLKYVSGLPTAAGSLLTYDALSGTCT
    SFEAVPDPARVVPVDLSAHEVPQVLLDVREAPEREESVKHEGSLHVPLSRLSDAEGSLLPATDVPAELLSLFESVRDQRV
    GVFCASGARAQRFVQAYEELAGEYGVSLTAI

    >gi|283458725|ref|YP_003363360.1| thiol-disulfide isomerase [Rothia mucilaginosa DY-18]
    MSENTTRNVRVRASELEGRAWLNTGDKNLTLQDLRGKIVILDFWTLCCINCLHVLDELRPLEEEFSDVLVTVGVHSPKFE
    HEADPVALAAAVDRYHITHPVLDDPELTTWQAYTARAWPTLVVVDPEGYIVAHLSGEGHVQGLTSLVRELVAEHEAKGTL
    HRGDGPYVPRPKAAGTYAFPGKAIELPAEFGPANLFGNRERTYLVADSARHRILQVAADLNTVINTYGGGDDPVNHPVKG
    HVDGTGTEARFNEPAGLALVPENLREQLGYDVLVADTVNHRLRSLNLTTGEVRTLAGNGVQRVIDGDNAITGDPNHIPAG
    VPATEIALSSPWDAVYSREAGQFIIAMAGTHQLFGYEPINGTVSIFAGSGVEGLADGPAADAWFAQPSGIIEARDGSLWV
    ACSETSGLRHVTFTEDGVQVTSAVGKGLFDFGFVDGDSDTARMQHPLGLTELPDGSIAVADTYNGAIRRWDPATGTLGTL
    ERGLDEPSDLLVEEVPGEEPRLIIVETNAHQLVRASIPAKAQHVDEGAITTARPSTKLTGGTLEFVSRFTVPTGQKLDTR
    WGDPTQLKISSTPENFILEGAGTSTGLTRTLVLNPEITEAVLHITARAAACDGTPDGDIPEHAACHLYQQDWGIPVVVTG
    DEADESELVLDLRGIN

    >gi|283458854|ref|YP_003363500.1| peroxiredoxin [Rothia mucilaginosa DY-18]
    MAVLTIGDQFPAYELTGVVPGKLADIEATKPEDYFTTVSSEGLDEDTWRVVFFWPKDFTFVCPTEIAAFGKLADEFEARD
    TQVIGVSVDNEYTHYAWRRSHEELVDLPIVMASDLKRELTAALGILNKDGVADRATFIIDPHNTIQSVSITADSVGRNTD
    EVLRQLDALQSDELCACNWKKGAATIDAFKEMK

    >gi|283458855|ref|YP_003363501.1| hypothetical protein RMDY18_18490 [Rothia mucilaginosa DY-18]
    MSIDNLRSALPSYAKDMSLNLSSLPRITSLSEQQLWGAILATAAATKVDSVVVEIAAEAKEHLSDTAYEAALGAASIMGM
    NNIFYRTRGFLNGAYDDQRANLRMQIIGKNGGIEKLDFEMFALAVSAVNGCSH
    CVEAHEHTLREEGATKEQVNDLIRIAA
    TLGGVAQGIQLAEALG

    >gi|283458985|ref|YP_003363634.1| thioredoxin reductase [Rothia mucilaginosa DY-18]
    MTENLGGLFGGAALGNLNLASAPATKAAPAAEVEADATVHNVIIVGSGPAGYTAAIYAARAELKPVLFASSLAPGGSLMN
    TTEVENFPGFIQGIQGPELMENIGQQAERFGTDIRYQDVEKVELTGDVKKVYTADGAVHLAKTVIMTTGSQVRKLNIEGE
    DRLSGYGVSW
    CATCDGFFFKDKEIAVVGGGDSALEEALFLTTFASKVYLVHRRDSFRASEIMQTRVFNNPKIEVVWDSAV
    TAVHGESNLESITLTNTKDGSERQLAVQGLFIAIGSDPRVELVRDQLEITEHHTIAVQGRSSKTSVPGVFAAGDVIDPTY
    RQAIIAAGSGAVAALDAQHYLENL

    >gi|283458986|ref|YP_003363635.1| thiol-disulfide isomerase [Rothia mucilaginosa DY-18]
    MSSAQQATDATFDELVLKNDKPVIVDFWAEWCGPCRMVGPVIDEIAGEYAGQVDVVKVDVEANGDTAMKYGITSIPAIYL
    FKGGEVVKKTVGAKTKPALLAEFSEHLG

    >gi|283457867|ref|YP_003362467.1| thiamine monophosphate kinase [Rothia mucilaginosa DY-18]
    MNPQTFSETRDNPMRETPLSKLGESRVLRAFMPIINAHNEQVAAAARQAGRIEPLEVGPGDDCAVLAEPAPGQRTVVTTD
    TLVEDQDFMNLWPGGIARAGEAGEFILDPARSSGYDVGRKAATQNLADVAAMGARPASLFISLSLPGSTPYGWIDGFAHG
    IVDGINACGATECVIGGGDIGDSTEMSVTVTALGYTDRAVLRSGARPGDTIALAGRTAWSDAGLRLLLNPLSLPATALLR
    AIAAGQEVEAALGAVAQAWEKKQAEGSSALPEGLIELVRTLTPEDAAHMIAVCERAVESQHHPVSPIPAGDVARQHQASS
    MLDLSDGLVKDAGRVAAASGVQMRLDRAAVDAFAEPLLPLARLLLAIGERNEAGESPASLARTFVLVGGEDHGLLATFPG
    EVPEEFVPLGTCVADAPERGLSAELYGAERRHNAVTGAAVVMDGRSLDGMGWEHYGASA