Rothia dentocariosa ATCC 17931 uid49331

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|311111675|ref|YP_003982897.1| dihydrolipoyl dehydrogenase [Rothia dentocariosa ATCC 17931]
    MQGSNIVAQEFDILILGGGSAGYSAALRARQLGFTVGLVEKEKVGGTCLHTGCIPTKAYLHAAELAEDAREASKVGVNAT
    LESIEMGKVRDYKDGIVAGKFKGLSGLLKMKGVEVIAGEGKLTAQDTVTVNGTDYKGKNIILASGSISKTFGLPIEGRVL
    TSTEALEMDYLPKSAIVLGGGVIGCEFASMWKAMGVDVTIIEGLPNLVPNEDPAIIKVLERAFKKRGIKFNTGTFFEKVE
    QDANGAKVTLADGKVFEADIVLVAVGRGPNTANMGYEEQGIPMDRGFVLANERLHTGVGNIYAVGDIVPGVQLAHRGYQQ
    GIFVAEEIAGLNPTVVPDVNIPKVTFCDPEIASVGYSEPKAKEKFGEDNVEVAEYNLAGNGKSSILGASGIVKVVREKDG
    PIVGVHAIGKRMGEQIGEAQMWVDWEAFPEDVAKFIHAHPTQNESLGEAAMALNGTPLHG

    >gi|311111832|ref|YP_003983054.1| thiol peroxidase [Rothia dentocariosa ATCC 17931]
    MYDETARPGSYATVPLAQRQRTRDNEEMAEITFQNNLAVHTSGNLPAIGSKVPAFSVLDADLAEVTGAQFSGKNLVLNIF
    PSVDTGV
    CAASVRNFNKEAAGLDNTVVVNVSHDLPFALGRFCAAEGIENVVTTSAFRSSFGQDFGVTMTDGPLEGLLARA
    VVVVNPAGEVVYTELVPEITNEPNYEAALAALK

    >gi|311111995|ref|YP_003983217.1| dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis family 2 [Rothia dentocariosa ATCC 17931]
    MSFIPDPETTPEPVTQLSAAERAFYARQLILPEIGMAGQLKLKAARVAVLGAGGLGAPALLYLAGAGVGEIIIIDDDSIE
    VSNLHRQVIHTYARSGNSKAESASETMRALNPFITVTVARERLTDTNALNLLTGADAVLDGSDNFEARYAVSAAAQQLGI
    PHIWAAILGFDAQLSVFWAGHGPVYEDLYPQAPAPGSVPS
    CSTAGIIGALAGVVGSAMAMEAIKVITGSGKPLLGEVGLY
    SALTGKWEYIPLLASMQAKPKKSVETHPQESQDTKNHLIFRHNSGKLTGNHHTQKLEDITPVQARQLSQHEKMTLIDVRE
    AIEFSSFAIDGAINLPLTEILEAAREGSLAARIREKVDPASKYLVVYCTGYTRALEAARDIAAVTDIPVRVLVGGISGWL
    TV

    >gi|311112061|ref|YP_003983283.1| thioredoxin [Rothia dentocariosa ATCC 17931]
    MATIEITQQNLTSTVEGNDIVFLDFWADWCGPCKQFAPVYEAASEKYSDIVFGKVDTEDQSQLAQAAGITSIPTIMGFRG
    GILVFSQPGALNESQFEQVITSIRELDMDKVREEMATAEQN

    >gi|311112101|ref|YP_003983323.1| Tat domain-containing protein [Rothia dentocariosa ATCC 17931]
    MNPMPKPTTPNTPLTRRALLHTGAGICATAAGAVLLSACSSSDDSLAKQANSGDNKGYIAGDGSVTEYQEAERGDPVAFT
    GELFDGKTVTAESLRGKPVLLNFWYAG
    CAPCRAEAPDLQKLSEEFKDKIAFYGVNVRDEKNTAEAFERSFNVTYPSFKDV
    TGKVLLSLSKYVPAQAVPTTVILDEKGRVASRVLGQANPSILKTLVETVTKGA

