Roseobacter denitrificans OCh 114 uid58597

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|110677458|ref|YP_680465.1| thioredoxin, putative [Roseobacter denitrificans OCh 114]
    MMDLNLGAAPAADDLIKDTTEATFMADVVDTSQTVPVIVDFWAPWCGPCKTLGPQLEAAVRAAKGAVKMVKINVDEAQMI
    AGQLQIQSIPTVYAFSKGQPIDGFQGALPESEIKAFVDRVVKATGGEAPGDGLADAVAAAEEMLAEGAAADAAQTFAAVL
    GEDEKHAAAYGGMVRAHIAMGELDQAEAILNGAPAEISKAPELEAAFAQLELARQAEGAGPVDELKAAVAADPDNNQARF
    DLAQALHANGDVEGGVAELLELFRRDQEWNDGAAKAQLFTIFEALKPNDPIVLNGRRKLSSIIFA

    >gi|110677599|ref|YP_680606.1| protein-disulfide isomerase, putative [Roseobacter denitrificans OCh 114]
    MRRRDLLVGGGIVAVAVAIPPILRRIPTDFEFEPLPGFAGFRRITGGSVSAASNPFLGLEPPDPSTPAPQRAGSPCVALF
    GPEGWQTGVVPIAIFSDFN
    CPYCKVLENRLMERRDAGAPVRLIWHEMPLLGAASRRSAQAVLAARFFDAEEAARAYLSQR
    FLRPGPVALRAMAHELGLPPDAFAQEVSGPRVAQALATSLDLGRRLGIPGTPGTVIGRTLVIGATNDADLTKLIEIESAQ
    PQMVCA

    >gi|110677621|ref|YP_680628.1| thioredoxin, putative [Roseobacter denitrificans OCh 114]
    MEKHLKAGDTVFLDFKASWCSTCAAQERVINALKAENPEYEAKITFIDVDWDDHGKSDLVKRMNIPRRSTLVVLKGDQEL
    GRIVAQTGKSQIKALMDSALGAASA

    >gi|110677686|ref|YP_680693.1| hypothetical protein RD1_0282 [Roseobacter denitrificans OCh 114]
    MARVIHKFTRNVPHWQPRLTPVKLAEATPEQLEALQVTPSNTKVSDYVLTLAHDVESLKVRSPLFNAIMYDAGGLSRSER
    ELGALAASMVNRCIY
    CAAVHADRHAKIEKDTTTTDALFAAGEKADLNPRDRAIFDFARKSAEAPPTAGAADMEALRQVGL
    SDAEILDLILSAALFGWANRLMHVLGDPVRKTEDA

    >gi|110677699|ref|YP_680706.1| thiol-disulfide oxidoreductase D, putative [Roseobacter denitrificans OCh 114]
    MSRMMIISAAVAVIGLGAYFVTSPGTNPVTPANPLGAANAQEAADIDTSSIMDMTLGNPDAPVTVIEYASYTCPHCARFH
    EGPFKQLKADYIDTGKINFVYREVYFDRYGLWASMIARCAGTPESFFGMSDLIYQKQSEWSRAGDPAAIVDELRKVGLLA
    GLDRDTMEACLQNGEKAQTLVAWYQENATADGIESTPSFLINGQRYSNMSYAEMAELIDAAAE

    >gi|110677793|ref|YP_680800.1| glutaredoxin 3 [Roseobacter denitrificans OCh 114]
    MKNVEIYTSPLCGFCHAAKRLLSQKGIDFAEVDVLADPDRKPEMVQRAKGSRTVPQIFVGDVHVGGCDDLYALERAGKLD
    QLLAA

    >gi|110677814|ref|YP_680821.1| methionine-S-sulfoxide reductase, putative [Roseobacter denitrificans OCh 114]
    MLNISSLKTYALAGMIALGLCVHGTQSHAAELETITVAGGCFWCVESDFERVTGVTEAVSGFMGGSVSNPTYKEVTSGGT
    GHYEAVQITFDPDVVSRDTLYAMFFRSVDPTDAGGQFCDRGDSYRTAIFAETPAQAAAAKAAKANAAAALGVPVVTPVLD
    ASTFYPAEAYHQDYYKGTRLVITRFGPKRQASAYKAYREACGRDARVRELWGAAAPFAGG

    >gi|110677843|ref|YP_680850.1| thioredoxin [Roseobacter denitrificans OCh 114]
    MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELSAEMDGKVKIVKVNVDENPNSPAQMGVRGIPALFIF
    KDGQVVSNMAGAKPKAALQGWIEDNI

    >gi|110677965|ref|YP_680972.1| hypothetical protein RD1_0584 [Roseobacter denitrificans OCh 114]
    MFIIAALYHFTRFENPAALKPALLELCKAQGVTGTLLLAPEGVNGTITGSRAGIDAVLAHLKALPGCDGLEWKEAQSERA
    NFGKMKVRIKREIVTMKQPDVDPRAKTGHYVTPADWNALIAQPDVAVIDTRNDYEVEIGTFEGAIDPKTRSFGEFPAWWE
    ANKHRFHNKKIAMFCTGGIRCEKSTNYLLGQGVEDVFHLKGGILQYLEDIPQDQSTWNGACFVFDNRVSVGHGLQEGPHL
    LCHGCRQPILPADKKRAEYEEGVSCHKCFDQTTSEDKARFRERQKQIELARKRARA

    >gi|110677976|ref|YP_680983.1| methionine sulfoxide reductase A [Roseobacter denitrificans OCh 114]
    MTQERAVLAGGCFWGMEDLIRKREGVISTRVGYTGGDVAHATYRNHGTHAEGIEVIFDPAVLSYRDLLELFFQIHDPTTL
    NRQGNDIGLSYRSAIYYVDETQHQVALDTIADVNASGLWPGKVVTEVAPVGDFWEAEPEHQNYLERYPNGYTCHFPRADW
    VLPKRDSKTQAAE

    >gi|110677977|ref|YP_680984.1| methionine sulfoxide reductase B [Roseobacter denitrificans OCh 114]
    MANYARTQEAIDRLSPEEYRVTQQDGTERPGTGALLENKEPGIYVDIVSGEPLFASADKYESGCGWPSFTKPIEPANINE
    LKDVSLGMVRTEVRSLHGDSHLGHVFPDGPPDRGGLRY
    CINSASLRFVHRDDMEAEGYGDYINQVEDVT

    >gi|110677978|ref|YP_680985.1| glutathione peroxidase, putative [Roseobacter denitrificans OCh 114]
    MKALKSTVAALVTAAFVAGPVCAGARDHQFASIDGGFVDMADWAGQPVLVVNTASQCGFTGQYAGLQELYDTYRAAGLVV
    FAVPSDDFNQELGSAEEVKEFCEMNFGLDLPMADITRIRGKNAHPFYQDVRAETGFVPRWNFNKVLIGPDGEIVDTWGSQ
    TKPMSREITDAVETLLDQASQG

    >gi|110678013|ref|YP_681020.1| anti-oxidant AhpCTSA family protein [Roseobacter denitrificans OCh 114]
    MGLRINDTVPDFTAETDHGTIQFHDWIGDSWAILFSHPKDFTPVCTTEFGAVAQLADEWEKRGTKVIGVSVDGVEDHKKW
    KGDIEHVAGTTAGFPIIADEGLAVSKAFDMLPAEAYLPDGRTPADSATVRSVFIIGPDKQLKLSMTYPMTVGRNFAEVLR
    ALDGLQMSTGKGVATPANWVPGEDVIIPPSVSDEDAKAKFGDFETVLPYLRKTKAPS

    >gi|110678114|ref|YP_681121.1| thiamine biosynthesis protein ThiF, putative [Roseobacter denitrificans OCh 114]
    MSRYARQTAVLGQAAQDKLAGSSVLVIGGGGLAAPVMQYLVGAGVGQIRIADADVISLSNLHRQTLFREADIGLPKVDVI
    AKAMAALNPDTRIEPIRQRVDPANIAALCEGMTLTLDCADSFAVSYIASDYCLGAGQPLVSASVVGRDGYVGGFCGGKPG
    LRAVFPDLPDQLGS
    CDTDGVLGPSVGVIGSLQAQMAIAVLTGDLHVLGQLVTFDAGGMRFGGFRFDTASDPAPNPAFIAP
    RDIAATDFLIDLRAKDEKGPILPQATRHAVSDLGPHGPTPDANQRAVLACRSGLRAWQAADRLSQHWQGEIKLLALGE

    >gi|110678281|ref|YP_681288.1| 3-mercaptopyruvate sulfurtransferase [Roseobacter denitrificans OCh 114]
    MIDDPKTLVSTEWLAEHMKDPDLRILDASWYLPEAGRHAKQEYDEGHIPGARFFDIDEISDSRSDLPHMAPRSEKFTSRM
    RALGVGDGHQVVVYDGAGLLSAPRVWWLFRLMGQQSVAVLDGGLPKWKAEGREIEDMPPIVRDRHITVRFQNHLVRDVTQ
    VSAASKIKDHVIVDARAGNRFRGEAPEPREGLRAGHIPGSRSVPYSTLLNEDQTMKSPDDCRQIFEAAGVDLDKPIITS
    C
    GSGITAAVLALALERMGHRHWSLYDGSWAEWGMFPTVPVATGDA