    >gi|311112103|ref|YP_003983325.1| redoxin [Rothia dentocariosa ATCC 17931]
    MPEPVIELLTRPGCHLCEDARLTVSEICAEYGLDYTELDITDNPDLLKRHKTEIPVLCIDGEAKDFWRINPKRMRKILDK
    KLAR

    >gi|311112127|ref|YP_003983349.1| sulfurtransferase [Rothia dentocariosa ATCC 17931]
    MAQNRIILYYQFAPITDPVAVMLWQRALCEKLGLRGRILISKHGINGTLGGEISAVKAYTKETRQYPGFKNMEFKWSEGG
    AEDFPRLSVKARDEIVAFGAPDELKVDENGVVGGGVHLKPEEVNKLVEERGDEVVFFDGRNAFEAKIGKFKNAVVPDVRT
    THDFIREIESGKYDDLKDKPVVTY
    CTGGIRCEILSALMKNRGFKEIYQIDGGIVRYGEKYGDKSLWEGSLYVFDKRMHME
    FTPDTVTIGQCERCSAPSNKFENCSNESCRELVLLCPECATDDAKRRCVPECAVDRQSAHAGIS

    >gi|311112230|ref|YP_003983452.1| mercury(II) reductase [Rothia dentocariosa ATCC 17931]
    MTTARLHFDMVVIGFGKGGKTLAGAYAKTGKNVALIEQSSNMYGGTCINIGCVPTKALVHRADEFRASGEKNAEAADAAY
    ESAVIFRDKLTGAMRAKNREILESNATAKLIDGHARFLSDTEVEVTAGEDKLVVTADCFIINTGAVATIPPIPGARESKR
    VLTSTELQKLTPRPKRLGIIGGGPIGVEFAGIFSSYGTEVTLLEGAPALFGRYDDDVAQAAREIIADQGITAHAGVRIET
    VTDNADSVTVNYLDSEGASKHLEVDYVMVATGRKPATEGLGLENTSIETTEHGAIAVDEHLRTTAPNIFALGDVNGGPQF
    TYISLDDYRVVLSQLLGDGSRSTKDRQAVAATIYMNPPLSSVGLTERDALAAGHTIKVAAKPVAAIAAMPRAKTLENPRG
    IMKFVIDAETDQILGAQLLVVESMEVINLVALAMRHNITASQLRDEIYTHPSITEGLNEVLANAVPVN

    >gi|311112306|ref|YP_003983528.1| putative DsbA oxidoreductase [Rothia dentocariosa ATCC 17931]
    MTSMLNRRTALSLGVPALAVVFSACGNATSNSGSSASASGSSSSNASSSGSASSAPSGDASGSASAGGEASASGSASASG
    DSAKMTATKVGERDEVGYHLNTPKQGAPTVTLYTDYQ
    CPYCAKAEPTYEKVAKDLEGTMNVTVRNMPLSQIHKNAIAAAQ
    AVQAAELQDKHLEMANKLFETQDSWKNITEQTEFAGVLLSYAQELGLEEEKFKTDMTDPKTIDLIKSDFEYGRKIGVKGT
    PQFAVNDKPLENVDSSTSAEDMVKEFKKAAGLS

    >gi|311112353|ref|YP_003983575.1| 4-carboxymuconolactone decarboxylase domain-containing protein [Rothia dentocariosa ATCC 17931]
    MMRANYPELVPESYKAMMALEGTLTLETALKELVKLRVSQINGCAFCTDMHAKEAKLNGERELRLYHVPVWRESNLFNEK
    ERAALEWAEKLTRLDGGHVTDADYQEVRQYFDDKELAELTFVITAINAWNRLGVAYAAVPGSVDKMMGLDKAGLE