    >gi|110678293|ref|YP_681300.1| anti-oxidant AhpCTSA family protein [Roseobacter denitrificans OCh 114]
    MTISQGDQLPDATLVQMGAEGPAPVSMAEKTKNRKVVIFAVPGAFTPTCHSAHVPSFVRTKAQFDAKGVEEIICVSVNDP
    FVMQAWGEATGATAAGITMLGDADSSFTKALGMDFSAPPAGLTDRSKRYAMLVEDGKVTLLQEEESPGTCEVSAGEALLA
    NM

    >gi|110678300|ref|YP_681307.1| hypothetical protein RD1_0953 [Roseobacter denitrificans OCh 114]
    MADHSLPTALNLPMQDPLPAHTQKYFDVCMEKLGMIPNVLKAYAFDTEKLDAFTGMYNNLMLAPSGLSKLEREMIAVVVS
    SINKCFY
    CLVAHGAAVRAMSGDPALGEALVMNYRVADLDPRHRAMLDFATKMTQASATIEEPDRQALRDAGFSDADIWDI
    ANVAGFFNMTNRVASATDMRPNVEYHAQAR

    >gi|110678311|ref|YP_681318.1| ADA regulatory protein, putative [Roseobacter denitrificans OCh 114]
    MTQHQTLPQTTEGAYHYQVIRRAIELIDQTDQPISLDEIAANMGMSPAHFQRVFSRWVGVSPKRYQQYLTLGHAKTLLSE
    RFSTLAASHAVGLSGSGRLHDLFLRWEAMSPGEFARKGAGLTIYWGWFESPFGPAIVMGTEKGICGMGFAAEMGAETAFE
    DLAARWPQASYVEDPMMLRPWVLQAFGAKDGALDTTPLFLIGAPFQIKVWEALLSIPTGHVTTYSEIAQAVGAPRAVRAV
    GTAVGRNPISWIIP
    CHRALRKSGGLGGYHWGIPMKRAMLAYEAVELET

    >gi|110678320|ref|YP_681327.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Roseobacter denitrificans OCh 114]
    MTTLPAKTDKKLGLVIDLDTCVGCHACVISCKGWNTENYGAPLSDQNAYGADNSGTFLNRVHSYEVQPDVGAAQLIHFPK
    SCLHCEDAPCVTVCPTGASYKRVEDGIVLVNESDCIGCGLCAWACPYGARELDQAEGVMKKCTLCVDRIYNENLPEEDRE
    PACVRTCPSNARHFGDLGDPDSAVSQLVAERGGMDLMPEQGTKPVNQYLPPRPKDTLPDAGHEFDVLAPFLEPIATEPKG
    FLSWLDKTLEKF

    >gi|110678530|ref|YP_681537.1| molybdopterin biosynthesis protein MoeB, putative [Roseobacter denitrificans OCh 114]
    MLLVFGLCAVLWGIGSLMGAPRSARAMMIGILYVGVLAMHIALPDRHPLRLATGESPALWLLIGGFALVIFSYRQVITRL
    RTRAKAVEKQSDDALDRPLFNTSELNRYARHMVLREIGGPGQKRLKEAKVLVIGAGGLGAPILQYLAAAGVGTIGVIDDD
    MVENANLQRQVIHRDASIGMAKVFSAQAEMTAQNPYVEVRPYNRRLTADIADALFEEYDLVLDGTDNFDTRYLVNETAVK
    AGIPLISGALSQWEGQLSVFDPAYGAPCYRCVFKSAPAAELASS
    CAEAGVLGPLPGVIGTMMAVEAIKLITDAGTPLRGQ
    MLIYDALYGESRTIAIKPRSDCPSCGPLQAKAS

    >gi|110678601|ref|YP_681608.1| RdxI protein [Roseobacter denitrificans OCh 114]
    MTATATNGPASCPGCLSAPAARAEVPLPDAQLALSLPTIHCQACISKVENSLTAHAGVRAARVNLTRKRVMIDAAPGVTA
    QELADLVMAAGFEAHELDLGALSQTQTDAASRDILMRLAVAGFAAMNVMLLSVAVWSGATDATRDMFHWISAAITLPALA
    FSAQPFFRNAWAALRAGRLNMDVPITLAIVLAVVTSLWETGLSGKHAYFDAALTLVFFLLAGRWLDSRARSAARSAAEEL
    TALEVPRAFRIQNGETSEIAVSALRLGDHVLVRPGARAPVDGVVIDGTSEVDRSALTGEAMPVMRTVGDPMSTGEVNLTG
    PLTLEATAVGTDTSLHQLAALVAVAESGRSRYTSLADRAAKLYAPGVHILSALAFLGWLLWSGDMRVSLNIAAAVLIITC
    PCALGLAVPAVTTAASGRLFRKGLLIKNATALERLAEVDTVVFDKTGTVTLGMPRATNWHDLTQDQQSLAYALARGSSHP
    LAQAIVTAAQDDDTAEIALSNLTEQPGFGTQAHYADRPVRLGRPEWIGALVETDGLCTALDTGEGAPIILRFEDRPRPGA
    ADLMAALKRQGMRVILLSGDRQAPVAQTAAHLGMPDFAAEMLPADKVAFVQRLTDEGQRVLMIGDGLNDTGALAAAHVSI
    SPAQALDAARAASDIVLLGQDLMPVADAVATARLATKRIRENFQIATVYNIVAVPLAVAGLATPLIAALAMSTSSLTVSV
    NALRIRGRG

    >gi|110678778|ref|YP_681785.1| mercuric reductase [Roseobacter denitrificans OCh 114]
    MRCQCFPSSSRPSLARKTSDMKRIKTDVLIIGAGSGGLSVAAGAAQMGANVVLLEGHKMGGDCLNFGCVPSKALIASGKA
    AQSQRNASQYGVANGPGAADYAATKDHVHDVIAQIAPVDSQERFEGFGINVIREYGRFISPTEVQAGETVIAARRVVIAT
    GSSPLVPPIPGLGDVPFETNETIFDLRDKPEHLLIIGGGPIGMEMAQAHIRLGCEVTVIEGAQALGKDDPELAAVVLDSL
    RAEGVVIREQTKAAQIKGAAGAIDVITQDGETISGTHLLMAVGRKANIDTLGLEAGGIKTKGNGIEVDAGLRTSNRRVYA
    IGDVAGGLQFTHVAGYHAGVIIRSMLFGLPSKAKVSHIPWATYTEPELAQVGLTEAQARKEHGTALEVVRFDYAHNDRAI
    AERKTTGFIKLMVHKGRPVGASIVGYQAGELINLWALALANRMKMSQIAAMVAPYPTIGEINKRAAGAYYSPRLFDNPKV
    KKIVGLVQRYIP

    >gi|110678818|ref|YP_681825.1| YeeE/YedE domain-containing protein [Roseobacter denitrificans OCh 114]
    MLDLMSESSLVALIGLVGGIFLGFAARIGRFCTLGAIEDLHYGENALRLRMWGIAIGVAVFGTFGLSAMGLLDLQQTLYL
    SIAWNPVASIVGGLLFGYGMALAGN
    CGYGALARVGGGDLRALLIVLVMGISAYMTLGGPFSGLRIWLFGATEPTTAAPSF
    AHALAGATALPVNGVGMAIGCAILALTLLSRELRASTSHIIWGAVVGLTIVSAWAGTQWVANNGYDATRVVSHTFSAPIG
    ETLIYAMTSSGNSISFGTGSVIGVVLGALIGSLIKGQFRWEACDDARELRRQILGGALMGAGAIIAVGCSVGQGLSAFSV
    LSYGAPLTFACIMIGAAIGLRQLILGFSPPV

    >gi|110678822|ref|YP_681829.1| thioredoxin SoxW [Roseobacter denitrificans OCh 114]
    MRKLFTACVALVIMATGAVAANLGDDGLHKAPWMRDTFKDLSEDLAEANAEGKRLMVIIEQRGCIYCTKMHEEVFPIDEI
    AAYIEENYFVVQINMFGDIEVTDFDGEALPEKEMVRKWGALFTPMILFFPTEVEDGVSAGKAAVATMPGAFGRYTTFNML
    NWVVEEGYDADEGFQRYHARKFAEQSK

    >gi|110678833|ref|YP_681840.1| hypothetical protein RD1_1521 [Roseobacter denitrificans OCh 114]
    MIEGLLDQFGEGAVLAGAGALTGVLFGVMAQHSRFCLRAATVEVSTASLGPRLAIWLIAFCAAVLFVQGAIALNVLDVSA
    SRQLSATGSMSGAIIGGLLFGSGMILARG
    CASRLLVLSATGNLRALITGLVLTLVAQASLRGVLSPLRENLSGLWLIEGG
    QGRNIMSYFGLTPLLLSVLAGIGLCLAVVLAQQRAVKGTQAFAAAGVGAAVALGWMLTYAVAQVSFEIVPIASVTFTGPS
    ADTLMGLVNTSDLPLGFGVGLVPGVFIGAGAMALLTREAALERFGADTPMERYLIGAVFMGFGSMLAGGCAVGAGMSGGA
    IFALTAWVALFCMWLGAMVTHVILARVHDRRATLA