    >gi|311112435|ref|YP_003983657.1| copper-exporting ATPase [Rothia dentocariosa ATCC 17931]
    MGNSTQTASTTAENDHSLFDSSANGGQTRIIHLDVQGMTCASCVGRVERKLRKIPGVDPAVNLPLESARVIVPADITDEQ
    IIETVNNAGYTASLKTEVRDAESEETTNARSGGLGWRIVVALLLGVPIFLISMFPTFQFPHWGWVLALITLPVAVYSAEP
    FHRAALTNARHFSSTMDTLVSLGVIVAYLYSLAQLFMNPGLTEHVHPMQGGILGMFLSGNHAPLYFDSASMVTLFLLIGR
    AVEHRTRTRSSEALRTLLSLGARTATLLRTDKRGTTREVQIPVEDLLPGDEFLVRPGEKIATDGTVIAGSSAVDASLLTG
    ESVPVEVSVGDAVTGATLNTSGSLTVRATRVGSETTLAKMGELVAAAQETKAPIARLADRVSAIFVPTILVISLLTLIGW
    LAVSHDVPRAFNAAVSVLVIACPCALGLATPTALLAGTGRGSQLGILIRNAQVLETTYAVNRIVLDKTGTVTEGTMRVAR
    FGTFDDFTEVTDDNASSKSERSVSILSDAAAVEALSEHPIAHAIARFATENYGAFLGTVENFEGVPGGVRGELVRTRGEG
    ESRRLVLVGTPEYLLQAGVPLTEKQHQMLEQTRSEGLTTVAVARAIGTKDPLPVGLIALADSPKPESAQAIAELHELGLE
    PTLLTGDAPEVAQAIASSVGINPENVFAGVTPERKSEVIAKLQDEGYRVAMVGDGVNDAPALARADLGMAMGSGTDVAVQ
    ASDIVLMRSDMRAIPTSLRLSRATLHTIKSNLFWAFAYNTIAVPVAAAGLLNPMIAGAAMAFSSVFVVLNSMRLTRFER

    >gi|311112478|ref|YP_003983700.1| rhodanese/MoeB/ThiF domain-containing protein [Rothia dentocariosa ATCC 17931]
    MNNVPQVTPADVPAGAKIIDVREDYEWEAGHVAGAQHITLGTLTERLSELPSKDEEFYVICHGGGRSNRAAEYLRQNGYQ
    AKNIAGGTSAWFTAKLPMESENGQEPAVVH

    >gi|311112554|ref|YP_003983776.1| hypothetical protein HMPREF0733_10884 [Rothia dentocariosa ATCC 17931]
    MLERQQATQEDARKVQEDGGVVIYWRPGCPFCERLDSSLGDLGNHATWVNIWEDPQAEAHVKSLNDGNAVVPTLDTGDMH
    FVVADRQTREKAATLIRNTLS

    >gi|311112581|ref|YP_003983803.1| thioredoxin [Rothia dentocariosa ATCC 17931]
    MSNAKAVTDATFKAEVLDNSKPVIVDFWAEWCGPCRMVAPVLDEIAAEYGEKVDVVKVNVEESGDTAMEYDITSIPAIYL
    FKDGQVVKKSVGARPKQALIADFEEYIK

    >gi|311112582|ref|YP_003983804.1| thioredoxin-disulfide reductase [Rothia dentocariosa ATCC 17931]
    MSTENTLGNLFGGAALGGLNLAASSTPQEKAQETASEGDQKVHNVIIVGSGPAGYTAAVYAARANLEPVLFASSLSPGGA
    LMTTTEVENFPGFVQGIQGPELMTNFGAQAERFGTDIRYQDVEKLELDGDIKKVILSDGSVHLAKTVILSTGSQYRKLGV
    EGEDTLSGYGVSW
    CATCDGFFFKDKEIAVVGGGDSALEEALFLTTYASKVYLIHRRDSLRASDIMQQRVFDNPKIEVLWN
    SVVSEIHGDSKLEEVVLTDTVTGATRDMKLDGLFIAIGSDPRIEMVKDQLEITDQNTIAVQGRSSKTSLPGVFAAGDVID
    PTYRQAIIAAGSGAVAALDAQHYLENL