    >gi|110678896|ref|YP_681903.1| thiol:disulfide interchange protein tlpA, putative [Roseobacter denitrificans OCh 114]
    MKNIVSALVYTALSLGAITVGTTAHADLAAAAEMRDGDMKKLVFHATPQDTSDAAFFLEDDGGTTTLESYRGKYVLLNFW
    ATW
    CAPCRVEMPHLSELQTEFGGDDFEVLTIATGRNSPTGIKKFFEEIGVDNLPRHQDPKQALASEMAIFGLPITVLIDP
    EGKEVARLRGDADWASDNAKAIIETILARAPS

    >gi|110678909|ref|YP_681916.1| dihydrolipoamide dehydrogenase [Roseobacter denitrificans OCh 114]
    MASYDVIIIGSGPGGYVCAIRCAQLGLKVACVEGRDTLGGTCLNVGCIPSKALLHASHMLHEAEHNFAAMGLVGKSPSVD
    WKKMMSYKEDTIGQNTKGIEFLFKKNKIDWLKGWGAIPEAGKVKVGDEVHEAKHIIIASGSEPASLPGVEVDEKTVVTST
    GALELGKIPKKMVVIGAGVIGLELGSVYARLGAEVTVVEFLDAITPGMDAEVQKTFQRTLKKQGLKFIMGAAVQKTESLK
    TKAKVHYKLRKDDSEHVLDADVVLVATGRKPFTEGLGLDALGVKMSARGQIEVNAHWETNVPGIYAIGDVIDGPMLAHKA
    EDEGMAAAEQVAGKHGHVNYGVIPGVIYTHPEVANVGMTEENLKEAGHAYKVGKFSFMGNGRAKANFAGDGFVKIIADKD
    TDRILGAHIIGPAAGDLIHEICVAMEFGASAEDLAMTCHAHPTYSEAVREAALACGDGPIHM

    >gi|110678970|ref|YP_681977.1| hypothetical protein RD1_1666 [Roseobacter denitrificans OCh 114]
    MGQLDPIEQSQKSPLRMSRRGLLVLAVAGVATGGAVAAQWFNILAENGEAALSAPDVHQAALSGEVVLVDIRRPEEWAHT
    GIGQGAVPIDMRRPDFVDALLAATQGDKARPVALI
    CARGVRSRHMSEQLAAAGFTRIIDVPEGMLGSGAGPGWLKRGLPV
    VVAQ

    >gi|110679167|ref|YP_682174.1| ArsC family protein [Roseobacter denitrificans OCh 114]
    MHLYGLKNCDTCRKALKALPDATLVDVRSEGVPDAVLEQAYHAFGDQLLNTRSTTWRGLDEEARARPALALLKEHPALMK
    RPLIQQGSVLHLGWSKETQAALGAV

    >gi|110679208|ref|YP_682215.1| glutathione reductase [Roseobacter denitrificans OCh 114]
    MTDFDYDLFVIGGGSGGVRAARVAASEAGAKVALAEEDRYGGTCVIRGCVPKKLMVFASEYAGMPDEAQAYGWDMQRGGF
    DWPAFKTKLNAELDRLEQVYRRLLSESGVETFDARATVSGQHEVTLSDGQTKSAKHILVATGGHPVRPDLPNAHLGIVSD
    DIFHLENLPKSVLIVGGGYIACEFAGILNGLGVKVTQYYRGAQILRGFDDEARGLVAEQMRERGIDLKVGTNILEMAPAK
    EHDSTSEGGAMGGTAQDRADLAQMHESAATKGPVWVKSTSGTEGVFDVVLFATGRDPNSKDMGLEAQGVKLGRRGQIEVD
    AYSQTAVPSIYAIGDVTDRVNLTPVAIREGMAFVETVFKGNPTAVDHDLIPSAIFTQPEMGTVGLGEEAAREQEPVEIYC
    TSFRPMRTAFAEKPDRVLMKLIVSIKTRKVLGCHIVAPNAGEMIQLAGVAIKMGATKEDFDRTVAVHPTMSEEIVTMRSP
    MRTA

    >gi|110679356|ref|YP_682363.1| methylated-DNA--protein-cysteine methyltransferase [Roseobacter denitrificans OCh 114]
    MLTCTVDTQFGRLTLREEAGALVSVSWGSAAREDASELLQRASLQVSEYDQGARQQFDLPVRIRGSAFQRAVCDAICAIP
    FGDTCTYGDIARALGVPAQAVGQACGANPIPIIIP
    CHRVMGAKGLTGFSGVGGVETKVALLRHEGAAGLLI

    >gi|110679562|ref|YP_682569.1| putative copper-translocating P-type ATPase [Roseobacter denitrificans OCh 114]
    MPTDPTTMQNLTLPIDGMSCASCVGRVERALKAVPGVSDATVNLATGRADVRFDATLEANALIKVVEGLGYRVPARSVTL
    SVEGMK
    CASCVGGVERALLAVPGVTAAHVNLATERAVVTGVAPVDALITAIGRTGKTAQASNRDAPPVDQVAKRDEEARS
    LRGRVALATLLTMPVFVLEMGSHLVPGMHHLIMTSIGMQASWLIQFALTTAVLLGPGRGFYINGLPALIKGAPDMNSLVA
    VGTAAAYVFSVIATFAPGLLPAGTVHVYFEAAAVIVTLILVGRWMEARAKGRTSQAIQRLVRLAPKTARVRRGSETLDID
    VAQVVIGDVIEVQPGARLPVDGDVLEGSSFVDESMITGEPVPVAKTAGAQVVGGTVNQTGHFVFRATAVGHDTMLAQIIR
    MVEDAQGGKLPIQALVDKVTMYFVPAVIALAALTFGVWLLFGPEPALSFGLINAVAVLIIACPCAMGLATPTSIMVGTGR
    GAEIGVLFRKGEALQALSDVQVVGFDKTGTLTEGAPRMTDLHVAEGFERRQVLARIAAVEAKSEHPIARAIVASADSEGC
    DLPEVSGFQSLTGMGVSARAGGTPVEIGAARYMAQLGHCVAQFAETAERLAADGKSPFYAAIDGRLAAIIAVSDPIKETT
    PAAIAALHALGLKVAMITGDNQRTADAIARRLGIDEVVAEVLPEGKVAAIGALKSRHGRLAFVGDGINDAPALAEADVGL
    AIGTGTDVAIEAADVVLMSGALGGVARAIALSAATIRNIRQNLFWAFAYNTALLPVAAGALYPGFGILLSPMFAAGAMAL
    SSVFVLANALRLRSWTPEPIGQSARENASVDLHPVPVK

    >gi|110679609|ref|YP_682616.1| glutaredoxin 3 [Roseobacter denitrificans OCh 114]
    MPPEITLYTKGYCPHCKAARALLSAKGVRFVNHDIDITPERRGEMIARAGGRTTVPQIFIADFHVGGNSDLTALNSSGTL
    DALLNIKQPA

    >gi|110679787|ref|YP_682794.1| thiol:disulfide interchange protein cycY, putative [Roseobacter denitrificans OCh 114]
    MPKISPLMIAPPLIFAGFIALAGVGMFRNDPNELRSTLVGKPAPPITEVGLEGFEPVTAEAMATGEVTLVNFWASWCPPC
    HAEHPKLLEMAAEGMPIIGVNFKDKAGPAGGYLTDDGNPFRAVAFDPQGRTAIDWGVTAPPETFILDAEGTVLFRFAGPL
    VGSDYEQRFLPELEKALGQ

    >gi|110679799|ref|YP_682806.1| hypothetical protein RD1_2563 [Roseobacter denitrificans OCh 114]
    MPTERIAFAGHDGGQLAARLDLPQGPLVATAIFAHCFTCGKDIPAARRIAARLAALGIAVLRFDFTGLGHSDGEFANTSF
    TSNVDDLIAAHRYLSENNKTPSLIIGHSLGGAAVLKAAAALDSIKAVVTIGAPFDPGHVTHNFAQALPEIKSRGVAEVSL
    GGRPFQISKAFVDDVAQTELEESVANLNAALLVLHAPLDDIVGIENAGQIFSAAKHPKSFITLDGADHLVSAAADAEYVA
    SLIATWSARYLDIARPAPPPGAPEGVLRVAEADPKGFLTDITSGEGHHLVADEPLAYGGTNKGLSPYGLLSAGLGA
    CTSM
    TIRMYARRKGWPLDQVCVDVNHDKVHAQDAETGVGDKIDTWRRRITLTGSLDTEQRQRLLAIADKCPVHRTLERSSTVIT
    ELVNP

    >gi|110679956|ref|YP_682963.1| DSBA-like thioredoxin domain-containing protein [Roseobacter denitrificans OCh 114]
    MTEKTKIDIISDPICPWCYIGKTNLDRALAENPDHPFLIEWHPFQLNPEMPADGMDRRAYLEGKFGGKEGAVRAYAPVVE
    HAKAAGLEIDFEAMKRTPNTIDAHRLIHWAGIEGCQTAAVSALFKAYFEEGRDIGDTEVLADIADSIGMDAAVVGRLLKS
    DADIEDIKARDAHSRSMGVTSVPTFVVAGKHAVPGAQPAELWRKVIEEVSTNS