    >gi|311112632|ref|YP_003983854.1| ADA regulatory protein [Rothia dentocariosa ATCC 17931]
    MSITDHSAASTDPIEQTVQFGRIAAAIEYLYDHAADQPTLAQVSQAVHVNPEYLQRQFQQWAGVSPKKMLQHISLERAKA
    ALAGQQRTLDAAWSSGFSGTGRLHDAFVTIEGMTPGEYKNGGANLRIIWRYAASPFGTVLIAATDKGICHMAFADNPDAA
    LTNLRAEYPNAQLHEGEHPFHEQALSIFGGGGERIALHLKGTPFQVQVWRALLNIPQGAVQSYGSVAESIGRPGAARAVG
    TAVGHNPVAMIIP
    CHRVIRESGVIGDYRWGRGRKMALLAQELGAA

    >gi|311112811|ref|YP_003984033.1| peroxiredoxin [Rothia dentocariosa ATCC 17931]
    MSIENLRNALPSYAKDMNLNLSSLPRITSLTEQQLWGAILATAAATKVDSVIVEIAAEAKEHLSETAFDAALGAATIMGM
    NNIFYRTRGFLDGAYDDQRANLRMQIIGKNGGIDKLDFEMLALAVSAVNGCSH
    CVAAHEHTIREEGASKEQVNDLIRIAA
    TMGGVAQGIQLAEALG

    >gi|311112812|ref|YP_003984034.1| peroxiredoxin [Rothia dentocariosa ATCC 17931]
    MDRIPLVRRTEECLKAAEVTHEPALRHPPRSGKKNTMAVLTIGDQFPAYELTGVVPGKLAEIEANKPEDYFTTVSSEGLD
    EDTWRVVFFWPKDFTFV
    CPTEIAAFGKLADEFEARDCQVIGVSVDNEYTHYAWRRSHEELVDLPIVMASDLKRELTSALG
    VLNKDGVADRATFIIDPHNTIQSVSITADSVGRNTDEVLRQLDALQSDELCACNWKKGAETIDAFKEMK

    >gi|311112964|ref|YP_003984186.1| NHL repeat-containing protein [Rothia dentocariosa ATCC 17931]
    MSETSNQYSGQDHTGQKTVRVRASELTGRSWLNTGEKSLDLQTLRGKIVILDFWTLCCINCLHVLDELRPLEEEFSDVLV
    TVGVHSPKFEHEADPVALAAAVDRYDIKHPVLDDPELTTWQAYTARAWPTLVVIDPEGYIVAHLSGEGHVQGLTSLVREL
    VAEHEAKGTLHRGDGPYVPRPKTEGTFAFPGKAIELPTEFGPKNLFGTGARTYLVSDTARHRILQVAEDLNTVLATYGGG
    EDGEKGYADGTGTTARFNEPQGLALVPAELREKLGYDVLITDTVNHRLRSLNLRTGEVRTLAGNGVQRVIDGDNAVTGNA
    NHIPADAPATAVALSSPWDAVYSRAAGQFVIAMAGTHQLFGYDPVSETVSIFAGAGVEGLQDGTAEDAWFAQPSGIIEAR
    DGSLWVVCSETSGLRHVTFTRDDHGRQSVQVTSAVGLGLFDFGFVDGDSQTSRMQHPLGLAELPDGSIAVADTYNGAIRR
    WDPAAKELSTLQRGLAEPADLLVEHIPGEDPRLIIVETNAHQLVRAAIPAQAQKVDEGAITTARPATKLTGGTLEFTSRF
    TVPTGQKLDTRWGDPTQLKISSTPENFLLDGAGTSQGLSRTLVLNPEIQEAVLHITARAAACDGTPDGDIPEHAACHLYQ
    QDWGIPVIVTGNAADESELVLDLRGIN