    >gi|110679999|ref|YP_683006.1| disulfide bond formation protein, putative [Roseobacter denitrificans OCh 114]
    MDGVLNGARLASLAAFGSAALLAGAFLFQALGYAPCQMCIWQRYPHGVAMAIGLIALAVHQKWLRLVGAAAALTTSAIGF
    YHAGVEQRWWQGPTT
    CSSAPIGNISADALLDQIMNAPLVRCDDIPWEMLGLSMAGWNGVLSLALAALWLTAYRRA

    >gi|110680031|ref|YP_683038.1| outer membrane protein, putative [Roseobacter denitrificans OCh 114]
    MLKKLLMACTLSLMSATAPAMALDLNAMSDEERAQFGEQVRAYLMENPQVIMEAVNALEERQAAAQAQADVDLVRQNAEA
    IFNDGFSYVGGNPQGDVTLVEFMDYR
    CGFCKRAFGEVEKLLAADGNIRFVVKEFPILGEQSLIASRFAIATKLEEGRDAY
    KQMHDALMSYNGDITITALRRLADTFGLNADQIEARMDADEVTQELMETRALAQRLQISGTPTFVLEDEMLRGFLPMDQL
    QMIVEEKRG

    >gi|110680159|ref|YP_683166.1| HesB-like iron-sulfur cluster assembly protein, putative [Roseobacter denitrificans OCh 114]
    MFGIPGKPPVTLTPKACAQVAKLMASAGHAGLRIGIKKGGCAGMEYTMEYVEDADPNDEVVEQDGARVMIAPMAQMFLFG
    TEIDYETSLLESGFKFRNPNVTEACGCGESIKFG

    >gi|110680178|ref|YP_683185.1| glutaredoxin-like protein, putative [Roseobacter denitrificans OCh 114]
    MTETTTRIQETITANDVVLFMKGTKEMPQCGFSSRVAGVLNYMGVDFSDVNVLSDESIRQGIKDFSDWPTIPQLYVKGEF
    VGGCDIITEMTLSGELDTLFAENGISFDKDAADKIREANG

    >gi|110680193|ref|YP_683200.1| dihydrolipoamide dehydrogenase [Roseobacter denitrificans OCh 114]
    MASKSFDLIVIGAGPGGYVAAIRGAQLGMSVAIVEREHLGGICLNWGCIPTKAMLRSSEVFHLMQRAKEFGLKAEKVDYD
    LDAVVKRSRKVAGQLSGGIGHLMKKNKVTVFMGEAKLAGKGKVSVKTDKGAEDLTAKNIVLATGARARTLPGLEADGDLV
    WTYKHALEPKHMPKKLLVIGSGAIGIEFASFYNTLGADTTVVEVMDRVLPVEDEEISAFAKKAFEKQGMKIMQKAMVKQL
    DRAKGKVTAHIEVGGKVEKHEFDTVISAVGIVGNVEGLGLEELGVKIDRSHVVTDEFCRTGIEGLYAIGDVAGAPWLAHK
    ASHEGVMVADLIAGKHAHPVKPETIAGCTYCHPQVASVGYSEAKAKELGYTVKVGRFPFIGNGKAIALGEPEGMIKTVFD
    AKTGELLGAHMVGAEVTELIQGYVVGRQLETTEEDLMNTVFPHPTLSEMMHESVLDAYDRVIHM

    >gi|110680198|ref|YP_683205.1| bacterioferritin comigratory protein [Roseobacter denitrificans OCh 114]
    MPEISEKAPDFTLPSTGGTDVTLSALAGAPVVLFFYPRDDTPGCTKESIGFSENREAFAAAGARVFGISKDSIASHEKFA
    KKRELDIPLLSDEHGTTCEDYGVWKEKNMYGKKYMGIERTTFLIAADGTIAKIWNKVKVPGHVEAVLEEVRAL

    >gi|110680354|ref|YP_683361.1| FeS cluster assembly HesB family protein, putative [Roseobacter denitrificans OCh 114]
    MQLPPKVTPRAFERLAEIGASDDGKALRVAVEGGGCSGFQYEIDLDEPKEDDLVLEGAGQKVVIDTVSLPFLADAVIDFT
    EELIGARFVINNPNASSSCGCGTSFSM

    >gi|110680476|ref|YP_683483.1| glutathione S-transferase, putative [Roseobacter denitrificans OCh 114]
    MITLHHCPQTRSMRTLWLLNELEIPFQLRSYPFDRSLRSPEFLTLSPAGRVPALEVDGERMFETGAITEYLCERYSPDRL
    GRSTASPDRMTWLVWLHFAETLSQHVAALTQQHVMLYEDHMRSPIVMKLEAARVGKCFDAIEARLSTPIESRDYLLTSGF
    SAADISVGQAVYMASHFVRLGGYPALEAWYERITAREGFKAALPNGGGIYSQDFYAPWPLE