    >gi|311112975|ref|YP_003984197.1| thiazole biosynthesis adenylyltransferase ThiF [Rothia dentocariosa ATCC 17931]
    MDVTSHDRPSVPDVPQILAPKDPAQAQALEAERVLRQDRLPGFDQQAVANAHVLVIGVGGLGCPVVQALAAAGVGSIALV
    DHDVIELSNLQRQLLFGIADCGRAKAEVAAHRAREIAPALTVTVYRRYLEASWILDLLAEENPAVIVDCTDTFATKYLIA
    DAAEITGIPLVWGSVLRYQGSVSVFRTGSTHLRDLFPTTPATLES
    CAEAGVLGATTAVIGSLMATETLKFLAGLPTLEGQ
    LLTYEALSGTFQNFALSPDPERAPVTDLSAYELPKILLDVREQDERETQVKYPDSLHLPLSATTEDAVRAMLKPLAGECV
    GVFCKSGARAAKFIKNWDAVAEEYSITLVGI

    >gi|311113306|ref|YP_003984528.1| methylated-DNA--protein-cysteine methyltransferase [Rothia dentocariosa ATCC 17931]
    MSEKKPKAPQEPINTTTKRWHSLIDSPVGHLYLAASSKALTGLWYEEQTHFPIPDELGEFIPDPSAIAANSEPAPAASIL
    KHTTRELQEYFGGKRTTFTIPLAPEGTDFQLMVWEYLCSVPYGYTTTYGTISHAVGPGAPAQAVGQAVGHNKISIIIP
    CH
    RVLGSNGKLTGYAGGLDRKQFLLNLEEPAEIREGRLF

    >gi|311113321|ref|YP_003984543.1| mycothione reductase [Rothia dentocariosa ATCC 17931]
    MSIKELEIIDGVAQYDLIVIGSGSGNTLIGPEWDNKKVALIDGGTFGGTCLNVGCIPTKMFVYPATTAQKARELNKLGIE
    AEITAINWAQIRDRIFPQRIDKISAGGRDWRAGLPNVDYYPEYAHFIDAHTVQTESGQKLYGRQVVIAAGSRAVLPAVPG
    IDLPQVHTNDTIMRLEEFPQRLVVLGGGVVAAEFSHVFSALGAQVYQVVRSNRILREVDKEVVDRFVEAASHQWNILLER
    SLVEIRENGDGTVTVVVEHDGEVEEIVADAVLAATGRRSNSDTLKASSFFDVDSRGFIGTDKYQRVLYNGSPVPGVFALG
    DVSSPFQLKHVANHEARTVQHNLSHPDSFVASDHRFVPAAVFSNPQIATVGLSEENARKLGEREGFEVTVKSQNYGDTAY
    GWAMEDSVGLAKLIARKDTGQLLGAHLVGEEASVLIQPLIQAMSFGLGVKDMARGQYWIHPALTEVIENALLGLDVDN

    >gi|311113447|ref|YP_003984669.1| methionine-R-sulfoxide reductase [Rothia dentocariosa ATCC 17931]
    MGNSLPGVGKIAKNWREVLKPEEYAVLREGGTERAFTGEYWDTKTEGVYSCRACGTELFRSAEKFESHCGWPSFFAPLAE
    DRVRYLEDTTLGMRRVEVRCAACDSHLGHVFEGEGYDTPTDLRY
    CINSVCLTLEPQKS

    >gi|311113453|ref|YP_003984675.1| DipZ protein [Rothia dentocariosa ATCC 17931]
    MLLSLIILGILGGLITGISPCILPILPVILVTGGADSARTASTEFGQTGIAKDSADNVQALFSRRSAVLGNAAPAPMQRT
    ASRWRPYQVVGGLVLSFSLFTLLGSVILAALHLPQDTLRILGITFLIIVGLSMLIPPLERLLEKPFAKFSKLGAKRSTTR
    GGFLMGLALGLVYVPCAGPVLAAITLAGATGNIGIETVALTLSFAFGTAIPLLIFALAGRSIAERVKTFRTHQRGVRTAS
    GVLLIALSIGLVFNVPAQLQRAIPNYTEGIEQTISQDTQNNIISSSTGGSISSCRPDEEKLQDCGSAPELAGGTGNFNTE
    NQPSLAHMRGKVTLVDFWAYS
    CINCQRTAPHLNELYAKYHDYGLEIVGVHTPEYAFEHEGKNVQAGIENLGIKYPVVQDN
    DYAIWRAYSNRYWPAHYLIDSEGKLRAVHYGEGGHKVTEAQVRELLKAANPQVQLPDPIHKDDVQEETQNAHDARTPETY
    LGSKRAMYFAGQESYANGTRTFKPADRLAVDQYDLNGTWSITPERIEPQGNDGTLRINYSAHGAQVVAGGSGTIEVRRNG
    TTEKIHVDGAPNAHHIVRGDEQSSGVIELKVSPGVQLYSLTFS

    >gi|311113457|ref|YP_003984679.1| peptide-methionine (S)-S-oxide reductase [Rothia dentocariosa ATCC 17931]
    MKSLVVGGGCFWCIDAVFRQFQGVKASVCGYAGGHTQNPDYRSVCSGTTGHHEVVRVDFDESVIGEDAILDIFFAAHDAT
    SWDQQGADRGSQYRSVLLYSSDEQKAVFEAAKERAQSFFDSPVVTEIKPLTEFWEAEGYHQDYYAKNPYQGYCSVVVGPK
    VAKVRKQYAHLLKD

    >gi|311113592|ref|YP_003984814.1| iron-sulfur cluster assembly protein IscA [Rothia dentocariosa ATCC 17931]
    MTETVTELPTHGVNLTEVAQNKVRTLLEQEGRTDLRLRIAVQPGGCSGLIYQLYFDERVLDGDAVRDYDGVQVIVDKMSV
    PYLDGSTIDFEDTIEKQGFSIDNPNAAGSCACGDSFH

    >gi|311113723|ref|YP_003984945.1| glutaredoxin [Rothia dentocariosa ATCC 17931]
    MVVTVYTKPQCVQCNMTYRALDAKGINYDKVDITEDSRALEMVKSLGYMQAPVVIAGEEHWSGFQPDKINALALA

    >gi|311113727|ref|YP_003984949.1| FrnE protein [Rothia dentocariosa ATCC 17931]
    MMRVDIWSDIVCPFCYLGKRNFEIALAQFEHRDEVEVRWHSFELDQNAREDNALPLAERIAAKYSLNLEESIATQEGIAE
    RAQEVGLDFNWRIAKYGNSFDAHRIIHHATAQGKAAEAQEAFKKAYFTQGRSIEKHESIRKIAAEIGLDSRQVDEILAGD
    HYAEDVRADERVAQELGITSVPFFLIEAQWVINGAQPSAAILEGLNRVWTETH

    >gi|311113763|ref|YP_003984985.1| DSBA oxidoreductase [Rothia dentocariosa ATCC 17931]
    MMKGNTLVTTTVDFWFDPTCPWCWITSRWIGEVQKVRDIQVHWRPFSLAVLNEGRELDPGYRAMIDNTWGPARVVAAARE
    LHGDDVLKALYDALGEQIHHQKNISEGDKFLPAIEEALKEANLPADLIQYATTDEYDTQLRASTADALDKVGDDVGVPLL
    AINDVAFFGPVLSPAPHGEEAGKVFDGAVAMASYPGFFELKRSRTVGPIFHGEDG

    >gi|311113873|ref|YP_003985095.1| bacterioferritin comigratory protein [Rothia dentocariosa ATCC 17931]
    MSTRLEPGTKAPSFTLEDYTGQQYSLADYAGHKVILYFYPKASTPGCTKEACDFRDNLASLKSLGYVVLGVSPDKPAALE
    KFTTKESLTFPLLSDADHAVALVYGAWGEKKNYGKVYEGLIRSTFVINEQGIIELAQYNVRATGHVAKLRRDLGIDPK