    >gi|110680644|ref|YP_683651.1| putative iron ABC transporter, periplasmic binding protein [Roseobacter denitrificans OCh 114]
    MKTTHILSSLFITLVGTGALAQTTVQSCNRTVTFDAPPKAAISNDVNLTEMMLVLGLADRMVGYTGISGWKTLDAEMTAG
    VEALPELSAKYPSKEVLIGADADFFFAGWNYGMRVGGEVTPETLEPFGIKVYELTES
    CIHVGEKAAVSMEDMYADLLNLG
    AIFNVSEKAEALVAGYRAELDSFTASLSPLSTPPRVFVYDSGEDVPFTAGRYAMPNALIEAAGGVNIMNDLEKSWATVGW
    EAVVERNPEVIVIVNYGDVTAEQKRDFMMSNPAFAELDAVRNDRFVTLEYVEATPGPRNIAAVKTLAAAFRAQ

    >gi|110680667|ref|YP_683674.1| thioredoxin-disulfide reductase [Roseobacter denitrificans OCh 114]
    MGDTRRTRVLIIGSGPAGYTAGVYASRAMLEPILVQGIEPGGQLTTTTEVENWPGDSEVQGPDLMIRMQDHAKAMGTEII
    GDIITDLNLEQRPFVAKGDSGTTYIADAVILATGARAKWLGLPSEEKFKGFGVSA
    CATCDGFFYRGQEIAVIGGGNTAVE
    EALFLTNFASKVTLVHRRDELRAEKILIDRLMKNPKIEPLWFHELDEVVGTENPLGVEAIRVRHTKTSEITEIPAKGVFV
    AIGHAPANELVKDVLETHMGGYVVTKPDSTETSIPGVFAAGDLTDHIYRQAVTSAGMGCMAALEAEKFLAAQDAEAQADE
    GVAAE

    >gi|110680822|ref|YP_683829.1| dihydrolipoamide dehydrogenase [Roseobacter denitrificans OCh 114]
    MSEYDVDVAILGAGTAGMAAYREAARQTDRIALIDGGPLGTTCARVGCMPSKLLIAAADAAHEARHTAKFGVHAGDVTVD
    GVAVMHRLRTERDRFVGFVKEAVDEFKDDHLIRQNARFVDDHTLELADGTRLSARTVIIATGSRPAVPAPFEVAVDRLII
    NDDVFDWQDLPRSVAVFGAGVIGLELGQALSRLGVRVHLFGMGNAVGPLSDPDLVAYARDTFGAEFAAHFDAETKITRDG
    DAVVVQWRNRKDASDTGEERFDFLLAATGRRPNLDRIGLENTSLVLDARGTPDIDPQSMQARTKSDTGAPIFVTGDAAVD
    LPLLHEAADEGRIAGENAARYPEVYRRVRRTGLGVVFSDPQIAIAGRGHKALTEAGVDFAYGEVSFEDQGRARVIGKDKG
    LLRVYGDRETGLLLGAEIIGPAAEHLAHLLAWTIESKLTVTEVLQRPFYHPVIEEGLRTALRNLAATLDFGPNPPLRCID
    CGPGG

    >gi|110680823|ref|YP_683830.1| glutaredoxin 3 [Roseobacter denitrificans OCh 114]
    MPPEITLYTKGYCPHCKAARALLSAKGVRFVNHDIDITPERRGEMIARAGGRTTVPQIFIADFHVGGNSDLTALNTSGTL
    DALLNIKQPA

    >gi|110680924|ref|YP_683931.1| hypothetical protein RD1_3777 [Roseobacter denitrificans OCh 114]
    MTPVFYSFRRCPYAMRARLALVSAQVPVCLREVVLKDKPQEFLEASPSGTVPCLVTDQHVIDESLDIMIWALKRNDPERL
    LDMPDTGWQLIETCDGPFKAALDRTKYATRYPESDPNEARAQAADYLRALEAQLSGSLFGRATLADLAILPFVRQFAFID
    KAWFDTQDWPKLQDWLAQFLASDAFSRIMPKYPQWQTGDAGVAFP

    >gi|110680943|ref|YP_683950.1| hypothetical protein RD1_3798 [Roseobacter denitrificans OCh 114]
    MATVSLISDEAASPEVLAVFDDIRAVRGTDFINNFWRALAHDPALLKATWERLKVVMGPGDLDPLVKEMIYIAVSTANGC
    SY
    CVHSHTAAAKAKGMSDAQHGELAAVIGMAMQTNGLVTALQVEVDKVFKA